ELF24 N4 (444 Agt % % %/lib/ld-linux.so.2%_ l Q5/OXZ *$b"G] =Ex(BU|,#~ 8t\<mCrJ!^ujz`4 >#'}pa[!$wKk6hWMLvR% 2.YIc-e 3DTVnFs)9f?Ag{yoSqH i+1@NP & 0 d;:7"  d"  $0$ `$+;@ 9< G &M !"S !"Z D,b ",j !x"p ,"w $"|F l !" l <h #p"@ " #L ( \8 ( Xx? `  ^   #xrX $q 5 !<uX  Lyd V $H\  H"c x| $   T, h X x, 8@ H  2 D ?,L Ux c z %  %ĀL  $  '42<h  ( "4 #  #," &P '(! - P5 &? +O '8_ t       $ hh"9 #`"O ,\"e }      "< XP $T  P #' `"/ l7 "= C ,"J $<"O "V !l"` f $0"r P"w \ \ T| t| L <l l   # !" `   @d  L" "\"  "$ + p3  > $9HG &PS L[ ,b  ,"k "t !0,{  $$p #  )! '0! '@P $`"  " " $$   # \  " #L !@" T" 8" $, !T4 ; B DH H$"O "Z ",_ !8i #dr !" "8" $x" " H" 0   !H 8 # $ " " |   x "  L !$" !<< !`p "# ""+ @"2 "9 $l"@ $"F  K #XhT ',[ 'b !(i (u { 0 "P " " $" " 8" #|" $" "" (" "  "  `" pX" #" !" |" "  $  " p"  $ ' " - " 4 d @ " G T N #@" T  Y "" ` #4 h 4 p "D, w H" ~ ( l" x$ "hL DX T T "t" X #(" H" hH" H" !D" T"  L"  T"  P"  "d # '< + "," > ' C  L t( V !x ` D x !4 "\ #< @@ "  T P X !  $  < 4<  xP  #h + '4! 4 '4! < '0 F ) SäH ]H g2x nĀ u & | & L<__gmon_start__malloccrc32strlenstrcpydeflateInit2_inflateInit2_errnofopenfdopenfprintfsprintffreadferrorfreedeflateEndinflateEndfclosememcpyinflateinflateResetfwritedeflatefflushfputcz_errmsgstrcatzcalloczcfree.udivdeflateResetadler32_tr_init.urem_tr_align_tr_stored_blockmemset_tr_flush_block_tr_tally.umulcallocinflate_blocks_resetinflate_blocks_freeinflate_blocks_newinflate_blocksinflate_set_dictionaryinflate_codes_freeinflate_trees_freeinflate_trees_fixedinflate_codes_newinflate_flushinflate_trees_bitsinflate_maskinflate_trees_dynamicinflate_codesinflate_fastlibc.so.6_DYNAMIC_PROCEDURE_LINKAGE_TABLE__GLOBAL_OFFSET_TABLE__fini_exit__environ_init__libc_init_firstabortatexitexit__errno_location_IO_stderr__nl_msg_cat_cntr__dcgettextstrrchr__ctype_b__ctype_tolower__ctype_toupper__pthread_mutex_init__pthread_mutex_destroy__pthread_mutex_lock__pthread_mutex_trylock__pthread_mutex_unlock__pthread_mutexattr_init__pthread_mutexattr_destroy__pthread_mutexattr_setkind_np__pthread_key_create__pthread_setspecific__pthread_getspecific__libc_internal_tsd_get__libc_internal_tsd_set__pthread_once__pthread_initialize_pthread_cleanup_push_defer_pthread_cleanup_pop_restorestrcmp__secure_getenvstrchrmemcmpgetenv__fxstatreallocbsearchfgetsqsortmunmapopensignalsigactionbzerosigprocmaskkillsigemptysetsigfillsetsigaddset__strtol_internalstrncmpputenvunsetenvsetenv.div.remsrandrand__muldi3__strtoul_internal__udivdi3systemgetcwd__lxstatreadlinkmemchrstrncpy__overflowvfprintf_IO_stdout_memmoveprintfsnprintfvsprintfsscanfperrortempnam__xstatrenamesys_errlistsys_nerr_IO_stdin_fputsexeclputsfgetcfilenofseek_IO_getcsetbufsetlinebufvsnprintfstrcspnstrdupstrndupstrerror__stpncpystrncatstrstrstrtokbcopystpcpystrcasecmptimelocaltimestrftimegettimeofdayopendirclosedirreaddirlseekfgetgrentendgrentgetgrentgetgrgidgetgrnamgetpwentgetpwnamgetpwuidendpwentunamewaitpidalarmsleepforkexecvexeclpgetpidgetppidgetuidgetgidsetsidcloseglobglobfreeoptargoptindgetoptgetopt_longutimemkfifo__xmknodumaskchmodmkdirreadwriteaccessfcntldupdup2pipecreatchdirfchdirchownisattylinksymlinkunlinkrmdircfgetospeedtcsetattrtcgetattrftruncateioctlwritevsethostnameselectchrootfsyncsyncswaponmkstempgetpasssyslogsocketopenlogmmaperrorllseekcreate_moduledelete_moduleget_kernel_symsmountquery_moduleumountacceptbindconnectlistenrecvfromsendsendtosetsockoptinet_ntoah_errno__h_errno_location_resres_initinet_addrinet_atonauthunix_create_defaultxdr_stringxdr_u_intbindresvportclntudp_createclnttcp_createclnt_perrorclnt_pcreateerrorpmap_getportxdr_opaquexdr_intxdr_shortxdr_charxdr_u_charxdr_vectorxdr_pointer_environenviron_sys_nerr_sys_errlist__ashldi3__lshrdi3_start_etext_edata__bss_start_end % %t  %4 %5 %$ %0 %  &I & & &E '(F ', '8K '4> '0 '< '@ ' ' ) +J H T ` lt x         n       ,g 8 D  Pa \ hT tq d  f e           ( 4 @ L} X d p |    v G      {    $ 0 <s H Tp ` l x k  A          H  ) ,V 8 D  Pm \ h t           y @ i  ( 4 @ Lr X^ d p |  u   c    o ` ! !  !  !$ !0 !< !H !T !` !lj !x  ! !  ! ! !  ! ! !% !x ! !  " " "  ", "8 "D "P "\  "h "t "] " " " " "~ " " "  " "B # #" #w #( #4 #@ #L #X #d #p #| # #  #D # #C #U #b # # # $ $ = $ $$ $0 $<h $H( $T_ $` $l $x $ $ $ $ $ $ $ $ $l $㿘@/|/|  @|@p#@{^ @|X\*  ɔ 4 ܤ 1@| @WƔ@|2㿘Ơ##    㿘X 8 2 @  f @ b  ]1 @''@{@y1@. 1@.  ( @ʔ@,9 @,4@"R 11@  5 @  `  ` @|@{H&`@ &@`   `."L L  L . ` @{@{( &` @ &@ 0 8 2C  > @z* @{10! @{ T 77 ''''''''''''''А 77"a @yk  @{m  @{1!(@ 0 㾨 7p7r ' X'@z@yA ' @'@z@y8 $' '@zܐ@y/ (' ('@zӐ@y&1!8@  8 2 @y 7p7r 't @y 6p1v!?x?"a@y؀ " $@{L1f!h'tp?x?"a@x؀ " @{:1T!x'tp?x?"a@x؀ " @{(1B!x  ѐ C7"a@xҔ؀ @{10! @z[ T'Đ 7 ('tp''x'|' 't''''1@zoa "a @x  @z   @z1!(@\ 0 &  x @y% @zӰ 1@I!0@xz"a@x~  @z x1a'1!'1!'1!'1!'1!'' `#1 a@ :0  㿘֦ 2O&@! @  @@  @ 1@-"1@-" 1@,"(@Hp @Ք  -` ` `@`2``2`1@ " `` 1&@`1 &@!!@&@ H1@,"Д#\? 2 @;  @A  1@,#h?@2#\#`#d #h#l  @A: 1@,#x?@1#\#`#d#h#l @A' 1@,#?@1ڒ#\#`#d#h#l  @A 1@,w#?@1ǒ#\#`#d#h#l  @A     '@y2Ԕ? @- '    '@y"Ԕ? @- '@  `'@yԔ? @-ݚ '@ " `'@yԔؐ? @-̚ '#\#`#d#h#l   @@ #\#`#d#h#l   @@ #\#`#d#h#l   @@ #\#`#d#h#l   @@ 1@+" 1@+#@J  @@9 #\#`#d#h#l   @@r  #\#`#d#h#l  @@e #\#`#d#h#l   @@Y  @#@D1@+#@CҐ@CT!R#H@*Bܒ#H@*>Ȩ?@'}̀ J@  @xK    @x  &   &   & &@&`  ?& J@  @x*    @w  " &   &   &   ?&   `?1@+S#آ1@+O#1@+K#@FJ@ Ȑ @w @ `@w”  &`@ &@` &`@ ?&@J@  Ȑ @wҒ @ `@w  " &`@ &@` &`` 2   &` @ ?&@&`   2@& $2 0@w @w  2 2@  @`& (  &  & @&z@?0 & (  & &    & 4@&i@t 2`@vE x'p Ȁ  p* @*p*`$ `'p*` p        4 "  @ ܐ  |@)Ӗx  2x'xa@" '|2!H@| |x@In% % 4&` Q!(@I e?@K 2!X@ ? 8* @E\EEEEEEEEEEEE2@vϒap 2  @vǒax   % 4  % `    ` *` @`&`     @v 2@2@**!1@*&" 2@*"!@E0@&@ % 2@*!1@*" 2@* !@M] @Mc@Es @J  2     % 4  %  % @&` 4    2@)ߐ!1@)ې" 2@)א!@EI @#= t   % @tt91 Ȁ" 0"L 40t   % @tt "'p 4?'p2@)"(2@)"8@)" 1@)##\p#`#d#h#l 2  @EL  ?  p  4@"ep % 4  ? %   ? % &@V&` "LS P2L 4 22@)U h2@)Q" ( @ _  @%e @)B p2@)>" ( @ M @&`@զ2@),!@))" @D@      % 4U "V       㿘@vY`$ @vT`( @vO`( o ?#`2" ", `, @u `(` @*7 㿈@2!`@v5` P@v0` K`@u E 2 " 22"#4`3@v` .@v` )`@u` #`@uZ  @4@u`  ?'@uj`@) @u`   '@u^` @)ݔ ( 8 d2@uc2@u4c( 2@ d#0T 2@tcX2@tch` 2c@t``2@t|c` 2c@tt` ` `'@u2@tdc2c@t_`  ` 72. @ '@t@tF ` &@t ( 8 m 2@uc2@u7  23 @Y 3 (@2@tc( 33@  HI  h@3@t ``  9@u=`@u:` & $"`@t` 2` J? .2@t| *?'@t3``@sޘ@uA0 '@t3`@s`@u `@t`@tv@sl ( 8 N 3@t`@  @t3@ > 2@tGc( 2@2@'!3@'!@t@r@B%  3a0@s` @  ` 13, @ '@t1@s|!@ ` , @t @s ( 8 [3aP@tL2@sc( 33@'9!`@ + 0H!@J3a@sP`4  3a2`3a@sA` "(`'@s3@s3a` '@s3@s*b`('@sא3@s!b`$'@sΐ3@sb 3@sb0@s 8 8  3@saP3@sb@  @t 3@&ѐ"H@ ð 0&& &4%ɐ @r= O L* @ "L L * L " #@t?J?* @  —J* @ 2*3"`@r  3 @s@Ģ`"h@r  3@q "p@rݔ  3 &4"@rӔ  3 &4"@rɔ  3 @s `"@r  3 @s(2@s?`0 ` & "@r } @r$w`@ &@`& &@r @ ` ?  3@5"ܰ "4  @   2) 2  < 3@"0 `? @ 3@%#1@%" 3@%#(@AW 3 3 < 3@%Ӑ##\? 2 @5   @: 4@%Ð  @+#\#`#d #h#l  @:L 4@% @*#\#`#d#h#l @:8 4@% @*#\#`#d#h#l  @:$ 4@% Д@*֒#\#`#d#h#l  @:  !4  @' 'ؐ   @'  'Ԑ   @' '̐   @& '#\#`#d#h#l   @9 #\#`#d#h#l   @9ך #\#`#d#h#l   @9˚ #\#`#d#h#l   @9  2 1̒ @' В @' 1@%" 1@%#@C  @9\ #\#`#d#h#l   @9  #\#`#d#h#l  @9 #\#`#d#h#l   @9|  @&1   @&*  $'@q@&  $ '@q@& Rb@#PȐ @ @< 4@$ @<ɐ@ 䀢 "0    0+' 0(% @"А!Ȧ4@"̐" 4@"Ȑ"(1@"Đ#4@""0@>Q    ? &@ 㿈 ` ' ؀      @ F   1& & & &  & & & & &  $&$ (&( ,&, 0&0 4&4@&`&`&` & `&`&`&`&` x& @!  s #\jh 4f %   " $0Z0  R  "   0HC 0E#\Қ ր? ?5& & & &  & & & & &  $&$ (&( ,&, 0&0 4&4@&`&`&` & `&`&`&`&` & $&&    㿘'H'L'P'T'X@H㿘'H'L'P'T'X @H㿘! ܀ 4@mb ܒ@oC 4@mb@m ܁㿘 !4!4"4@nrb "`"!4"4@ngb"`ܐ"  "4@n^b"`ܐ"Ȓ @n"c4@l"؀  "`㿘 ܀ @nS@n#'L'T ?'x@nՐ#4"x@l@nВ : 4{#x 'l. 7Đ@n  @ 24??'|@n|`4#p@n@n #4M#xyxL@ 4#4#p 4c@n.@mՐ&!ʐ# @m!d# $ 8$ < <$ @ $ D$ H $!\ 'h'`'da"'\ 'Xa"'T 'P4@mc 0ʢ#@nZ =    @l[ ,4@mؒc 24$`,@mВcȀ 24 $`0@mȒcЀ 24$`4@mc؀ 24$`8@mc 24$`<@mc $`@5@m` $`D5@m` $`H5@m` $`<$`@$`D$`H5@m`( ʐ5@m`0 ¨5@m`8 5@mw`H   5@m`X@kː5@mg`` '\5@m_`p 'X5@mW` 'T5@mO` 'P5@mG` $a\5@m?` |5 ^x 5`@l    5@m'`Ѐ d5@m!`؀ ^5@m` V5@m`耢 M`?5@m ` E5@m` =5@la `?3'h5@la `?)'d5@la !5@lޒa `?5@lՒa `?'`4#p5 5!(x 4@lUc ֐ʒ#@ 2 `2 h2 "`(d"ʐ "`(ʒ#`( @"`(ʒ#``(""`(ʒ#`4 2ʀ F "`4ʔc "cT L  `"7@?А  7@k'@E 4#Hx 77?'xx\X @lu  7'x'''p't\Xp@k 5@kY!Hx@j$ '''p'tp#\@ ] l] ̟ 5@k a`{x " @5!pAlmx''''''''     @j 65@j!Kx@l:  5@j!Ax27 o7  T@jsP* 2  "(7ʐ#"  " """ """" L" L"""  \@k6! `@  @@l9x0? `@ @@l*x @l% 㿘 䀢?  * @ @i  *?2*1ː!5@kaа!㿘@k @ 㿘@kb 2@  2  `   㿘@k4$@ 㿘@k+ @ 㿘 ]@kᔀ@ 㿘  ܒ` `@  㿘 ]@k@ 㿘˒ `@  㿘 ]@kex@ 㿘  Ԓ` `@  㿘 W   €  2#@@ks ݐ@j'` ؐ@j"` Ӑ@j` ΐ@j` ɐ@j` ð "V`"V`"V`"V` "V` "@j` @i` "   €  Y `R@"` c  €  2#@k @iВ` @i˒` |@iƒ` w@i` r@i` l &@6`6`6`6` 6` @iƒ` V@ia` "R   €   `  @i@# @ > `2@`4 @jĒ .@ix` )@is` $@in` @ii` @id` @i` @i`  `  @i#@  㿘@jh o ?#`@h-5@i(a5@"5@"@j0@hB@8f㿘'T'X T #@jj@h@h @J ?@,4 @@. @@jL@@@ @U㿘  " @h "  2 㿐N sT hN  d2ON% ?  6@"`6@"h6@"pԖ   N ?, * * *`:` ?,  N ?, N J  "N ?N  ?Р   : `@  ?{$ hCN  d?N  a% ' b c! 2N   d2N   e2N  ! f2N   ! g2N  " h2p  " @N   N  "N ?= :?76b@hi    % N  *(?"d!#, * @hݒ bd , "d3!, @*`@R`R`` %%@hB,`: ? @h 6 @"`6@"h6@"@h@g@7% 㿘6"@hx '  * *   " **` *  #x* ?#x   * *  `2 "'**@ *` $% $**$6@e"6@a"Т6@]"h6@Y"#\#`#d#h#l   @7  * * *` &@6"S  ?㿘bp   "bp6##   5@_c'L ? '`5#6# 'p/t'x'|'6#0'/ ''''''''p@f~ <`  ` 6   6#8 6#@#P6#X`@ = 6#@il6#6#@ h6#ޔ` h'l@ff*  -` h@f3l@f/- @h3l@h1h'l L``  ,l @@ l,`@ @g@ @`@&@6 7l,` `  @a 7@gf`(  6 x,`*  @gZ ``` ,``,`7 0r?@*`7 Pj  <    2-,`* ',`*  @ 2 @  L`27@+ h6@'"h7@# p@5 ~, l,@>@,@s@􀤀@gl`  @ -656  `d@0` ` ''d`@8Ә@9?7@ @ݐh7@ِ @=, @=2@5B0Y@:c@:` @:[ @`@h7@ @5'0>@f' > ,`*  @e "`@f ``` ,``,`@`@h7@!@40, 7 P@ @/   `@:3x ` L` !7\” \ @   @V!(H  0 L  L@ :"`L@  :, n ?#`9 L 4@f :  $@@e-` @dI @Q  1,@0@0),@ff k ?#`%@@d*2L  `@ 2 " 7,@ @7!` 㿈7a'''' @|㿘 @ 㿐 @f! ?#`7! !,@ `,` `,` `,` `,` `,` `,` `,` `,` ` ,` @dϒ7@d˒a '@dI '7a"" `U" @e k ?#`@c C;ɐ * b :  " L L* @ *L -`'`@d*`' * b: @     L* @  *  "?L , L  *  "@@u @e0^ 8 Z ` w 2 687; <   b@cO  7a@ @e7'!@  <  b@c4 & @$$ $ $ $ @d$ $ @  <  b@c   @dM 㿘 2@c{ &&㷨'$#X#X " @d "   "   @`&@`@d'*`&@*`@ "@* "@   @?&@9$ (  " 77@!@d '$@#0@d '$8@y 6@u"h6@q"bd#\$#`#d#h#l( 7  @3-  $]?  @`&@`@cғ*` &@*   "?@*  "@  @ @?;&@     2*` *  ?#x*`` # x    @ ,@*`%@ @ ,@ "`$@ "`   "88 0 H@,@*`%@ ,* @,@ " $@  " ,* @"`%@8@ X8@ H6@"h6@ߐ"#\#`#d#h (  @3   ʰ2-@&@`@c@*`& ! * @`@c ",`@d  ,`"  ,* @ @d'  ߑ,&@-* @  4" * :  " "*` "  L*  *` * :  "L*    `" L L*   L  @&@`@bԓ*`&-* @  E#ɐ * b :  "  L* @ * * : `")Lb*`   " L L* @  L  ,@bʐ ,"@  ,@b ," L  &@,"@ 㾘@a$8@b`p8@b` 8  'ɐ @a_ @c=*?8`@b=  d# O‑* @ N " 8 N* @ 2N8`@b  8   `@b  c  c`" 2 " 2 * ‑: @     N* @  N @bl   $ 8`@aԔ   N‑* @ J yJ* @ "JJ n` * @b?   2 ^  Y$ @b  㾘 8 @`[8@aV`p8@a`  %ɐ @` @bx*?8`@ax  E8`@ao  8-@a$ $ $ $  $ $ `@aZ  Ґ * : @   " N N* @ N @a$ $ $ $ $ $ 8`@a.    @* : @   " L@`L@* @  @L@ ,@@   @a   2 @aH$ $ $ $ #$ $ @`7 $  $ @a:` c"`@aP 㽘 8 8  8  @_8@``p@a 28s!@_8@`|a @`d@a  `8<!(d _#8`  "`` 1` 2`8 aP $8 a`@`F` `  88ap@`4` a@`-` "`` 2@` 8a@``  , a@`  `&`8@` a@`2`@` 㿘@A㿘8y!Ё㿘8s!؁㿘!$!|18k! 8ݐ!!$!|18`" 8Ґ" "18U"0 8ǐ"8"0"a|!|@ 㿘@`S``@`2``H  " @`` "  2  4@`  k ?#`@^ @`Ր@0 :@J@ :@ ?@@@@ ` @@2@@&@@`ؐ `8"X@` 6@D"`6@@"h8@<"p@`s@^@. @_',8b@`0@_p 2   K8@_" 3 X8@ "@^3@`A-8"X+8)8@^А J` .` @_ @_c9@_@_# @`VX8@#@_2 8X8@ِ#H@]8@Ӑ#h8@ϐ#8@ː#8@ǐ#@.YX  ?2& & 㿘     ?? ?H8#@_  @_ϰ @]8#0'@^ O  @_ @]8#0@_,8#9@^` 99 @   ?c8'D  0@^%8#@_  ?@_@]8# @^  @_y@]8#P 0%9L ! 9G 0D!09 x?@_ @_?@ *J@ ?# ;?#L J 2*``` 9ڠ#`g9Ԡ `@^ ɢ ̠9 @^P  9@^2`    @]M  9 В@^; 9 @^`  J "*@\L#8*` ,`  *`c: @ `*J  `9@]a x9J "*9@]Òa8@]p !@@]  e,9@]גaH (-:  -9aX@^a<`@]5 , <  `@^ *:9a`@^ra,* ) 9@]ah  *9a@^]:,*  9@]a `*9a@^I:,*  " L  @],, %@]$ $ $  L  ,* %" * @@]*`D# @  8  !9!@^5  9!!@\  @^+ @^, @\>9!9a9@,^0@^E @^ @\+9!9a9@,K0ϐj ?#`@]%@^F̀9!99795939- L hL  dL  :@\Y - *%@ 9 a* *  *  * @ *`L  L , L  ,L ,p$@\3`- , @$ @\ *"@\ߔ  @\ٔ  @\Ӕ   b@\͔  L "@\   - * @ ," @\   - * @ " @\   - * @ " b@\  - * @ " * @" - * @" "   2  @\^%  V- * %@@"  * @@\*`'@ 㿘  @\㿘 `@ `   2 ? @\` 㿘  $k@[W؁"" " " " "  @" " " 0 ,` ` "  "` ` @&  ?@ג\"?9@ '  @+ '9,` `,` "`,` 8 @\ @ "` '` @& @#ʒ '@#\#`#d#h#l   @$ #\#`#d#h#l@   @# 㿘N@ / 9@S"H9@O"X9"`L  " @\J? /2 9@="H9@9"X9" "*`:  @"L L  L  9@"H9@"X9d" L9b@[t  :9b@[m  39b@[f  ,9c@[_  %9c@[X  9c@[Q  9c@[J  9c @[C   9c(@[<   9@Ґ"H9@ΐ"X9#0 9ch@[&   9@"H9@"X9#p@ @*%0 㿘 `@\,` @[R㿘@[` 2 `` @[ : "`@[`  k ?#`@Y` @[ :, @@Ԕ `@Д ` @[`  @[` ``@ h 9@a# 2@Ғ @ 9@В@  9@@  9@@    @ޚ     @֚     @Κ ''''''!m P@  P@ 9@"X @" :@   @ #\@@ ؐ@ J@     @" <&  8&  4&  @[]@[1ؠ@[.ܠ@Yx &:`@Z@l?@2 㿘 "@[A " @[;  " @[5  @[/㿘 * ߐ   ,   @[㿐  @'@Y3 T' '*` @Y+* ' 􀤀A,*  3,, "@@"`"` "` "`"`"`"` "` V @"` P"@J @"`C @"`&',@@Y*`'%%  8'''': '@Z p ?#`':  *@ *` *` *` *` *`@Y8"t : ':@  (@Z :@  P <  U :`X@֔D@@ 0 / @8    /   @!   @' @  :@ Ȑ h#\? 7 @  *` r ?#h`r ?#h 3 * , @*`  ",,, *   , :a` @Y `?L @ ), %@ %  &`$  @Д@ƒ @ @  #\ @%ܚ@%ה :@ _!x"t   *   @ 9@ O"X:@ J!@+  @    @%ޘ @& @$ :@ /!@$N@#В @@@ ?, * @L @ "`   &O ""t "bt 㿘  , *   "    & 㿐#\@ 㿀':@XΒa`?:!Ȓ 8 :#\!9bX::@'; :@Xb8 )@?@Y s ?#h@VڒL  J@ : `J@  :J@ 2*@:"P鳒} :"hx @2$'N /02'Ƞh:  , `,  `,  `,  `,  `, @Wђ  0P':"~쀢 :s"Ȁ#0;@`:"g@X8쀢 $  :@X| @Vɐ":@W]c0@ 8#(9@ 4"X:@ 0#0@Xg@Vy@&  v 㻰:@WM#H  @6Y +:#PcP' /,`, @@W,`    6:,`* @ ,`:@X  2$" ,`* @  ::@  :  " #`@  #ܒ@H` @cP 㻰:ΐ#:@V#H 8 2 ? .-:#P,@*`` " P' `/@V` " @W "@W#:@Uאc蝒$:v#覄< 㿘@Wא k ?#`@U 8  .  /@W˒ /  .@  /. @@ 㿘@W  "+ N  J@ / `J@  /J@ @W!@Wp; H `  @Uu;; (  ?#"@; 8; `;) ; @Wn  ?@WB@UT;: c @VW/ 6 ?@W3@UE;+ #*;@V:a0 %?J@ "0J@ 2J@J@ "`*@J@ /2@V`?c" ;!8 ?#@ ;aX@V#  2 ?#@ Ð 2$ 8  ;?#@  @W-绐!`;!x;@V]a ;썐!;@Vb;穐!;!;@VKaت  ?#@ ";@W;r!  6b#\r!D, @*` ` Q  ;"`? 6 * ɄȦ :#X, * : @V5cH  :!;" ; ";" ;"( `2 , * @@` #\#`@U@  &#\#`;0;8:#X;@U.bH?#@ "6#\;"P@Vy!퀢 " ?@V5@TG; "`?#@;@Ub " #\@V#@T5;"#\#`;;;!0;@Tb?#@VY@#\#`;;;";@Tb@U 㿘  . @*`@@U "   & 2   $ * @@U *`$@TG $$. * @"`"`"` " `"`"`"`"` " 㿘 @ 㿘 @`  X;c@Un0X@S@U 2   @U@`@ 2  j ?# 8  `;c@SĔ $;#0 #0, `,  `,  `,  `,  `,  `,  `,  `,  ` , @TQ;@TMc@ %;@TE@@TB@`@  8 / - ;@H  ;@P  ;@X   ( @_ D@ϒ @J@ @Ȑ@@@ư`?X@U  @U?@S$;#`@S;#x;c;@#=0ې`;#Ւ ;@S@U@SҒ@U,#@U  ;#@U" `;#@U"` @S ;#@T   ;#";# @T@T 2@T @T @T `"@R;@S#@S  @S @S @T@T@Tߐ`"@Tڐ@S@T@R;#j@T?@Tʐ@TȐ@TƐ`  @S Ȁ`@R @S`@ @R ,@@T'@T@RW T ?T?#> 㿘   '|ؐ@R5 74` @S̔  @SȔ T'`'`'` '"a@R& <A "a@R؀ <7 ` @S "a@R؀ <) ( C7"a@R؀ < 8'Đ 7"a @Q < H?c |@R    @T-< X@    5  2?     2`?2??"  2@" $ 2  @" ( " 㿘` ?&`` ?&` l@Sǐ "`@S&`0` ?&`  " ` @&` &`, &`` &`  u! @ ` @? 3`*  ל  ֜       8            l                       &    *@ @ *`@ *` *` *`  &  C& @.` `.`! `.`" `.`#` 7&` @Q & @Q\ * *& @.`$ `.`% `.`& `.`'` &` @. `. `. `. & @Qe &@Q7* &<Ő h @ @ 2` @㿘#@R@Rנ@P@R $b | %"|!  #|b @ !@S "xb $|@Q,$"x@R!@P"x<`@R"x<" * x @R/"@ .ؐ@P"a'@P  < '.  . 6 6 6 @R& &   J   ?"* *@  & . @R "6  \   p6 *   * v"@'\!,'\\ @Q \ t'''&@, @Q   ?  @Q @$@   @P A ;< '\"@ `@P\ G<@-N )NN$@QZ <`@QM  ` `'@d'`h'`l'`   Ȁ" 2<< А @ @R<  㿘  ` @  ` @`@ @  ,@`,@`@O ,@㿘  ` @ ` @`@ @  @ ` @@Oג`  㿘<e!@Q"@Po  h@Q  3͔d 2  :Ɣ` " xd*`" 2 '` x'`w @P}a|@Q d @P#"@@P ` @Oϐ"@@P   @Q0/_ 5 y_`'Đ 7h C7j 6l #\ <xʚ  x@On"@<!@P@P  Ц@P  @O 6<%!0 o` h /G 5 2Gؐܒ @P  7ؐ D7ڐ@O  <!8 v 7Ȑ C7ʠȐ̒ @Pk  #\Ho 8 7 C7H 6!쀢 @Q1<R!@ /G 5 G 6 H 2 X.'@ 3 ޖ@ #\9 H@Pې0' 3< 1< !h< ?  @O H@PHϔ``@ &`,`@&`@P  @N 6<!0 2 + @Oߔ  7 D7@O;  <!8h( 7ؐ C7ڠؐܒ @OƔ ?#\HʚȰ @Pl0@PiHx``@ &`,`@&`㹐ɐ "c @" U 2S??#@K?. . . .A @ @: ? 73@0*    *    @X$ ` 2??@O@N: &@M 2?`2??ΰ ?㿀ɐ "c@OԐ k ?#`@M@Oː ~ ?#` L  J@ ."@`J@  ."@ *@*"`<a@OR f   㿘  X8  @O  <@%"@<@!"P<@"X@OT@Mf@1 @OS̐k ?#`@N^̀ <@"@<@"P<@"@O.@M@@c@Of  @Ob,@!- @M* $#!@M-`$#L 1'/;9@O4 2 @O& , "*`:  " L   "J* @ "J8JJ"* @ "**L  #<@Nb .`  L  @N;"c<@Ntb  >2L`@M-`%L @%* @ "`  "*`:  "L L  L m.`@N*`" `c$* @"`@M*" V$@"K < 2 <@2"@<@."P<""@N@ "    2  2c <@"@<@"P<"@@|.` c  - @#@Mz*`'#c #* * """'c .`  L 2   6  ((  ( `  6  +  (@  +   6! c+  (@2 @"c+  (" c c ""@㿘# o <ސ#(<#P"@MԔ! <@n#h<@j"P<@f#p@M@K@ӔN <c@Lv !@M#@Lo#@M#@<@H#h<@D"P<@@#@Mw@K@@M<@L#P# @M@L  !<@LZ#@KJ#<#ؒ@K @MV@Kh<.#@MT @KB <@L#P @  @ ?㿈   N  J@J  *` * @ @'c  {@KS" 2 x'!# " @M[$#"#$"c  @ K   2EP 4'=Ӑ"8<P= *  @L`   '쀢  ="pݸ`!P!= *`@="`@L  *`@="` @L *`@="`@K @r 0nPp = **  &*&=@JՐ" =' #=*  @Jɐb@LR   '쀢 "'#\#`="#d#h="=b (  @ 쀢  !==@Jk"=@Jh"=@Je"0% *`@="`@K *`@="` @K *`@="`@K @  *   @ 㿘 @ ?=@Jh"  !=@Kb `!# @Lz$#"#$"c  8 0=c0=c@K=@M c( 0@L @J=#0=b=8@?0=cx@K˖%=@ @Pߐ =@K   =#0=b=@00f=#@L %@K@I=#0=b=@ 0R#1,@J  =$c @ #` $$* @#@J*`&#c #* @*`," @ `@J˔ c #* * @`* : @J c #* * "@JRc #* * @R``* c  $c @Kɐ=@J##c  {@I␁?a 8 2 =#=@Lec( @Kh@Iz=#0=b=@ %>@U @PA 2y @KE  2s > @Kn )?@@J_?b@ @JY"!?!@@JR ?a@ $@@JJ*@Kk ca@I " ?@K@I1> ? ch@I  " ?@K @I> 8? cg@H " ?@J@I >ѐ X? cj@H " @J@H>۾ pɐ">@IĒ` 㿘=@I" 8 2M `H @J ?#`>`@J>@J?`>`@I>`@I = ,  @J`    ,   =`,   >@I|`؀  =`,   >@Io`@J 㿐5    &  "  *` *    `*` *  2  㿘 ؐ  >! .  2 >  [>!0&>!@ # >8@H @ 㿘 S 㿐U "% ꉐ    &  "  *` *    `*` *  2  x '''􀦠    @9܀ @I   >!X>a`>h@  >!h@Gݒ  㽠 @H   >@Ia`? 4 `ɐ">@HaK @I  #>!>!>@Ja褒 @H / 2 >a@Iq 2&  &`@H >!@H@I?@G}  2 ??#> @% @H㿐>">" 8 j @I ~ ?#`>"H@I @HW>"P@I!>"X@I!>"`@I!>"h@I!>"p@I!>"x@I!>"@I!@G@I~>">@Hm"@G`>b@H"@IP! >k"@IE@H@I]`>#>#>b@Hߔ`2 >@Hc` "#@@G0 >#ے>#(Ւ>#@>#H>#P@$"@I ! 6>ٻ#>#"@H! 6 @HҦ @F>#٩@|:!T !@"@b! >>#s 0ٓ#@1@.  @ %?,` @H[ 2 `@@`@& %-?,`J` "``@H8 " @d@_,`@ `@&@Ē @>$#@> #H? @{ @@HL @V@T 8  ? 8>cH?@x@; @? ` @,` @*`@@P@Hl`߫@?@Ϙ@@HM#@ "?@G?ߐ x 㿈#@#@ ` ? ? ?`@F@9 ? ع#@ 8?`@F03@G 61@G@Eڐ?!؟>#@>#H?}! @E@!#@  @E#@?a`@F@> 0Z?@GRa " `@?@GKa "`@@GO @E #\ `@Ec@Eߒ @G`+@Gv@z?!M>3#@>/#H?+!@zѠ@!#@  @Ei#@?a`@F8@G@  @F| 㾘@Gc!2 ?#`@G] ?#`?a@G@G$  ?S"?b(@F?"0?8  ި?@`b@ z?bH@F۔@G/ 6 /0@G@E?"Xڒ0e0@F @G6O0 L    L  ?L ?"p׳0>?@"׬` @O`Ś @ ,?""? /@E0?"׌  ,  @F_ Ҡ &?@bЀ @Fy㿘@y  !#@  @y#@?@Elb0@y\@??" <@찒  @#ˤb0$b0 ?@@b0  ?@{@|b0  ?@s@tb0  '?@k($  @f($   - @p @$     d@ Ŕ 6$  ?@R0@Sb0  ?@Jh@Kb0  ?@Bx@Cb0  ?@:@;b0$4$<$8$@@E $H?c@Eߔ  @&@'b0  @($  @($`#@?c@EÕ:%ˠ0  @@ 0  #?@c($   @c($ $ * @c($ 0 * @c($ ( * @c($ ,>`    @ P :$  #\ #` #d $#h (#l ,#p 0#t#x0   @) H# @m\ # @mV # @mP # @mJ # @mD ?Q#'?c@EQ%ˠ0 @ɒ?c@EE2  @ @ $ D  @  @T0@T`!ˠ"0 8$ 8 @ D $ @%?@E# @ 4 8@E"  @ @%?@E2 @ < @"@E2 $@@DՐ  H" @b (@w @ 2 "l' ?#؉B"p' ?#؉Bą'#"'@8!ˠ"0 0@K@0$ ,@E @   @  @㿘`!˒  d"@"0. * @CL*      @ @㿘@<㿘@CL.@D.@CE <@D <?c@D㿘@Di@㿈#@l\쀢    @㿘  2@   `"?@C 㿘  "( @  "#?@ @C` " " @  ?4 @@@㿘  @B  .& ,   "@C " ,       @Boᄠ   , @  "&   , & p' @B '@!@C @Ɛ!0 @D"@B @DJ@ٴ!H0@c@ٮ!@D?@D%ư @D"^ ?#` ! @h@ٻp@!L . @L ?  @a@C @C 6 @C!@@A!Ԗ0x @d @C @!ԇ 0i@B,'@B *`" * @"@* @* @C *` "`#@k5#@k/  * @"`* @" @% * @* * @ *` #@k ܀ "'@CwԀ 2'* @"`* @"` '@C>$@Aϐ ?2]L ؐ&@&`@Ca@閰 h '̴@@Bb  @ې"Ͱ 0: @AN @ΐ"8l@@BbX @@Bb` @"h@"p@"x@'@B|  '@AS d'' 7ɐ @A ר @B@J "*O N* @ "N N * N``#"ސ2t?А  @u"h@q"p@R"@2 `-`@@A*`'*` *  N 1`?$ $  ‑*`:   N @b@A  2N  ‑*`:  "$ N $N @$"Т@ "p@"@s@AĐ$$ @@ x$ h @@Ac 2'Ԯ @@Axc " V'  @@b!< 2@"Т@"p@#@S:2 ,@ @AQ*`$  *`"  &$@A.*  '"  "`   ` * *   * `&` '@'`'` 㿀N`N`@` 2 ``` 2` " "` 2` @ "`.``@c@@A2 `@@H'L` @#H@Aɐ@AΒ /`?*` *  ?#x@[#P@O @V"p@Q#@! 'Ȑ @ 'ĠL@c@@AG2   @@6#?@#\#`#d#h#lĒ   @ #\#`#d#h#lĒ   @     @^ '̒ @g @ S, J` E``@@ `2<,,@AS  3 @@R ,,,@J   *`,,`  @q %`P@j$ , ,  $ L$ @ ,*  *%& @ #\#`#d#h#l   @A `$+  @@ @ܒ @E @֒ #\#`#d#h#l   @" #\#`#d#h#l   @  @Β @u#?@Œ#\#`#d #h#l  @ #\#`#d#h#l  @ #\#`#d#h#l   @ #\#`#d#h#l   @ښ  @ꓔ@  @4#ؒ@ S@ Ւ  @%`e;   p  e@( % ' &@֐ ,@*   , @o  Ѐ@ ?ΐ@@@  6  ,*    J   * , * , pH'Ԙ ` 6` ` + @*  ``&` ` "   , @*`@? "` `&@`  @,  @*`  6  *@  + @*  @@ ް  @ ؘ ` 6` ` + @*  ``&` ` "  ؀u%@9@ ܓ.   F `ܢ @, @*`@> ` ` 85"p@1#ܗ.@  =@,  @*`  62*`  + *  @ `"ܑ.@'  @=s!< 2"pA @ g* ؀ܐ@J F DB  # 2 `d"7 !````d0)`d0& @F# @# ْ # @?  ͒  `d@ ǀ  d2 `dЀ` 'A 8@>Ȓ   A X"@k! 2'@}B , J @} , @} &@}۔@}  @E,*  " ,*`  ,* @`2* @} *` @<ܑ* . 3)A,*  ` "#` ` #A,* @A `p@>A@=+`@=( @ 2 @IA  -  @b @F @@@>cAؐ!@AԐ!HA``@=ה@ː"pAƐ!X@ 6  ? - @+ @ @ #\#`#d#h#l   @= ?@ #\#`#d#h#l @, #\#`#d#h#l  @  A!`? * @#\#`#d#h#l  @  #\#`#d#h#l   @ @@4AZ!@y@@/@@@=? @  O  ,* @`2* @= x@峒  * /  r ?#h @j? @U  @^ @E@   @( ,`@*` ` "-`   * ,`*   @|@4`` @&AҐ!  @g@ @@@  @g #\ @ %Aﭐ!?O @B@"pA!X@m A!ؔ?@  @ , @ X@Ҕ A}!@@ @R@ @䀤Oq? @ &O , `@6* #D   , ,`@,  @<@  ,  ,  2@,  2`@,` * ``@   @6:  ,`@*` ` "+`M ""`,`* @"` ,` @*`  6`@*  , @  *   @` @& 㿘 @ #\#`#d#h#l  @2  @@  @– @. @b@@'㿘&Az#Av#0Ar#8An!XAj#@@  ? && 㿐  . n ?#`.@6ʔ$@$@B [@p@7  8 2B@6\B@7g (`@@7͒0@6 @8f @6T @X`B?# @:  ?B, 0 ?# @:``B   H 㿈B X'' @   3耢 B`hB`h 㿐B`'' 㿐 @       '`'`"@B * `* `* `* `* `* @    < 2`@ *  j ?#`@6!*@"*` $* @  B $   < *B $ @ 'B`(㿐' @    髖  '`'`"@B * `* `* `* `* `* `* `* <    @ 2 *  j ?#`@5*$*`@ $@?,  @  B $`  < , B $@  , @7x k ?#`$@@5= 'B`㿘 8 ,@7_ ?#`Ba@7B@6a(` B@6a0Ba@@6  B@6aPB@6a`B@5ah@6?`@? "@&@Ba@6Ӕ& }? @ؔ ?@6(0o @t "#?@'@60c`@ @6!?  @6d4 @ϭ M&@? B!, @6O @B,, $, $, @a@6  42 $`  $$` D$`  ",* "* "* @,* *  `d@ `#  @4` * *  * , 㻐  x`@K BD B5!B1"  @  "0&`,`* I  ,@4@4` @5*`,@4*`,`*  ב,`&`@ܝ&@ 㿐'R' ֆ 2X ֐  Q   # +  *    +`@ *` &  "`"` "` "``+  * @    +  * ` +` * &" "  " " ` +` * `&&@ x "@ @4.* & @6*@ * " @&*"@ ' '!B"@5  B""(h BBS!BO"8BK"@@ܰ @3Ɩ հ?<" @>,`pئhB,`* c@53Bc@4  2BBc@5%B@4@c@4=B@49c(,`*` @42`/@5d ?#x%@3)`@B,`" بp/BB#8B#HB#PB#X#\#`#d#h#l#p 8  @   ,  * , Ba@4! 2V @ @3P```B#h@2B#ǒ@4H h@2ؔ @ B - @*p+B),`, a@4 E@4 @3 & "_@2 2 @4`@&,` @ ? 㿘Be#آBa"8B]#@ϒ@@4 㿘  4##, * @43   `4,  㿘C@4$aȀ C@4aЀ  Ca@3  2  `C@4a耢   C"|aC"|b@2 !ː"|@31"|& P'T `$ @3 C@3"0C"87 9C'ȴ 1C/CC"@ >  @Y?@= @@@4Z@'`'ܐ#\ؒ  % Đ"C"Ȗ@  @@@3 2 @@@  `, C椐"?@  @=  @N  @ #\#`#d#h#l   @ #\#`#d#h#l   @ #\#`#d#h#l   @ #\#`#d#h#l   @ C["ؒ@z @ݫ@ @ @'Ѐ@@2'@֐@Ѐ"?@3  0p 0lC""@3"  "T 2_ $ SC@2z@3e̐ ?#xCc @3̐C@2 C#0"C#8@3&@18@\0'C#h@3  Cܐ#0ِ"CՐ#@F0`$ @3P @1q $$ @2t$ '`$ @2ؐ"C 㿘 $!C# ˜   C#Ē@2#㿘 $!C# ٭   C#凜@2#㿘 $ ,`*    " ` @2n "```@&@`@6;D@,`, D À@@@2  t ?#`@D`@@2c !C@1#@2 # ( @2 @0D H_CE#0CA"D= p@0M Cc  C   㿘C#h㿘C#0㿘D- D D@1ɒa 㿘D!!#Da( <@x @2^ @2[ ?#`a(Da8@1 @D @<@=@ @ @0 D@1aH@0 @#㿘@u@ 㿘D!Xܔ#Da( <@3 @2 @2 ?#`䲐a(Da8@1 @ @@@Ő@"@1! 6C䒐#0C䎐"D䊐!h@1@/*@/ D@0aH@0 @}@1@@ C e"Da!@C!p@̰ 㿘 2 D@Ô @ۡ C@X  C@R  / @ @D@ a   @T Da@Q Db@L @Κ  ` @ `@@ߩ@״?0@볐  D@0"(&D@0"@& @ߘ@ף h "C' "8''   *  "  *.@C"Dސ"h@ DԐ"p /  @H?@, @@@1I   @`    @X  @D㫐# ?@#\ #`#d#h#l  @4 D㗐#0?@#\#`#d#h#l @! #\#`#d#h#l @ #\#`#d#h#l@  Dl#H  N@ @@ #\#`#d#h#l  @ #\#`#d#h#l  @ #\#`#d#h#l  @ך #\#`#d#h#l   @˚ D.!@M @~@t @ 2@޳@־?0 @0@/& @0@/& @ޝ@֨ `D#p /  @p?@T @@Ē@0q?  @䈚 ?  @䀚 ?  @x  @$ Eː ?@#\ #`#d#h#l  @T Eⷐ 0?@#\#`#d#h#l @A E⤐ @?@#\#`#d#h#l  @. #\#`#d#h#l @" #\#`#d#h#l@ #\#`#d#h#l @  Cm"Ch"@8 @ #\#`#d#h#l  @ #\#`#d#h#l  @ #\#`#d#h#l   @Ԛ E@X`P @ى@@ђ@܀ 2 @ݻ@ư?0. @/@/u쀢 "& @.&   @/@/g耢 "& @.&   @/@/Y䀢 "& @.& @ݍ@՘ p ؐ@.  $`@-c   ؒ @. {#؀ t, ggghh@i<`  2r` l؀ ܀@?X ׀ Ӏ P O׀ L J ؀ ƀ C A E h @? 'Cᐐ!pCጐ"Eሐ x@@ Em` @@   E`E  @    $ @.@- & $@,Ӕ   $"@"` 㿘E W㿘 $E @.k  ˔E * `* `* `* `* `!*E * `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * !ː#@--#&@.^ ?#`C@-aȀ C@-aЀ  Ca@-N  2  `C@-Ԓa耢   E  E , `,  `,  `,  `,  `, @, I C༐!pCฐ"Eഐ x@ @"@.12 / 5E3C@   h @ ? &  apE!E!E!@͔ ՠ    㿘 8 AE#P@-͒  EE~#`06#@-  Eu#0-@, '@+ @+ @+ @-ɐ@- `@+y "EE@+͐#E#Ec@+ @-r@+FJ @-㿘  6  ͊ " ?` ` `@`2``2  !  \ 㿘F (F 8F HF PF X@  ? && 㿈   p @ F f  $@Cra_?]   $  ` U #̀```` 0G:` 0D! @ $``ఒ ;`   0  /!#\!``?@#`  $ D @HÚ    ` 2 2 `      ?` ` 㿈  2  @   Q @`   ' '`  D@ ? @ #Fax쀢 F!Xax F 7 @  "F@+F@*! 2  @F,!  F: @ , € 2 F @  4F@*z! @Ҷ㿘!     ?* * @` ""`  (& $   $㿘! "!  6!?  $@% 㿘!  ,   ,? 4!  㿘 9 ! < F޸!ؤF޴!Fް PFެ!@ ?Ҡ$ Ӏ$ @ ]$€ "Y Ӑ0+F!F < 2FF~"{aFw PFs"@ Fi#HFe#X ( t 8 " @_#@^4 F@#x@^@^, @ FF#CaF?#@ 2 ,`@*` ` 2` @+` `(@&$ ".@ j ?#`- (@ F!F$,`@*`   2`M @*/#$,`* @@*'` `(@&$F# @,@+I!2 ?#`Fc@* )@+  $F#G@*`0 Fϐ#Fː!@+@)G8@60G`P@)ݔ@*@**@*( 24  ?"  3  a =  ' ? . /?* :  ''G h'/'Ȓ'''''''''''''''''  @ W  ܦ P@L@GZ xFV!GR @ @@@ݐ 'G= xF9!G5 @'@Ȑ G) xF%!G! Д@@ݐ 2 @)ϒ  @fG  ?@]#\ #`#d#h#l  @ G ?@I#\#`#d#h#l @ ?!G! @ކ ?! @~ #\#`#d#h#l   @f #\#`#d#h#l   @Z Gܽ! %  @1 @ @@@*2Fܨ!Fܣ P@s @m @@ G܌!В@@- 1G/F-G!@U@Y  8 2A @)b l!iGe!@ג@ݳ #@) #\ _@) 8 J!GGC"8@@ݑ @ݍ ``"@@) ?#x'@'P'@׼ 8 2R  @(Ғ l$/i//@(G@)bp@( @'&E@(1#H@'@)8@ϝ?@׎0'@׋@ϖ 0"@' @)H ?#x@)B ?#xGb@(Gb@(@(E@' "c\ 㿘!㿘!    ?!㿀  #` @D"#` G"@(Ӓ    G"Ş  E  0#G ,,   c@'   0 & , 0),  ,# @Pd  ,# @P\ G#0 ' ' $' ('G"!@K! GI# 㿘@(! ?#` | ؐ D    2#GcP@(C! G@'YchGc@(2! `? 㿘 @'ޔ  @     I   DG#G#G#G#@B "&! & D&! `H 'H 0'H 8'' < 2  @    [ Y?  أ, $, ,$@Hڶ @Hڲ XFڮ!Fڪ P#\cd#`#d#h#l   @g  ̐! @'] #d  &!!s&!#d*  &!!w&!! &!"&!! &!! &! 㿐`'` '@$ `$  8  `$F`@   € " Ϝ㿈'' 8 E#HF#x  UH @'o  =HH @'h  H' K `@ Ha쀢 B H!E@&ےc8G #H!( # +@&!' `@  @&w@ͫ  H!H # G `,@ Œ@͚  `,S `,`4  $ 㿘F#Hސ!hHڐ!xH֐!HҐ!@c     㿀'!.` "@*`  ?!"* @ .`"* @ ?" !, "*  , "* `?``#2, `,` ?#pHً"$@@6-H"+H#$* Xp" !, "* @`  * *  *$*   c*@ *` *`$* !, "@*` @%  @&Ր$,`" HL#HH# FD!#\#`#d#h 0  @  ?㿘   .`"@*`;  " @  "^EWAQ.`"* @ ?. " ?. "* @ ??. "* @` 2` 2 ?2F?Hؐ#FԐ!HА#@B4?2??,  '.`"* @`.`"* @`#   . "* `   `#"$ .  $$㿐 @4@%Ȑ @ȵ@% H#@#E#Ec@# I@$ @$% @% @# @ȡ'x'|''''''''I ('xI @'|  @%  @%@#Ia H0E<  IX h0<*ĕ3` 2 ` 3 ` @2II  'P @%@#l  2II I  'I @%G  I) 0 I!# FcxI(τx㿘@%]! ?#`Ia@@%!!    ? 8 E #H@%  "! @ 㿐   #h Gͯ $G" K  "ch! 2  8 `I!P@$  2 I!h@$   `| z?G#u 4s +I)F-G`)```0cB 0`דaI׏!I׋!׈ PIׄ!@ Ѐ "H B uaFq!n PIj#p@ - + ,   @#  " 0  0& , 0,  ,# @L3  ,# @L+ F#x@G ``` x @$@I@#ؐ#@?I@$c 2@@ ?I@$c耢 2@@ ?I@#c 2@@ ?I@#c 2@@ w?J@#ܒ` 2@@ pj?J@#ϒ` 2@@ ]?J@#’` 2@@ iP?J@#` 2@@ C?J@#` 2@@ Ӓ6?J@#`( 2@@ E)?J@#`0 2@@ ?J@#`8 2@@ ?J@#t`@ 2@@ ?J@#g`H 2@Ւ?J@#Z`P J@x @"ϐ Xؒ @#"!  D'F#x'` `#ɰ J@#<`h 2J  Jb@"b`x@#}  t'Jbؒ`@"V@#q @# ` Je @#` "  J@#`Ѐ 2   2SJb@"6`MJ@#` 2D" <J@"a 2;" 8J@"a 2   20'bJ@"a @#. J@"ݒa@ 2   2'bJ@"aP@# J@"̒ap bؠ  2'ܐbJ@!a@#   Ja@!  wJ 2 ɐ"J@!ےa@"  8 ɀ"؀ @! 2$ !ɐ"J@!Œaؐ"J@!b@"ܐ "J@!b  L#  D. $, Ս@$@ . "*  #. #`D. $, |@$@" # ". $, o@$@ . "*  #. !". $@,`^$'̔   8 "" "@R x 8    JV"@J^"!J@Ŧ@w J@sJ."@" #H@"#H  @"Y@ kJ1#P0*@"P1J"@  #x @!r   @"@@  @ MJ#0  J#  J#H @"]J#Ȑ @YJ#J#HJ@ #K@   Ң 2 "`@@̐ @ !'",  ؑ,"* @"@ؐ  @@ؐ @آ 2-@ؐ" -@  @-@ؒq @ "KKԐ ( H@Β Kԉ 8Fԅ!Kԁ @@@$ 㾈  /x5*  * 7̐! @!-  @!) $ <''@ !  b?@ "-  `"L L  L 2% ,L? ",?`2&@O耢 @   2 L`    @  /L` -2  L 2   $?@  O耢 4 5 Ka@ X  ??" x'L'P'T'X@!A L` P @!9 ` k ?#`@K@aL` P3K@@aд` *? *?.@Ҕ2 ?6  㿘Nb* @  @ Q   ?[  @ ɰ?@ $㿀 & `K!@ K@@ j@  l ?#`@K@a!"@ @  o ?#`Ka@ [䰒 L  @ Ѐ "aC? 77'!!@~    !!@  @ !+?! %!!Kb4 !!!Kb* !!!KbK !!@ {?#@?#@6 *   * ?"@ @  @ @$ <%@%  @ @ N??@ H?#@  @ޔӐ@ 5?@ 1 xKb @̔  2?0䀢 2? @  ("J@`J@  @J@ (2?`' @  )"J@`J@  @J@ )2?*@ @  ,"J@J@  @J@ ,2m? @  ,"J@J@  @J@ ,2\?*@ 7`Kb(@܀ 2P?* ސ 7J@  ` .J@ ,"*@J@ `@쀢  5? @ -?@ ~ ?#`Kb0@-@'@< ?@[  @ ? @㿘 ? 㿘B  @f`㿘@[㿘 d`c#t*` ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||pLdX@4(K"@K"XK"hK"K"K"K "K #0K#HK#xK#N㿘 *'K,, @ @ , @@$  @  @  ۀp'@e*0@e1# @E K@cȀ '@` @o!< $ @EЀ  @t@F@e ѐ㿀`8@J "@2`@ *` ''@R0$$B @E耢 "`*` @e2   ''@Rx??'@0`??2@ h`@'''# @E # @Ey # @Es 쀢 耢 䀢  K#m  @d   @Q <, @d @(  @Q ``:@ *` $ @E6܀ # ' 'ܓ, @d] $ @E&Ԁ ''؀ @@EJ  @2 `''@QڐȲ`??2s@ 㿈 -J ''# @D $ @D쀢  ' ', @ " *쀤 " @c 2 㿈 2 J 2('# @D ''$ @D쀢 "  , @{ " ** 쀤@*Ӱ  㿘  J 2`2K#x`N@J` I @'''#@Df # @D` # @DZ 쀢 耢 䀢  Kw#+ @* @cΔ 2`@O <  , @cj @  @O ''@Qز`2@ 㿐LQ  @Sږ"@a! L 05B @B$OL4 `un ,L) xjL! b'L ZL RbL !J@1@b @b 㿘 @ ,, @y& && &  @&  @n  ,`@*`"   "   `@" 㿘  *` * @1??&@* @(㿐  6L *` *   " `@ *`L!@@L!X@L!p@ L!@ L!@   ?L! @   *`(8 J 㿘  .` @*` * ,@;    .`*   㿘ΐ@G֔㿘Ð@<ʔ .,` @*```"`  @*` "@  & @ ,`@*`   *" #   @U&   &  "?" `"`@& * (`6`("  "`@ * (&@"@"`@&  㻘%'L@ $ @̔"@@   @@ɐ"La@ 㿘@   В@0 @@ɐ"Lb@ 㿘`  `       㿘L@"(Lɐ"P 㿘  L"`8 `@ : L"pL"x`` `L@+b ɐ"L@Ub `` `Lc@  @T  2  / @ 㿘 ɐ"L@1c @&`   @? @Qɐ"Lc0@`㿘 `ɐ"L@cP b!L#x@$@6@  @X!퀢 #ɤ  㿈  !  ɐ"L@ce  `@!?J@ /'O@ `L@c `L@c耢 ɐ"Lc:`@`  @ J ɐ"M`(` ` @ J ɐ"M` `.  : ? @Y耢   @@ɐ"M`8@ 㿘` ` 2J --M @F`P M  @>`X M @6`` M@0`h ɠ   M"ؒ`p@V-   2 ?   `ɐ"M@@`  @  @  @K  M @  㿘 `ɐ"M@` b!M!@.@@@  @Z #ɤ  㿐  `ɐ"M@a . ` @> J ɐ"MaH@` b!M!`@@ @ؖ  @ #ɤ  㿘 ɐ"M@a @Lc@  2 `@@’  ` &``  @? 㿘 ɐ"M@a  `@u M @! 㿐 ɐ M@aȒ    @ߚ@ "M@{a 㺀Ma@ϔ! @3@ ` $!@_ R? 1* @ ´   ;$ ?     @ !" @#耦?@; @Aɐ"Mb@0!@@뇐 @ 1M@J@ /#@@`@ 2@0Mc@ 㿘@ @aJ   J@ \2 @J` n2 @.`.`J`  .@ 㿘N 1"L* @ "L L * L " .@ؐJɖ bJ‑* @ 2* @  .` J@  @.㿘 @ H㿘@ H㿘  @㿘$ $  $  $  $  $  $  $  $  $$ $ ($ ( ,$ , 0$ 0 4$ 4 8$ 8 <$ < @$ @ D$ D㿘@@ @ @ @ @ @ @ $@ ,@ 0@} 4@{ 8@y <@w @@u D@s㾘 !@Z 8 HO 0 #-@- J> \    J~  *~* *> @j@@@, @@ђĐ㿘@ :   @L L  㿘&@&`&` @ { @ } &@( ,&@@?@*?   㿘@ @Z`㿈@#@c@ @c@M@c0 @Ր?@ѐ"#"c 3Y Mc8@ @ ($@$`$`$` $`$`$`$`  @@ @0ܐ & `&`@*`&``*  "?$ McH@j  McX@c  M` 2$`U$`Mch@T M` 2$`FU@h $`Mcx@<  ` 2$`.=@P 2$`3 $` Mc@ 2=$@7 2i$`   -`@#$``@$`@@@A `-  "`?Mc@ "`@7` "-  "?Mc@ݔ .Ӑ@ 2'$` ` -``@$`` @ݒ$` @ `, "쀢 "` @`  ", "?@ϐ0:$`$`$@ɐ0@  c @ 㿘M0#M,#@㞔p    "M@w ?#x@;`M@ {MM #@  @Y N ?@P#\#`#d #h#l   @܉ ? @ ## '), `@ "   @@ 2 @ǒ # #\ #`#d#h#l   @P  " M@Ω  #M)'N# ,   @0  c& MǑ#Nnj H@\  #\#`#d#h#l   @  @̔ @l`e@߿ Nj P@߉@     p  e)@b    @ * @   耢@  "@@ܰ@S@ː耤? . @% N`h@    %(@ ` %(㾠  N?  p@ N #\? 4 @=  @M  @I  @E N ?@<#\#`#d#h#l   @v    @ #l,`@ " `@ 2`@``$,`#\#`#d#h#l   @M #\#`#d#h#l   @A  2N@͞ NƝ!?@#\#`#d#h#l   @'    6  ? @̨*   9 @6A (N!`,`@֒ x, `` N! @j x,(@σ  ,`   @C 2`@J` `@&`  NA!(@e @8   2#\@1 #\#`#d#h#l   @ #\#`#d#h#l   @ڵ N!0 (   *? @ũ'M # N H@Ԙ  @O #\#`#d #h#l  @ڇ #\ #`#d#h#l  @z #\#`#d#h#l  @n #\#`#d#h#l   @b  @ @`@ @_ @`e   p  e@³     j   @  @ @?@-@0,@*@ #l,`@, & @    $ N@ `* @i!(@& O'  & (& (@| @@㾸  "۰? $ 2 NN@!(I& $`ΰ ̰?A p@5  ?$@_   $69 $(N!P,    2N! @) @{( F8/n(@? $ ,    @ @@d( @_  $& $ 2N@ N!X  $@e  $ @I @@ֹ@fMܐ#Nא H@㧘  @# @Ò`e@єN!@ߐ@  @]    p  e@     l   @  @ @ $@1 `* @6@& $@ @%@@"?㿘 `   `)   `0 `09 6   C   ?ڠآ ? 㷈!@# ?#x@^#N@Ya@? 0,@@`> @ '@ 1,@@y`> @ '@ 2,@@j`> @ ' @|N! (  @r?@V @@ƒ@s(N"@ (+N)N'N@b0@7 ,@3`0,@"@,` 2NʐH@NĐ"P@``$( (  @0?@ @@Մ@1 @ Nã"` @ #\#`#d #h#l   @, 2 N"p    @+ #\#`#d #h#l @Mv#Nq H@A @׼ #\#`#d#h#l  @ #\#`#d#h#l  @ #\#`#d#h#l  @ݚ #\#`#d#h#l   @њ  @@ۀN+"@J@̒@ ?@@ % @@0 0' ,''' ''''''''''''''''N"'N"'N"N"M#Nߐ H#\#`#d#h 2  @ߦ  " ?@U ,& ,@Q 0& 0 @K@Iȁ 4' 8' <' @' D''P'T 'X'\?`'h'l'p't?x''''''P@ HN—#'N“#'N#'N‹#'N‡#'Nƒ#ؤN#M{#Nw H#\#`#d#h 2  @?  "?@ 4& 4@ 8& 8@ <& <@ @& @@ D& D  @@@@@0 'O! '  'O!(''' ''''''''''''''''O!@'O!P'O!hO!M #N  H#\#`#d#h 2  @К   @&@{ &  @u@sȰ?㿘N PO"8Oݐ"@Nِ HOՐ"H@g  @?   " O4 O 2OO"p"x"h'O"'O"'O"''?'O"O"ТM#N H#\#`#d#h#l (  @Q  ?pOz"@ժ 'Ot#@'On!P@'Oh#@'Ob#@'N\"@'OV#(@'OP#0@' OJ#8@'OD#@@'O>#P@'M8#@'O2#`@' *`4`` $*`0O #p@ FO"T O#O!P#\#`#d#h #lOc@@ $   O#OcД@  I0O#N"#\ 0#`Oc3 ,O֐#(P`@  4 8 "J "P@ `@  8P@ ` 0@ O#0O#8#\ @#`P`( <@ 0@ ɒO#@O#PM#O#` #\ #`#d#h #l#p#t $#xP`P @ @ )P'M%Nv xspH@۸0  ? 㿘 `$  * ! 8?, <Pp`?2$` , )  `  s 2` 2"?    ?  ?& H @ F@ t!퀢 @ 0 23?@ 7@ cP@ `M@ c0   )O@  "?@ ɒ! ` ``@ `  @  ? ?㿐@  @ H!@ L@  F @ U*  AP &@/  1" )P. @ @  @ @@ $  `,    @ , `\?@ X?.    @ ~  ա. @ #@   C?@ cP@ `@  @ Ԑ @ Ґ @  @  @ ʐ@ Ȑ@ @ ?@ @ @ o ` @  `.    @ . ` @  㿐!@ }#@ Ȑ 2@ D#P@ ?`АP@ ;`@ n@  @ 5P@ 0a@ c#@   ?@ %cP@ a@  2 @ s @  @ n@ l@ j 8 8 2   !@ 1#@ . @@ x`@ #@  P@ a &?@ @ e @ P@ ܒa!@ #@ Y .@ #P@ В`АP@ ̒a( @ K P!8$P!H$P!X$P!h$ @ <   P@ }ax P!P!$@ 2$`M#($` $`  P@ fa P!P!$`  &?@ @ @ @ @ @  @ ~P@ ya!@ #@  1@ r#P@ m`АP@ ia @  (P!$P!H$P!$P!$ P"$P"$P" $P"0$P"8$ P"H$$@ ǐ (  $@ 2$`M#($`   N@ a( N N! $` $ "NN@ a(  P"X"X??@  $$` N! $` P!$`N! $`  P@ Ғa P$`!$`P"h$`P"p$` $`$ &?@ O@ M@ K@ I@ @ h @P@ ߒbx!@ #@ \ /@#P@ Ӓ`АP@ ϒb @ N P"$P"$P"$@ B N! $@ ( P"hN! $`P"h$`Ę &?  (@ ֐@ ! @P@ bȐP@ *bРPb 4@  <Pb@  8Pc@ ~ @Pc@ y D@ "@ ڐ@ ؐ@ ֐@ Ԑ) !?@ # ?#p@f#P@ ac P@ bТ !P#0@ P#8@ P#@ P#@ #0@ Q @ !Q X@  X@ ~P  Q`#\#` $#d#hQ`` @ $ Q`@ Q`@  Q@ `   Q`@   Q`@  ,Q`@  0 Q@`Qa Q@ Qa( P@@  㿘` #   @  y ?#`@ܒP@גc "#QE!8  0;:? 5"#1%  "#0*   # "8@ 8 2&#@&#  #(&##? ?#  Ҁ  h Q!`'/Ԑ 'ؐ '''''''&  Ȁ ( Ȗ@5@iQC!hQ?!xQ;!@ߎ @ߔ@פ@  & Q@ a 2  Q@ a  Q@ aȀ     &  &    & 㿘@p  tQ@aЀ "c2`( ` ( " @ 2`( ` ( *" @ 㿀  # "հ # H @Q!ؒ!А!@#: ?  @n : @ ?@!#\#`#d #h#l  @1 #\#`#d#h#l @% @ٔQ"@ӣ@@ #@b+%3 #   `}L   @O@c@@8 @BQca@@ @ `  `5c`[c*`f ?@'c*`"&``&cc  &c2`3`#@ ##  Q""Q"8Q"X 0Q"Q"x@#  @@㿐@є  @@  4  0 㿘   . 2  : ܒ "ђ  㿐@  Q"̒ b`@  ̐&@@" @* &@ ?b؝"#"#  8 2_ ?#@@ @LN /8Qb@ؒ `G 8@`"#8c !#@c$#Q"o# #*` ,cQ#_:` e8#* ㌀ !"@ &Q#H: !#35@c#@@c$#c #: @~@Q#H,8@r `"# @O Q#x 8<  "# Ā#  ?Ā#@?Q#@_#8@Q 0?#@@ ##c"? 3Qߐ#{#?@ic c`&c@:` R @cR 8Ò!?c@ c ?R`p@  5!# @z R F#!?c@# @$$R 7#?#@@#?R`@  $$#$$# $$$$$&!# @G Rv #!3?c@c @s##@ Rd c@Ű @8@\@#8@> " N@u@RM!N / @8 0'H'L /#   x#@H @n  @6 ,`  "`@ ,`  ?#x| ?#x@  | @ R!(R!8R!HRߐ!X@' U?S @  Q@aЀ !"  @ ,`@`2``  .@,`  $` .@` @&L2 R!R!ȤR!ТR!ؖ #@Й; " 9 Ry!Ru!ȤRq!ТRm"ؘ #@ӱ;  `!R\!ȢRX!РST @Ӝ "  [R  @   /   @Ɓ   @ 4  @iS$!x#\? : @] '?S@j@' ` ?#x*` ?#x @ cS"`,`   2U` |  x,@*`@ |&| x,@*`   * 8   *.| ,`,`,* x %@ @.%@,` N@  S"xS"@?N @J@` @&$  @@ @ے @D #\ @@ S"#   *? @Su"Sp"@@  @˻ #\#`#d #h#l  @ #\#`#d#h#l  @ #\#`#d#h#l  @ۚ @@ϋ S6"@U@ג @ @Đ@O @ "c䀤  x'|'u? @T%S,`   2G`L,`N 6 @ @@3"` ,`@' ' ' '@''''''''''Аx@ .@ "`@P @" ` @&# #H |@6%!x,`*  ` 2``   N  @ $#`|@xH''#@xH  x'|' 㿘SbS  ) S"@   S#@   S#@   S# @    S#0@    S@j"㽐'@ 'D@TPL#\  Ŗ༘hT  P@ْ '@ 'D#\   UT  S#H?0S@L" ?S#( SbS  SŐ#4# 5  <@s8?<8@W @@ǒ@tT (4T 00@Ե  @1P@' 40@  @! #\#`#d#h#l   @Z  #\#`#d#h#l  P@M #\#`#d#h#l   @A T 8@Ð#S@{0< @?L" ?S b  T| H(  8 $ S"@  TS#@  TS#@   TS# @  TW `@|b @@@ 0? 8 T S#T@` T > 0T9 + @'@'D@S@G"0Ԓ @ 0)ɤ+T!P @ O0 "L* @ "L L * L " #T`@c  ݐT@D`Ѐ ֐@P?J?"* @  —J* @ 2*T`ؔ@w Ta@7   Ta@/  2@x'X'l't'x@r'dS@b耢 2 'pT5! T@a0  'pT!8'hc 'X  ?!%cT@aH T@a`  'p'hT@|ah 2 @ 'pT!p'pT!'hX'\' `'d'h'l'p' t'$x'(I@3S@~"@'@`'D@&@&` ?b?Tf!@  ?c  @t ǰ @TT!@ @u @TG!@  j ?#`Ta@. 7@@G @  @NT!'@@M @i @3  @<T" @@  " T@/T"8@T"P@M ?# "T"``bT?# ?#?#?#  @ 4`*  `- @  &4*  - @ &   @ 6`4`*  `2  n$@  @!T"p@@?`4*  2 `@ @`@?`4T"@ T*@*`*`*`*`*`*`*`*` *`  "*`  t*` ! r*`  w*` @ x*`  r*`  w*`  x*`  r*`  w*`  x*` ( @ s S*`$  s S*`< <# d (< l < p 0< l < c  b*@㿘 @Y@V l ?#`Tb@@@ @    @   (T "/ @ 0pǖ "Ű E@ '@~@ TbTb@@ TbTb@< ( 2EpT" ",@ `,` `,` `,` `,` `,` `,`@ސ@ې | ?#pTb@|@# 4,@Tb@ @@ ?#pTb@`Tc#<  2  c<  2ؐ b/ *`$22`Tc `@? @Tc,@8@'@"    T  T0@?@p@l@ U#\#`#dTc@@㿐   @M@ @q @C@ *< 0 2 =/<  2 |/<  2 //  *//O @֔ Tc`@є  㿘@@ 4`4 ?  H`H?4  㿀 6 ,* @@@4,  k ?# ` j ?#` P@. "  P@'T@ocp@@w 2  c-<W >,`* @   ,`T'#x* @  0 ,`T#* @   ,`T#* @  ( TT##h,`@*`@D@ @@@* @@6Tc@@@"@ Tc`@ 㿀'D'H  @%@DH@A l ?#`TbH@0H@@ ;%@  @!Tb@#< ;L .3  -`@@/*` (@\ - * $  !T@@bؒ#@  - *  4 &#:   "%@   `D `   `ʖ@??  @D@sDTc@n D" Tc@GD@X@,`* D /@@H`E@0?*  < @@24@T@c ,U@` &TDc`@$ ",`@]@Z@ Tb@D* DH@l@ @ ",` @ ,`* @]`@,`@W` T#@#@ @j Tb@Ö  @>x ɐ"U@В`0Y@2L .`@@ J `T# +|<   @@@. Tb@  @`t`.`@@Ɛ @ U`@ `x@|@~x@А @ ?4  㿘@   3 @ ( !&& Ā "   *  @,  & *  & @ @@  @*`&  @x㿘 &@@&``?㿘 &@@&``?㿘ɐ b@㿘Ȑ!Hb@㿐''# @J!x   㿐''# @8!x   㿘  "c"c`? 㿘N 1"L* @ "L L * L " .@Jɖ bJ‑* @ 2* @  .` J@  @.㿘   @ѐ&2`@: `6   @   `. N@ @㿘Ub@  %Ub@  Ub@  Ub@  Ub@   Ub@  2 LU)"آU%"U" / U"آU"U|#(L  " @kJ? /2 U"آU"Uf#x "*`:  @"L L  L  U"آU"UH# /V`@=  V`@6  Ub@/  U@`@  V` @"   U"آU"V (V`@    U"آU"V  @ 0 㿘@@ t ?#`V`@@Ɩ @ 㾈V / `/ `/ `/V / `/ ` /@#0?@ ʔ*` @ "VI!@ f#p a|. @a@  @m V@  V&!( V!(H , * "* "*   "  , V!8 <@k  @I   2@P @V!P@   @ O * "* "* ` 2D ` @ PV"@+  V"@$   V"@   ` J@  @*`, * "* "* @w  J@  @*`*@  *, U" @ @. @Q@U@@ 㾘 &+V-/V,*``@} "4`2VVY"  @VQ"VM"РJbؔ@ǒ ?>", @ V@b؀ * @ y` TV 8 * @* @m  @ HU "V#`,@v\ HW bؠW (,@6  "8 * @~* @T0 * @N* ѐ", @#Vǐ#@ĐbؖM "* @1  * @+  &  "}?, 㿘 :(  ,, @*``@@@ @ 2 , @*`k8@@@ @     , *ޠ  㿘@ 1! ؐ! `@Ҕ d@Wa @=  &!@ @6 0!  @@- Ja ?"*a @ؒa @ "!㿘`h dU`@'`@ U`@!bȀ   *`*` 2`` &`4`&`8`&`<`&`@`&`D` &`H`$&`L`(&`P`,&`T`0&`X``* *` @@ @ & `4&` `8&``<&``@&``D&``H&` `L&`$`P&`(`T&`,`X&`0 , @``, @` @`   *,` `\&`d@@h''  W`@J P ' '' ' ` @= W@a`? ?`  W!(!(?`?h7p [/r =  , p   , @`W!P,  PW@ @`7 FJ@ 3 F Vb@ؔ  "+ F@̐@@ɐ P"@W`@ F `J WY!P PV@  F`WL!P@r F` @` @'  W@h@T " V"@   V"@    Wx    W  @ 'W@W@X '$ PW@M2  @D@E`( PW@=2   @ 'Т`2/(, @ /   */W@@   '̒W@@ `WxO @K'̢`25 W!@@ "WW!Ȑ! @@ `W!@ؒ@@V @ϒ@  +W@Ɣ@ @ :'p * '!D #TaD*` ` '!D䀢 *# PW@  0 PWW@T 0@@9  0 @N /')W* * P!@p *@9 *T@    *` @ '  Q W@A@B (  @. @7@ ,'* p@`*` *`@*  `* J    *+`    @W`* $@   '䀢  @ @`@ `''ؐ?*a T `?"aВ`@) 3` '0'4'80< @G (p'dt'hx'l|'p't'x'|''''''Ub@䀠@ 'Вa@` UW" @gWO"0 (@_'`@ Ѐ@ ̀@ `@ @۔ @֖  @ȀE`" T@'ܐPܔ  @ T p  ]J 0 T +W"8V V W"H@< V@J   V@@w  +  2TJ " Ts 򀥠 J@  /0J@ /2 @  @/܀   W"U"W3"Ѐ7ؔ @ @WJ@ 2Ẁ *     ?   @h Wv#0Ur"W#@m@ߒ"T@fp`'*`@J  **`p@``  'T 2TV"@   @`Ԑ@@T UV@  O   @ ? /J *  , p   , " W, Wc@ ##?'@@0  ?@՘ @@W   @y@jX @ ('#Wa@b a@:TT* *"*"*ܖ @a  㿈 @R W#V V W#@֔ 2H  =@NP@Kp@Ȓ @ *` *``@ *`*`@$@,  @ 耢  ` *` * !4 "@@@@Ɛ H ͖  / 2&.`J 'X (''' '''''''''ȐH0* @ # * ( $"@( , 0 4 8 < @ D &" 㿘@zaT "` "aT,* ``zo !P?!P?  + - '`` , * @ 2`  , ` %aT@%P4 %aT# 2- ?*  , ` * @  ?,  %aT@s%P %aT`@i%aT@eP`2   ` @` * @*`    `` @G8?@g '@  A #X. #\2 #`2` #d2 " #h P8@| [/ ]/*` *  * @`b  @ʒ  @ 6/`;`@ ,@/@'  X H'D'H'L'P.`j ?#`'@  @,`* "* "* L@3 d " `L@ ,`P  ?d DH`lp \@ ' @d$h  d @z$h H@ܨX- D ' L@ƺ- ',`* "* "* L   @ p2`@T 2`$( D  @  @< PV"@Ԕ  V"@͔  V"@Ɣ    PX`@﬘ Ԙ  PX@6   ǘ  PX@6    D!@  T!T" DTaD*   *D * PW PXT@S | /h -`@*` "  "   " @ ``L@ A,`-   H +-  P@6I  @ PP,`, @`   C XP P @    (3 /Wax  + X` : $ /Nh -`@*` "  " @`P@` L@,`* "* "* L  " `@  ,` h -`* "@Wax@`h -`* "@X`@|`h -`* "@X`@p L@`!3,`* "* "* L   2`@ @~T 2`(   @ PV"@  V"@z  V"@s   ,`* "* "* L@  }  PX@H5  p T H"p- D`  @ T!H -  !D#TaD*@   *!D c* PW PXT@ ' /h -`@*` "  "   ?" @``L@ K,`h Ւcp@h  ,`*  h`@ ,`h@@bd DH`llh  X \@` * @*`@ @  ? !%, c ?#`'@ @ @  , X!@  U4 X!@   / *"*"*8@  X! @  / *"*"*@ O   2) @zAА@zCX! @̒  @(  3,   @Ja  ,  p'D'P'T'X  %'!#x*`{ ?#tx%@ D @(a*`$  ?#x$ D @a  ''? X!( N@  'X?@ؔ@ #\ #` #d#h#lP z  @Ĕ`%Xf!Xb!U^VZ"#\#`#d@% 'XX  P1XC!ئX?!X;!U7V3"#\#`#d#h#l@ @`e @`i  PXX@nX"0?@b?X@\@ @Y #\#`#d#h#l   @   #\#`#d#h#l   @  2#\ #\#`#d#h#l   @s #\#`#d#h#l   @g #\#`#d#h#l   @[ #\#`#d#h#l   @O  @L @ @Q  @`f @`g @`h@   `@<@  `"  `  @F @tp@. @ @`  @  @@   p 4 'pt  p@t('t et 't ft 't gt't ht't i`'tp  t@@@t@^ d U`@@y * @*`"@*`"@*` `d 2 `    X"xUߐX+" '  * @*`"@*`"@*` `d `   ' X"UX#@"K`  '* @*`"@*`"@*` `   ' V!8V V X#P@Ȕ `xԔ =`2; Xk#ЦVg Vc W_"0X[#@   d '*`D  @Ô  ' tۀ` d  t@"  '쀢@ t#\X!D К@9t "6@*@ *` !`Y UY @o #\X! D * * @P`y@t "t@*@ *` [#\X!D w[21tY 0V V Y H@ D`'x*`D  @   '@ԐD@,  * P?@3 *@ *`  #\X!D ) * * @P`TX3\ "  `@ `@| @@쀠X@H*` @* && U U Y xY ,* "* "* ` "}`  2w,* "* "*  J / S2h @,* "* "*  ,` @`@,`@"O!С,, $, $, @ ' 42 '@闐 'Г,` X`@  d "   @'耢   @ ' ' '' '''''''''''''Ȑ x,ǐ 㿐[ ,`* "* "*  * *BX*,`*"*"* `@  , * @@i " &,`* "* "*   "@, * @@ ` ,`@*`"@*`"@*` "``@   㿐  @'@ X' '*` @* ' 􀤀E,*  28 3,, "@@"`"` "` "`"`"`"` "`   @"` "@ @"` @"`&',@@h*`'%%  㿘J - @*`` 2B ` "> ` ,@@@L*`&@, @,`"" "  " " " " "  "  @@"` @"@ @@"` @@"`&`  &㿘 @.`?*` * " * " *  d?~ ( *` *" *" * Ș @ `@ ؑ*` ?b('D'H?#@'?Y`$@?b,@ ?b $@ ??c@ $@ ?c$@ ?Y`$@ @ *"?c@ " "?Y`$@ @ *"?c@ " "?c,$@ @ "`"`"` "`@@@皔 P%?Y $@?",@?"$@?b?"@$@ ?"$@?bY $@ @ *`"`?"@"` "`?"$@@" " " " @@l <$@$ $ $ $    -  Yא UӐ"Yϐ Ȕ@Að - j ?# %`+Y!x?"- `% ax*@ `*` `*` `*` `*` `*`@ $ *- ?""@ ?" ?"?" Ȗ O @o@@L Y@a Y@a Y@^a 2L) Y@ےa Y@Ւa Y@Ga Y YN!UJ"YF!Ȕ@@  @ @!?"@ @ !?Y'"HU#"Y"X@  - @  -  #@ @͔4?"@@?#@#@H@JH?"%@?"%@?"%@?" @@@ a ? @@@ @@?b?7%@Y͐"Uɐ"YŐ#@ @@@. @?"- @x&@  -   - @  -  ?"@ 2??"@  ?b??   @C ?"@x!+?" - c ?#`$ @ @a  - ?""@  ?"?"?"?#?%@?%@ ?@?@?@ 5?@ ?@?@@ @ @T?%@Y.#@U*"Y&#X@y @@@@%@?@ @ @{ @?@@"  J@ 2 ,  @ @d %@@" %@J 2%@`*` %@%@ @ Yݐ#Uِ"YՐ#@F@@@  ب ?"@ ?"- @w5  -  : - @   -   @n ?@  @"?  @t @Z@ `  (   @tv a,   @to ,(@  ?"@ ?"- @v  -  :b - @  - Y ?#@@@}֔@ 20,WS"UO"ZK @@ ?"@ ?"- @v  -  :+ - @  - "  !?Z @@ ?#@@:@!?#@@@} @}?#?bx'?㨤@q\@q^?" $ )?#?"- * "* "*  2 $Zܐ 0Uؐ"ZԐ H@E  - ?"@   ?"@?" - @v0@  -   - @  -  ?"@?x+" -  @ @a  -  8   ?"@!?" - @@  -  ,D?b !"  ?"?" - @u@  -  O - @  - F H ?#0"?c4" %??@@ H!?#@MH?#0@$@?c4$@ @ @?"- @u@  -    - @} *-  X @Ȕ @r֒` @r@s @s   #@rژ x.  ? @rј X@|  㿐  "%U,`, @Ȁ`?   #\`,`*  ,`@p@p @,`* "* "*   "`@ ,`@@ 㷀\ &!X  °? `'!#*`c ?#`$  @a 'U`@@{ `|'Ֆ`@2`~ `' @  @ 4@}T_ 7Z9Z"ZZ x!`@T)"`U%"W!"0@i "N?"`V V Z "h@S Ҁ&"U"Z"@i&?   @㰔4@|`'#*`  @Xa '`?"aX ?c'D'P'T'X` ? 8"@? 4"@!` ?   `,`   Y U"Y Ȕ@ -  z ?# @!p'Y!x,`xp%@ x*@ *` *` *` *` *`@@y@ f`@ ,`x @2 @?<   Q? <@  YU"HUQ"YM"X@ @:8 ,`@@`@ ,`/ ? <@@!x-? < ,`s ?#p$  @ᥔ`@ ,`!? H @ޔ4x#?`<@|$? @#@[8!\ 5 !`  x < ? "a`x? <? H@? 8@\#\##\  ?? 8 ð?? 4 " "a\!\ ?`<?H?@X#\#`? 4#dx   PT ?@ ? 4 t 8 % ? <x  @x!? <,`@`@ ,`   2D ! ? <@@?x < ,`@r`@ ,` @Q ,`@@`@ ,`H ` ? (@"?`,`" ?`<?Hx@ @ !? @@W? (@$@?`,$@ @ ? <@@?x < ,`@r`@ ,` @ ,`@@`@*,`@Z"'Z#''Z#'''!d. : Zc Zc(@'Z#0# | % Z#8Zܐ#@  w Zc`ZO@tZ{#0 Z@6#h0!d. "    㿘Z#Z#Z#Z#Z#@6  & #?8 @[  '`7Ġ@૒? 8 @! c@  @ɒ[p ?@#\#`#d #h#l  @ ?@#\#`#d#h#l @[L ?@#\#`#d#h#l @֚ #\#`#d#h#l@ʚ[- [) ([% 0#\@@n #\#`#d#h#l   @ #\#`#d#h#l  @ @O[ 8@@#[@ΐ`H@?  8 @c@7 "& 8@& 8@x\[ P'' [``@˔Z#`#`' `/Đ@ 8  8  2 @ڔ0 " [ x[@]` P%[) $@ @    @X 8%!p@O#ap [`@ @৔0 2$ap#ap  [`@pX Z$ap#`#`'P `/TP@} @0 " [`@R!!l  [ [@Sa[! [@Na8$!l[@aX [[v$!` !qB[@Ia[a@D[a@? -[)['[%[l .  `8 e`< _ .   < 2X .   2Q [a@[a@8@ܒ @ `"@`(@@8!p %[bH@[@bh. @ߴ @ޔ "@ؔ`(@Ҕ@ϒ8  & @o["x[" # u["!["[   Zc`[@ߜ"@%@ @ 㿘< ["[ H8`[ H[@lbЁ [Z" <? @Κ?@ @@"@ϐ@[?#Ф[;#آ[7#[3#[c@4?@{' ?" @E  *` ?#x@ q,`   d b @` 22\`,`   22R`,`    2 ,`   2! ` @, @*`@ ` &` ,`  8 "#`,`  8 \@޲` " ,`  < 2-%@,`9 @Ҕ@` @&@P \@3 @ [ \ 0Z##\@Y@-  @s`f @ʒ #\#` #d#h#l  @ #\#`#d#h#l @ #\#`#d#h#l  @ #\#`#d#h#l   @ޚ \A 8@`@   f/`@: 2< pjj`@̐*   8  \[\ P` @`V`@ *`@ @>$ <@6;$ <,`@ * `< 2"`<`@,`,$ <@@21 @*  T 8  < $ <@* @`8  "`<@*`X@ @qQ$:`@i` `@@Q@\  @? 㿀'@   *\ ؔ#\  5 @ٚ @? 0@0 [ Z#@R  @ @G@ @C\i!@@  @>@쀤` @?@ &@@ݯ &@&@ p'D'P'T '' p@@ܢ -`#\, * @` @a؀  &6 , * @ #\, * @` @a  , *  @ `.T9\ 1\, @@@ߒ 2 @@ܛ @@"`8@" <,     2  2  @܇!@, @ "`8  `ۣ, TT'쀈2'T2쀢`@'`'P#\#`!t#dDݚ  h fc !"7@0U@0Pؔ쀢#L  F'ے!t ڀ?<  @耢 3 @ { ?#p@ڕ@''`''' ?  @'`'P#\#`!t#dDy   㿀\!'\"'\"'\"('''\"8# vX L \"@@܂  @V  \"P'Z@܌Z#0# v: . \"`\"p  r["!["[  Z c`\i@@"\@\u"8Zu#0㿘@ڀ @4&& 㿘@S㿘 `  `& +  @* @&@+  @* @@J @  &  㿘    @ & 㿈@耢 @? @ $ 㿐@􀦠 ax@ڀ '@{ @w@ݐ㿈`@Fu  2: ax@Ҕ  22 @Ff  2+ @F_  2$ @FX  2 ,  @ϐ? "@FB" @e@ۘ㿐@􀦠 ax@ '@ @ @㿈`@_  2: ax@t  22 @P  2+ @I  2$ @B  2 ,  @q? "@," @@:㿘@X    $$*` @M* $ $ ?$* I@ ?$@$ $? $;    @@*$@ $ 2 " "  " 2  @@ْ ` `㿘@ @&@ & @*``" &  *`@ M!| $%$*   $@@:$@ @@$@$  2$@``4@``@s@`  @㿐㿐\ @c\@c   !5] ,*  H$0<\#h\#x\#\#\#\ #\ #\#\#] @ " @` "@`@ 2`@ ] ] `#\ @ؠ#`   ?  * hh$Р??" H@?@~ ?` ??']hT@?@m ?`} ??x']L@?@\ ?`l  h+]']`@O ? @@I`??]@>`Ȁ N ??I] 'ɔL@–* @  @% ??`4 ??/']@@V ?? ! !!  "!#(@" ؐ ]a@ח $!#("!!@@    㿀 2''  @&  @ "= 2" ( 2 22  *` * @: 2  @? 㿘 @ 㿘` &@ &/   2  $ ! 4   &   .@&@  @ֽ&@`@؛  0 &㿘_  & 㿘 H 2`&  @  &  '& 㿘@֔ @֑ & & & & ?& 㿘     @Y  `@S@Q㿘%`*`   @ !|  * `@Ò&@2`  @ 㿘   H 4G &D%1@b !  "!#(@" ؐ ]a0@8 &!#("!!@֒@׭  @@Ð @063@@״` @0)!|. @?3@׬a  "!#(@"  ]a`@ &a#("!a@N@i 㿘    @s @ @Տ0@Չ㿘d @թҘ&㿘  & !"  ""#(@"  ]a@՞ $"#(""b@@    & *@ @F*`&  & +  *$  $ $ ?$  $ &  㿐 d   2İ + ( ]N C]N ]!' d     !'' d   d 2 ]!   @Y "  @ @   @ֳ   @В@$  @ː   $ `$ 2 , n ?#  `]! "@ `," 8M @ր$     @՜@%   @ސ    @: .% @h   @԰   @]@@ @w@@N@ @K   @@"@e"@j  % %  㿘2 @( $` 耢2$` 耤@8$` $```$`@C 㿘 0@㿘ݔ   ``@ @&``@ ^` ` @&`&` 㿘 2?  ( ?耢2?耤 8?*` * @ :$ ?@ۤ$&?&?&?&?@ & $  $ *` *  *  *  : $?* : +0(ΈΐΘΠΨΰθ         *`: 㿘 @     2 `    `@ 4@g㿘&'!]!@9  "#@- t ?# !`, `,  `,  `,  `,  `,  `,  `@,  @@. "@`@ @ "&  @   2   "'㿀N@  L ?"$, L  ?L ?",!"   "0#(@" ؐ ]a@. $" #(""0"  L { !"@ "P#(@ ؐ ]a@ $"@#(""P"@ '@#\#`   @ 2 J``:!"` "p#(@ ؐ ]b@ $"`#(""p"`'@   `|"L!" "#(@ ؐ ]b(@Ɣ $"#("""'@ ~ L |2 ]@ӧ! #\#`  @q L { !" "#(@ ؐ ]bP@ҕ $"#("""'@ M #\#`   @p 2k J``|!" "#(@ ؐ ]b@i $"#("""'@ ! #!" "#(@ ؐ ]bx@L $"#("""'@    (  ' &  `"& `& "@*` *  *  *  : & ?&  & h'''Ԡ  L  ``%"` L  -`  4@T`'@'N ?2/9آ̨?J@ ["O. ] %" J`ƀx }w %2`4&`4@ " `4 4 $@$` `' `.  ' 4.`'J` | `'\ '$`$` $`$`J`   L {  L  {L 2, #(@ ]b@с  ("#T&@ J‑* @    @v  @$ '*JJ@ = # $`  $`$``'`}"LL  L 2, #0(@ ]b@.  ("#0 &@L`:"L L  L ""$`, L 2$`@ #P(@ ]b@  @("#P@&@J@  ` #p(@ ]b@ߔ  `("#p`&@4쀢 $` -$` ``$`"@*` *  *  *  : $`  #(@  ]b@Ч  ("#〒z&@ $@'`4 4``'( #\v#` 2a`2 # #(@  ]c@r '#("##G&@ k%J ] }\2  };\8 J ]!  #(@  ]c @C  ("## #(@ ؐ ]c0@- $#("##&@h 0B '* '@&`4@  `4 4 $@$` J@ \2``'J`.' @. J  . 2 @ш &   4 ܰ 㿘` 2@``@`    '`@&`&` 'h  ` ܖԛ(@+`ך  'Ԑ ']#@'ܖҘԀ    'Ԑ ']#@' ܀ @Yؐ'Ԑ 'ܐ '']#H@7   @Щ "  2  2܀ "/`  j h0>e` ؐ / @ @  ]@ϴcP/ @@ @/ @@Њa@0] ؔ@  S]@ϔcP@ @ '؀ " 4 ؀ J/  /  ` '̐ ̔@ *]@kcX@ @E0@ ! `  #(@" ِ ]c`@ $ #("  @H㿈@`"x*`@`@ε `@1'`` @? '` 2 `` "` ```.`*  @Ύ ' *@3@`@N' 4@@M?'` 8 `@ 2-`@  2(`  2$` ` (@+` 2` 쀢    @`Π 4쀢?2`@) ] c@'*c@ `*  `*  `*  `*  `*  `9* @Ϊ * @*`@'* 6,` " `7@@ϭ @ǒ'@j`4@ǐ` &`㿘    `     @9 㿘 ` "@ϙ      2 @ό㿈@α#\#` @x: $ @͒$. %  @"@1& 6@G@ `4@C@>㿘 @Y 3` `  0#(@ ِ ]cp@] &` #(" 0 @̾0 @<]@͵c@@Β㿘 @+ 3`@`  P#(@ ِ ]cp@/ &`@#(" P @@̐0 @]@͇c@@dX @ ! ``  p#(@ ِ ]cp@ $ `#(" p `@b0@2]@YcP@@' 1@Q@,㿘]c㿘]c㿘 @̯]@(cX@@02@V l ?#]cP@`@@G* @̑  '.L    ' \'2 *@*@`*@`*@`*@` L   '*@*`㿘 d `9?050& @ k ?#`@ڒ`$@ :2,  @@͑ "  @  `@ @ր ޢ`?& 㿘]@#]@#㿘]@ؐ#2]@Ґ# d `< ":`@ͽ k ?#`@˂,@͹ :2, `  `@8 N 2` @͛ @@͗ `  ` פ դ`ᤄ  $  $  㿘'L'P'T'X!L?`{"ܓ*`@ !A"!ɠ"]@ c:!  " #(@ ِ ]c@˖ $ #("  !  " #(@ ِ ]c@| $ #("  @֐!ɠ"ؐ@,@˃0K!  " #(@" ِ ]c@X $ #("  @˲!ɠ"ؐ@@_@Ő !  " #(@" ِ ]c@3 $ #("  @ˍ!ɠ"ؐ@@:@̠ ف ف! 㿘'L'P'T'X"!! @ʃL! " !ɠ"@̣^ @̟㿘@ڐ @ߐ&  @ט '&@̨ @̦!!   ! #(@" ڐ ^`@͔ $!#("! @?!@Q? 㿘 @@| @z㿘 € 㿈'@C'  ? 50 !@#(@ ڐ ^`0@ʋ &0#("!@!0 q??&@d&@6 2 & 㿈'@' &'* '  <5P !`#(@ ڐ ^`P@H &P#("!`!P  5p !#(@ ڐ ^`p@* &p#("!!p ?  㿘  `& @ &@͓*`& @*  "?`"? `#d"d"  #㿘@˾㿘     /  (`& `  &  &`?㿘@@㿘  6 , @ 2  & 㿘 N "*`:    N `:"L L  L!! !#(@ ? ^b@y $!#("!?a!:!! !#(@ ? ^b@^ $!#("!?aD~ L:"?"*@ 2? ,L   "N@* @ "N@`N@ * N@ "  g  , @  & "$@$`@ȓ*`& &, @@$@$$ & #^@ʒ " ``@ɩ*`$@А $@Ր*`"  $ @ɡb 㿘 6  , @ɂ 2  &  㿘 `` @m*`& @Ȕ & @ə *`" `& *` " 㿘Ԓ' # $    .@ ɔ &     . ۖ 㿘  6 &@* "  &&@  㿐@ &@@2  &&@*@ @*`&^@b* *@& ^c@&` @`` ` !!Ѐ !#(@ ? ^c@ $!#("!?a@͒ !! "#(@ ? ^c(@ $!#(""?aؖB? @ 6`J  !ڀ*`2`?#@" " #(@ ? ^cP@ $"#("" ?b?@Ȥ&@ȡ`@ȟ&`&` @Ȝ`&`` 6`㿘@`2` &@@Dž &&@@T*`&^@b*@T& ^c@N& ` !"0 "@#(@ ? ^cp@l $"0#(""@?b0@* !"P "`#(@ ? ^c@O $"P#(""`?bP5 ?@3&@0& 㿘, * ??@^  ? 㿘.@@L `㿘@T  ? @ے @  㿘@* '@% @  @Ȏ@ȋ l ?#`@O@ȁJ? /^@Dc@A@'㿘 ^@ cȐ ^@cА "^@cؐ ^@c '^@c㿘!! $!_ @O & !@@b $0"p   "#(@" ڐ _`@ƒ $"p#(""!_"p@ @?4_ @@  @h@. &0^"!" "#(@ ڐ _`@] $"#(""@"@?> 0<2# _@ P" @ r ?#`@Ť_@Ɵ`X@Ԓ &  @!@  @/  _$`` _ `h _`p _`x _` (  @Ǐ̐l # `@ƚ̔ !!"   "#(@" ڐ _`@ $"#(""@^"@p?v . ̐* N 7/;9!``  N 2 .L‑* @   L* @ 2L`#"gN`"dN‑*`   ‰ N*` `:2NN‑* @ "N. N" N N*` `:N :bЀ "(@? _`@s #b(""?bДX . 'b\ @ "…N`" LL*   L2 b #(@? _`@6 #b("#?Tb \*@  N   N* @ "NN 2.c # (@ ? _`@ 'c("# ?(c N `" N N*  N 2 #0 #@(@ ? _`@ '#0("#@?#0Ș @SN @M N   @@b@e `,O ,* "* @ML`_`_@ؒa   1   _@ƒa ,aВ  ,* "*   _@ūa   aԒ    2N!#P #`(@ ? _a(@X $#P("#`?cP>N } 㿘! - !ڠ#d@ĊL!  ! -L /",L  !̢!`۠ h "`, @Ë`,>`4   @À ې h&`ڐ#d&@㿘`!4`, @*`ې!@@,   "  @& 2  2 , @*`ې!@@      2   㿘ɒ 㿐 " J`y`Y  @m ` J@  @  㿘. * ۢ!@@ $ `$ @Ĕ&&㿘    @Z @T"@O 2 㿘. * ےa@ @     " @Ğ "           " @ą 2  " @  @ ,  @' & & @*&@%& & 㿐a a "a @ ?$?@ 㿘. * "* a : 2   4"`0"@㿐`?`? "`" ! *` * " * a  `$`!*` * " * a  !$!!4`!4@ "!!4 @y@â$!4@ !!0`!0@֐  !0 @d@Í$!0@ 㿘!. * *"*!? 㿘!. `4ە*` *" *a !04( `R`&O`L&@ &`"&@* @*`"@*`@` 9!   !#(@" ې _aH@< $ #("! . ې!0e !!   ! #(@" ې _a`@ $!#("! !K 㿘 㿘 㿘 _@ba_a4@[ _@Wa" "'_ ,`@ @K`@& _@Ba_a0@; _@7b"<@ "<'_ ,`@ @+`@& _@"a   ’ _b !!4 @!4_?@b@_@ b`!@ !'_ ,`@ @`@& _@a_@bx!! @'_ ,`@ @`@& _@ےa_@גbb\_"'_  Ⱀ@Ēa  㿘@B & & & & @㿘  @ & & 㿘  @6    "@  " @ `@ ,  @Ӑ㿘   & *@ *`"@ @Γ*`&#   `& +` , $ , $@@* # @$ # @ #  $$  $ $$ $ 2$($$$$(㿘      &     @$  ,  6     $@$  , `j*` @* $  [      "@  @"`"     (*  "@    + @ "` "       $ 6 (*  "@    + @ "` "    $  `,  @T㿈  '   @ߘ!T"   2 @ 2 㿘 @I`@  ?@ 㿘@ 8$$  $ @ $   $x ٔ T# @   . @N''$B 耢 * @$ܓ.` @t   . @$''`@@f܁㿘 |㿘 $u㿘  @2  `&  @C*`&   &  * "@㿘6 4 $@; @9㿘 @ @-@+ @) @'  @$`@ $@p ''@: '&@&   @lw u $  0 @@ ` @ے $@W܀ "ܠ 6,  @Œ耢 ܠ  բ`,  m+/-ɨܦ  @`@cP `(@"   _b@ (%cP%` cPڐ?0Q#@r耢 O$  ܠ ,  @^耢 6 ܀@$ Ѐ Р ԓ,  @C耢 Р @o  쀢 @b @^ @W@U &@& 㿈!#p ##(@   _b@r $#p#("# cp 2'  & @%ɐ@ J* 2    2 `| N@ /  @ q  a#  al,  @Ր@ T  O2( @ 2! #  al,  @@   ''&; @ ,  %  l,  @  @@   ''    $' 㿘 @6C %)'ɖ ,` !l @X 2/@@ #(@"   _b@ ($%# ,`w? @?   ܐ`@Ɩ  㿈@ 2 'c'㿐 @ 2   `' $e '$[$U$M  'ܒ$C$= @܀ @)-+ɠ  @- 2n  #### c(@"  _c@͔ c(%#%# `` &`@*@ @y*`&@f`*@ @*` " @`*@ @*`" @`*@ @*` "@`*@ @*` "@@`*@ @*` "@{@`Г*@ @*` "`@*` * @"`*` @* @ "` `(*` @* @ "``* @@*` " ` &`" `@  Rܢ @܀  )-+ɠ  @n 2   #U#O#I#Ѐ c(@"  _c8@ c(%#%#; `` &`@*@ @*`&@᧐`*@ @*` " @`*@ @*`" @`*@ @*` "@`*@ @*` "@@`*@ @*` "@@`*@ @*` "`@*` ؑ* @"`*` @* @ "` `*` @* @"`` &`" ܢ`@  ]܀ @^@\쀢 @V@Th  #ܔئ䬘 `"^ @ W #䙘 K @_@cX&'̒#䇘@ -@ k ?#`@$,@@J `  #k̨ @0   @0 &   "   㿘@v1#  #(@ ې _c`@ &##(" #1  nX㿀`\`  $&@ *"@ *`@ *`@*`" *  : -  >   @p?`@`t ?#h  ,#_@)@&c *#`  #(@ ?ِ _c@ $`#(" ?`t ' @$ Ę `$ @㼘 $ @㶘  @L  ` @">: 3"1` " *"@ *`@ *`@*`" *   ??" @ #\#`  `#\#` Q `@ @@ `&`(*`& - ?' 㿈Y W $  *r ?#h@#  *  v ?#h%   @* '     2`,  #\#` @ `,@     * $&@㿘 1 0  @#(@ ܐ _c@Д & 0#(" @ 0  @^ 㿐 1 P  `#(@ ܐ _c@ & P#(" ` PԐ  "@5 㿘@/@,@) ~ ?# `_#А@@@@.Ӑ 2  {! '@  ` _#@J? / l ?#`@ /,@* @@ ?#`Z @@! p  #(@   _c@' $ p#("  `pS_@cؒ @ `@.p @1!'!  #(@ ? ``@ $ #(" ?`v7'Ā9'Ȑ 7@@  k!  #(@ #ܐ ``@ϔ $ #(" #`܀`   #(@ ܐ ``8@ $`#(" 8`А 7@@]  4! !#(@ #ܐ ``@ $ #("!#a܀`  ! #(@ ܐ ``H@ $a#("! a?g 0`Pۚ܀  ``њ  `pƚ耢  `쀢  `  `䀢  ` .@2v܀ "h "b耢 "\쀢 "V "P䀢 "J  D`@ &"" " " " " " `" @ 㿘 " @2+  "  "   "   "    "   "   @x㿘@2㿘@2㿘@ ݈ 㿘@2 k ?#`N@ /2 * "*J /"`*``N@ @*J /"* ɔ㿘 ”㿘 컔㿘 촔㿘 쭔㿘 즔㿘 쟔㿀엔 "9S Q'?'쀢 ! !!0 !@#(@ ? ``@ $!0#("!@?a0젔''0!!P !`#(@ ? ``@ $!P#("!`?aPٖ`''?!!p !#(@ ? `a@Δ $!p#("!?ap뵔հ @#䀢 !!! !#(@ ܐ `a@@ $!#("!!돐?'!   !#(@" ܐ `aX@ $!#("!!깐 ''` 6!p#ߠ䀢 !!!Ѐ !#(@ ܐ `a@_ $!#("!!ꌐ '!   "#(@" ܐ `a@D $!#(""!q Ԕ''` !$X䀢 1 @+%)' " (@" А `a@ ($%" С,`@ ? `@!`@ @А$ 䀢 1 @+%)'0 "@(@" ̐ `a@۔ ($0%"@̡,`0 ?  `@" `@ 0@̐$*䀢 1 @+%)'P "`(@" Ȑ `b8@ ($P%"`ȡ,`PА ?  `@M"X`@ P@PȐ$ް䀢 1 @+%)'p "(@" Đ `bh@k ($p%"ġ,`p阐 ? `@"`@ p@Đ$x䀢 3 @+%)' "(@"  `b@4 ($%",`a ''ܔ' `@ݘ"`@*@!"   "#(@" ܐ `b@ $"#("""2 @.I G E @հ T㿀???  #@''d @J '' `'''''Đ##ۘ耢  `"''$͘$ǘܐ$Ԑ$ݻ̐$*ݵ@^ @,ݐ2>!"Ѐ   "#(@" ܐ `b@j $"#("""R?@C܀ @!Ԁ @̀ @Ā @쀢  @  @_   F 2  > 2 IJ @$̢  Ȥ, @I   Ȁ Ȕ@ IJ`@ `̲ @Ԕ Й.`@  `̀@ Բ @ܔ ؙ.`@ `Ԁ@ ܲ @ .`@ `܀@  @.`@ ֲ`쀦@     @Ԁ @q܀ @k̀ @eĀ @_쀢 @Y㿘!" ##(@ ? `c@x $"#("#?b_C  ̐ߒ *!#   # #(@" ܐ `c8@Q $##("# #~ `  2 ~   @@V  @ x@ ܒ@0㿘 ܒc0@ 㿘@@J? /`j ?#`@p /,@* @@ ?#``cP@;@`ch@3@`c@+@`c@#@`c@@`cȔ@@x`c@ @p㿘@XJ? /  l ?#`@ /,* @DJ? / l ?#`@ /,@* @0@- ?#`@&@# ?#`!`#P@Ö@@Œ 2 !`#h@@@ 2 !`#@@@ 2 !`#@@@ 2 !`#@{@v@} 2 !`#Ȓ@i@d@k 2 !`#@W@R@Y 2 !a @E@@@G 2 В<@" @g@P<  l _( @, 2 @?#;! @ @2 `;"ے @ @"`  ?!#   ##(@" ܐ a`@ $##("##א V` >!!#Ѐ   ##(@" ܐ a`@@ $##("##幐 `T!#  $`T #(@ ܐ a`p@q $##(" #`T坐 `T@ }&   #(@ ݐ a`@R $ #("   @8# 7` /7ۊ  /7#2  4V`N@B 2O ``8    &B ڃ> $  0D 0@0 k ?#0@u`@'B'0$J Q ! 0  @#(@ ݐ a`@ $ 0#(" @ 0ِ?  F 㿘 8  W `?&& ' ' @ٔ @ 2 @  #  #  #  # ܘ # ֘ # И # ʘ # Ę # ھ # ڸ # ڲ 䀢# # aڥ # ڝ $ ڕ $ ڍ $ څ &@ !@* '@*`@*`'@*`'|@ *`@*`@*`'t@*`@*`'l@*`'d@@*`@*`  t- -  &  & | & Đ &Đ $t & l 4 d 4 Đ /@Đ 8 "a&a&&Đ @  %@Đ < @ %@@& %@ %@ %a@a@& &@`D %@ %a@ܒa`D ??$є $  ˖$ Ŕ $|ٿ $ ٹ$ ٳ$ t٭ $  ٧$l١ $ dٛ $ ٕ$ ُ$ ى@@@@|@@@t@@l@d@   @@  @ݐ@ې@Ȱ (@s h h;j"ۀ@ h1a!&`$&`&``$@&` &`(@@֐ `(`&`  `"`@ ` "@1a0<@C@u``J@-@J@ -2*@`&`J@ -2*@``&`@`&`@`(`@2`*&`` "&` @ &` @k`(@i`` @f1a2!8` @`  @     `(`$@`$  @,@@ :  @ݔ     㿘@ U@0@@㿘@ @ ( " @  @ 㿘@ @@ @ @  " @  " @  " @  " (@  (& (*`  ,* @@ ( 2 (@ ,㿘    (  $@#) "1a&`&`&@&`&`&`&` &`&`( a!H@  a  !P@  a ` !X@  a `!`@w  a `!h@m   |`aw :V@J "o `( j&`(!p@Q a@ ^&@!@E  a@ R&`!@9  a@ F&`!@- a@u :&` !@!  a   @" +&`$!@ 2% @Z &`  @ @H $@ *@@`$@@@a@@a@@  2Qa`(*` @)*  &`,@"1a8!8  J  `,@j@   D@"z` 2@a@ !&`@ 2`a@!&@` 2`a@!&``  a@!&` 㿘@@" @&a@!a 2%&a@a耢 1ݐ & P    `#(@" ? aa@є & P#(" `?`PḔ@@"㿘@[@!ݔ @&@&` @@"㿘  @V &`   @P &` @`   @G 6`   @A 6`    @; 6`  J 0@ &`<  J  0@ &`@ @) 6``< ( 2&`8@c $&`8㿘@2 8 @,㿀 8 " d@ d@C    #\ #` <  a"a"0a"8#d @ a"0a"8#h #l@ 8`ab@@㿈P谒D 1 p  #(@ ݐ abH@ & p#("  p?&  `  ''@  $F   @@'@@ @`D 㿘@ @@ @ @ X''''  `'Ԓ$J 耢 "'`  `` -` h# `9/75ݤ  >耢   (@""  abp@ ('   ఀ (@ ఐ ab@x (& b? @  k ?#`$@@0 @ k ?#`$@@!@ k ?#`$@@!\20 , @q  &耤2Ѐ (@ А ab@& (& ?  u %   @=@  ''@`'''@ '```& 쀢 "@Ԓ$J 耢 2@ˑ*  耤 !  @@ 2 `%`$$KԔ @|@z$Ԕ ږ`$Ԕ Ԗ` ̀ n-`?@;?" @5? R/75ɻ,`L$`@@@,@  @@" @` `2` 2+`@ @ j ?#``@ΐ`@Ȓ@ (@  ab@R (%&` `"$Ԕ `ե@`$Ԕ d`-@* &`$  Ę U $  O $ I $ C $  `= $I 7 "'a@"  @ @ : ^/75ɠ` , $ $ $ (`$` %@,@$ @$ `$ @$ @4$  "2`J "-` @@ "  2 2` $ ( (@  ac@ (%& Ԑ ` 0`0؀  @Z  @ 㿐$ ұ $ ҫ  L'+#%)ݰ @` 0  a@c(@"  ac @_ c($0%a@0H?` &` 7&` @ ` P !`c(@"  acH@@ c($P%!`P)?` &` ;&` `0  @@㿀S ( _ @ϖ J@`!!p !#(@ ݐ acp@  $!p#("!!p?0< : ’$8Կ$9Լ$:0.$8  &쀢#$9 $:  $8 =$9 7$: 1@@Ȯ'd'\'T'L'D'     '4@Q $' @\ԔЖԘȰЀ 6 !!   !#(@" ݐ ac@ $!#("!!ܽ g ̀ $'L'\'2^ \LԒ\@ Ж Ԁ`SԐ 0O#Ĕє#ю#ш*$ $"$ $ $!@ Ԁ !!! !#(@ ݐ ac@2 $!#("!!?0$@ Ԁ !!Ѐ !#(@ ݐ b`@ $!#("!!?0hd@ `!!   "#(@" ݐ b`P@ $!#(""!  dM /dt ?#h@7 /,,d{?*  '<  '< `)  @-  " d@ Ԁ B$ 'ݕ'(^Ԓ$B б U M+;7ɢ d@)?؀ :b b (@"  b`x@_ (%b'b bۍ 􀦠$:  @ - ,   , @ $'>'`@- $r ?#h@@ '!'.$ 2@ 2@O  @ " 2@’@ s ?#h@`@b@5 @b@a @Q$2/'Ϸ$ (Ԓ$     @t s ?#@:h@'@j $J  'ؔTԄ#\ b@ @$  @q$ '4Ґ !  @>@ :  +;1ݤ @ `@&@@& 2 ` J  /``2@`(@ #0 @c(@  b`@] c( 0 @ 0ڇ  @"`( _*`$`   "`( S*`$* $ `I"( <  C@ =  bP `c(@"  b`@ c('bP ` bPB  "p c(@"  ba@ c(&"p  "p'  " (X0 @<d@#\  b@; @G 4@42ؐx'x'|''' ' 9b@ @&!"   "#(@" ݐ ac@ $"#("""͐  4@Y4nؐx'x'|'''b !"   "#(@" ݐ ba(@o $"#("""ٜ b #<$=Ԛ @@%#\  4@4 ؐx'x'|''k'b@ @ `^ р);#%1+ݠ  ( J* "@L8\D$Dhb3!P@  ?#  h@rb@ma` "Ѐ 'Dbc(@  bah@ c(%"'b?"Дܖ " b! 'D 'D'D l@u  ?# h@8@4 c(#@  ba@ c($&#?٥ @ >c  c(@  ba@ c(%c @ @"c? 4@P4 ؐx'x'|'''b@ې @R D" ,; 0@ @ ?#h@} @v Ԓ$Ėtq "'t\ !"\@@Kt \L@) "͈ 4@4 ؐx'x'|''3'ub@p @| @     $,`0$Ԕ =@4&ؐx'x'|'''0$$ p @@Ւ $Ԕ @@ 'lԒ# l  b@ @)` @d@s `d켔 d !x #0   #@#(@" ݐ ba@ $#0#("#@#0׳ $<$>Ԛ @@##\ T  d@@&^ G d@@& < ̽'['2 - +!#P #`#(@   ba@< $#P#("#` cPh 7  d@ _ d̆԰ 㿘` €@  @bb @< @ "@㿀 ` 2'  ''쀧 ''`'.*  h#`   `, @"@`"`` "``"` ` "`"```0 4@Ȁ b@8b(`2$  $!H@n@$!#p ##(@ ݐ bb0@ $#p#("##p@ @?y ` d d x( 2X  @M+/-,`꾐D #˃#}@~ %@y  `'c (@ ? bb`@3 (%c%㠐?cˍ ˉ`@'"'ܰ 㿘. @: .@>    @0@` dh@< ""2# `*!# ##(@   bb@ڔ $##("# c @sW.`@o: / @k:   !#Ѐ ##(@ ݐ bb@ $##("##?!#  #(@ ݐ bb@ $##(" #  ! 0  @#(@ ސ bcX@x $ 0#(" @i 02'@g @[ ! P  `#(@ ސ bc@S $ P#(" `D P% @M$@#?\! p  #(@ ސ bc@. $ p#("  p@U !  #(@ ސ bc@ $ #("  = < @5 !!  #(@ ސ bc@ $ #("     Ѐ    #(@" ސ bc@Ք $ #("    0'''   .@ @  "@0` @ @o @k ' @ P֮ %ɨ * @*` `( Ð   @I@G@E ֒` a(@ ? c`@e ( ` a?`K  #Ɂ#{#ua  ! (@  c`@@8  a("! ab $T  a0 !@(@a0 c`h@  a0("!@a0? lC $.$ ($ "$ $`aP`!`(@ ؐ c`@Ք  aP("!`ؑ-`aP `         Ԑ J@  ap !(@"'ap c`@  ap("!ap-a !(@a c`@  a("!aӮ * R" -`S -`@S a\`*(a !(@a c`@O  a("!a ܕ(* ,?7 .  '@(`.  aА &@  @ "!(@aА ca@  a("!a* *  ; * @*` `   ̑* @ +Ē$(-(ē-`ȀR  З-`  P" #\((#`\`?#d#h@*@ *` "`(2  %@@@  @| . @w&@ @0''@'@!!?` "#(@" ސ ca0@ $!#(""!һ ڰ ڭ @@ t ?#h@ܒ#b`@֒@Ӓ@@ t ?#h@ǒ@Ò@@Œ  !" " #(@ ? caP@B $"#("" ?b @  !"0 "@#(@ ? caP@# $"0#(""@?b0  !"P "`#(@   cah@ $"P#(""` bP2!"p "#(@   cax@ $"p#("" bp ư$ #\ܖؘ  ܢ @  "`"```@ "``0ƕ$F ܢ @  @` 2ܢ`@ `0܀@2ܢ @6'b @B @ѐ ܢ`@0܀@&!ެ-@أ,`@*ؠ@&@ w ?#h$ @b @`ؐ@ @@-`"   "#(@" ސ ca@` $"#("""H?܀ =''''m' `* (#h#b#\$V "'!"@@3 2@ 2@U  2@Β@܀ ؀    ܀  '''' '@ @W@ !" "#(@ ސ ca@ʔ $"#("""Ѳ? @[@X t ?#h@#b`@@@F@C t ?#h@@@@]!"Ѐ "#(@   ca@ $"#("" bДа@˒ #!" ##(@ ސ ba@e $"#("#@"@?F"  @A& -ؑ* @@7`&܀  ''''Y'а 㿈 @ *  @@蔔ń@z Đv$9`* `@ ݀@p` 㿈#   "'#  "'  "@   28?` "@@*?& #  #  @'耢 2# ٘ # Ә @㿈 :  20# ķ # ı # ī 3c   # #(@" ސ ca@l &c#("# #Q?Ð* : <   ( 0     㿈#^   J耢       㿈#A   @ 㿘1 c@b   c@b #?㷈`2&@.: `p,"8*`@Pxx!#0   #@#(@" ސ cb@˔ $#0#("#@#0 Ұ !#P   #`#(@" ސ cb(@ $#P#("#`#Pܐ @ !!2 ` &@#  0!#p ##(@ ސ cb@@ $#p#("##pj?8 !#   ##(@" ސ cbx@f $##("##Γ I В &` ?$@ "@` `%  "@##(@   cb@8 $#("# cd%Ѐ ##(@   cb@ $#("# cJ#<쀢 @@ǔ@   @i`_  `&@V 㿐 a &  ?$ "@` ` ?@>#c  #(@   cb@Ȕ $c#("  c!   #(@   cb@ $ #("  `ڔ @@ 㿘㿘(쀦 0"  0@# ̘ '@Y#    @ # ð  !cՇ"@cb@@@'Hc@ @  @c"cb@ g    !ca"@ c#(#\#`#d#hc"ccc#@ ! 0    @#(@" ߐ cc0@ $ 0#(" @ 0?@?@ؒcH@ccP@[@@b ` !?# @:    P  `#(@ ߐ ccX@ؔ $ P#(" `j P@A @y! p  #(@ ߐ cch@ $ p#(" J p!&    #(@" ߐ cc@ $ #("  ʐ @}&@@. @@ #@4@=@G@!  #(@ ߐ cc@o $ #("  W?7" @@! Ѐ    #(@" ߐ cc@O $ #("  {  @ @Ô<  U11 ̀ ` "@!#(@   cc@# & #("! `O1! ! #(@   cc@  &!#("!  a51!0 !@#(@   d`@ &!0#("!@ a0&@!P   !`#(@" ߐ d`(@Ӕ &!P#("!`!P  㿘`,/"ԓ*`@ L @&   0 BP Bp@+  0@  d@ݒ`X  @ @̀@ d`@˔  d`@Ŕ @>  2$@#\#`#d#h#l#p#t#x#|#d#a@#B ````#\`#``#d`#h`#l` #p` #t` #x` #|` #`#`###############d#`@U#Ȱ ?c . d@aؤ&@!@V@@:@W@ @@’     !c "@ 2 #\c"cc@!!p  "!#(@" ߐ da@ $!p#("!!p@!!   !#(@" ߐ da@ $!#("!!ˋ?@-?@Rd@jb(.?#@$@C  d"0@&  d"8@  d@ @ڒd"H@@ ( "߰ ސ@s?c@Δ @   `2  ?# @:  2 㿘v   !! !#(@ ߐ dbx@6 $!#("!!?7 "d"@@@? 㻀 !cC"@\@X@\c@Ő @Ð 3 d@ d"@ "@Ғ @  "@ʒ @ǒ c"cb@ =     !c "@ 1 #\c"ccd@b!!Ѐ   !#(@" ߐ cc0@ $!#("!!ʤ?@F?@cH@gccP@ @@ 쀊`  ?# @:   㿐!!   "#(@"   db@ $!#("" aɫѠ !" " #(@ ߐ db@` $"#("" "ɍ  @@ ?#`!d@#@@ !!"0 "@#(@ ? dc @, $"0#(""@?b0!"P "`#(@   dcH@ $"P#(""` bP>@!퀢 #!d!"p   "#(@" ߐ dc`@ $"p#(""@c"p@u?Ӕ!d@#@$!"   "#(@" ߐ dc@ɔ $"#("""  !W  !"   "#(@" ߐ dc@ $"#("""Ґ "!3  o-9%1d+7'/Ѐ "(@ ? #@t (%'"?^0M=#耢 08#逢 +3#ꀢ &.#ꀢ !)# ߑ *b (@ ? dc@B (%b&?b+ 0 ( @ ? #@- ($% ?|=;`!#0 #@#(@ ߐ e` @  $#0#("#@#07 d = 8!#P   #`#(@" ߐ e``@ $#P#("#`#P !#p ##(@   e`@̔ $#p#("# cp' @ !!#   ##(@" ߐ e`@ $##("#@#@.?є  6,x4 *   *  @   p$ 'p't@ @@ &  㿐k ?#`@ ,@i J@ "@e &@@Z @@ n` n@$` e @ؔ   e!@є     &@J@ 2   &`J@ 2   &`J@ 2   &` J@ 2~   &`J@ 2s   &`J@ 2h  } &`J@ 2] ƒ r J@`RΒ h J@`H,   :>` ֒ Y J@`9ޒ O J@`/,   :>`( @ J@` @ &`0@@J`@$`@  "@ @ @@:X` @$`@I`0 㿘@@@ @ +# ,@aD@ !@@ , H`@ `d!!@@"H$!@!@@3"!DL  /L /2  ,D!퀢  , L  /9!?c0  ?``0@ 2 `0@L`0 "`01 D "@3 1 ; 6 ?#`0"`-"#/?  @&  & @ʔ݀`$  `"@$ ƀ$ ݀@@`((@ @ @ & `6  *8 `0?@ 2#`0?#< ( ?`0c @'  *0@N " @`0 1   `0@  1  @ `0@N 2`0<   @`0 1   `0@a 1   8 `0@- 2`(< @@ `(@`,@ @{`0 1  `( `0?`@ 1   㿘   , @ " @o  & @h @  @6:   $@"0  `"+  @֔ 2 $ @6 "  $ @r&@1   * @@@  @d&@1  @3 " ?&  `@̠  `?##@@ @&  @@ 'd    '''@/<- &c cc(   ea@! c(#c#c@@cɚbؐ @qM e@:a( `@1  d'4@#Ȧ`  @@' "' " ' 'Đ EЀ B` 2  2 22@ $<$А $ ?@$$$$   @   `@- " Ѐ Đ  ؀ $?d Ѐ Đ $? ϒ؀`R  N ^3Ē @ '@(ג @@@@0R @ ) Đ  Ѐ  $$ }$  @  @@'@@@$@@^  "@ @Y @h @ ' ''''@ "  $? >$@ " @ @?c   & <`  &`   &`  &`"&`,`< @2(&`,@#??c @^(2&`,1  #?cea%ea`8'7` @7 7 7 7`@7 7 7 7`@7 7 7 7`@7 7 7 7`@7 7 7 7`@@7 7 7 7`,@w7 7 7 7@+ 3`3    @c7 7 7 7`  @T7 7 7 7` *22 `  @@7 7 7 7`'  @17 7 7 7@{  @ 7 7 7 7e!@!@ 7  n7 77@@`$:`@  :`@ @ @`$:` @ :`@!?#`n$@@  "@ @  !@$@@@`$:`  :`@    D<`  > @ ?1   `, " `, '?#)`,@u@@`$:` @ :`@k`," &`,@*!?(!?`< ( "# ?#@@x$: @ :G?#@"!?#@@V  "@ @Q  !@$@@N@`$:`  :`@   ?#@ &@M @ $@E@$(\'@`` ?@ ?,`* `(?`0?`8?`@?`H?`P?`X?``?`h,`?`p?`x?` +` *ٔ  W`>@䀦 '@'` @Ȥ`(?`0?`8?`@?`H?`P?`X?``?`h?`p?`x?` `*  +` *  ` `* @*` *  %@䀦  '@,`@*` ' Ш'<eaP \@ '   @ @j  `1 %@7 0<  p4 m  $,  2   2    2  2+ @ې $ '< ((< 00< 88< @@< HH< PP< XX< ``< hh< pp< x < ,$ 4$ 4$ 4@* $   ?$ * "@ 2R#\<  @x'<2@j"2@  (?@0?H8?P@?XH?`P?hX?p`?xh?p??`%@@'< '<C "x#\@# @ <  '<x 0@T ne!! 'x7|e!А! 7 7 77e!! 7 7  n77ܐ@@`$:`@  :`@B e!(@z@`$:` @ :`@/<  y@_'< "@ @Z  !< '<@W@`$:` @ :`@   `<'@ 㿘@Ɛ`  .: *@* :  "  `*@ @*  &,:  J@ `"*@`*&㿘@n@l@ @ "  @    㿘@ " @$ k ?#`@ k ?#`@@N )N@ *`:  "N@"N "N@* @(" N@  "* N@ "N* @("`N"*` #`"L@ L* @ "L@ L * L@  @"*`:  ) `L@  @" `"L@ L* @ "L@ L * L@  @"*`:   `L@  @ , @/,@@,   @   @ &#?$ , @ ,,@N nN  N@ 2N ? ? 㿘@dJ?`/ ? *J /㿘@Q@ @@͐㿘 @J  @;@8@ " @e@a@@㿘 "!T@?e@b &@7 @aP` !T@ #А @6  !!P@"$!P!P@@ 2  @>@ 2 ?"## &@㿘 "!\@?e@eb &@7 @ɐaX` !\@Q # @6  !!X@"$!X!X@v@ 2  @}@ 2 ?"   &@㿘? "!`' !1e""!`!d@2@ @x$!`h@!!d@"h$!d!!d@4@!d㿘? "!l' !1e""!l!p@R2@ @I$!lt@!!p@`"t$!p!!p@@!p  e"@,@) @s@ @)e@a@גb "@*@!  @  @ٔ "< ( !   #(@ ? eb @K $ #(" ?G` ! 0  @#(@ ? eb @0 $ 0#(" @?,`0 @HT@ !H@ PL@` P  `#(@ ? eb @ $ P#(" `?`P 2&@& 㿀`9` ''@ .' @   B! ''@5   '@ @b  B! @   @'耢 @s  @֔ '@  && & &       ``? `@"   6 ɶ"%)'@ @  쀢 p  (@"  ebH@q ($p% p@͔@ * `"` ?'ؐ@?'@t W@  2 '''' @2 B! ' '& @V 9@Ŕ  2 '''''䀢`@=  @  2Ͱ '''''Ȁ @% @[   @ @L  2 䀢``@ @;  2 ``@ 6  @(  ` Ѐ``@ 6  @  ` `h  '& @ɔ @  @ @  @ @   @ @ `@ @ٔ 4  `j ?#`@?''''''@ @”2 @ @  2 @t @  2  & `X  (  Ԡ@U {@Ĕ  uԀ Ԁ`@B h@  b@5 [@  T @ @% K@  D ''''@ @K @  @C `'@ &@6     '@  & B! '  '@  @㿘@l@v㿘@ 㿈`  .@ @.  2% `     @@     耦 (?0 e@gbG @  $@K$@ @ U@ؐ @W+ @ 0 #\#`#d#h#l#p#t#x#|#e#b@k#@- 㿘  㿘  㿘  㿘  8@ ` / / / / `777@B72 㿘D ` `#!  #(@  eb@Ȕ $ #(" @: @K? ```L6`6`` 6`L`N6`N  `?@ 㿀'  @ <<   21 @6&,*  x,`"2%@ @5%@@ "`  "``@'f'ɮ  B@  ''@@''@ `''Ģ   ̔ j  e X 9ɤ73/   @@ r #(@  ec @ #(  ? ###Ѐ   #(@  ecH@Ԕ  #("  $䀢   !#(@ ecp@  #("!? ̀$ʘ #  ! #(@  ec@  #("!   j ?#`@'Ԑ$ 0   !@#(@"  ec@c  0#("!@* 0 Ԑ J@   "Jm 1agP !`#(@  ec@3  P#("!`Pp !#(@ p ec@ &p#("!pL : !#(@"*a f`@ &a#("!ađ* Г*@, ᰀ  !#(@  f`@@ %#("!  * '@`@ 8@@@0''  @a'!!Ѐ !#(@  ec @ $!#("!a3#ǘ##@ !! "#(@  f`h@w $!#(""!^? ''Ԓl'@?  @G?  !#\$$?@Ś !u " " #(@   f`@- $"#(""  bY$̠F O $h$ 7$ 1$+$% %!"0   "@#(@"  ec@ $"0#(""@"0 Ȓ r ?#h@'Ȣ *` r ?#@ h   ? 8"@"@`@ ` ! P !ݐ !@LΔ :?)31 8@< Ȁ@ / @9 "J  /"P b`#(@" ̐ f`@| #(%"P&b`"P  $Ȣ`@֠ 2Ȣ? >f ء,`@ @  @* `r ?#h@@@$(J@,`P `?#\@#`Ƞ?@@Ā%!"p   "#(@"  f`@  $"p#("""p6 #\$$@@z @ & P!"   "#(@"  fa@ڔ $"#("""    x' \ `` "; ` .`f!($@   z ?#`@k.$K Ҙ耢  $" ǘ  '''  , @'@4  ?# O`܀  @: @5  f@@a(  @f@a0 fa@@ @@.@@`@ $@.`$@ faH@  .`$@ faH@x.$@V  f!P@’ &@ V@_@@ @@ @ @"@A!x 65f%f,  `@11 2 @@'x' f`@ @3@?@@@Z?@3 @쀤 @s @n   @Y@n؀` !?# @:   " "#(@  fa@ $"#("""t? 㿀`\(   `  h"?#\#``@p.`\>````!"Ѐ "#(@   fa@8 $"#("" bЀ``{!" ##(@   fa@ $"#("# bF` А !# # #(@  fa@~ $##("# 7#@ !#0 #@#(@   fb@~Ԕ $#0#("#@ c0 !#P #`#(@  fb0@~ $#P#("#`#P ` ` o`!#p ##(@   fbX@~ $#p#("# cpƔ0!# ##(@   fbh@~ $##("# c@  ~ ?#`@}Ғf@~͒b@~ !# ##(@  fb@~O $##("#@#@}?00!#Ѐ ##(@   fb@~. $##("# cZ/ : <  Gt@~ o@ B!!#  #(@ ? fb@} $##(" ?c0M     #(@"  fb@} $ #(" @V @}h.?/@~ *@H !ဎ! 0    @#(@"  fc@} $ 0#(" @@) 0@};? X $* \`ɘ耢 0#  $,  $+  耦r  "h@~ 2a@ܠ@@@~ 2  J -2  В@ C$- } $) w $D q # k '<'؀L АԒ,  @  #\Y#` ,@~@~0`@~p# 2 ũ2 . ū'' ,`@C#\#`5 ;`@''܁p $* 耢 0UT $-  r ?#h@}耦C'* @ L 7@ T"&, +@",`@ѐ#\#`ޚ* @L `@'w'  '   ( (("H";j" &."  v" " `" " X " X㿘 .&   & 4  ? 6 &   @" & @{ X   @_ @&?  @{є @ X  @L?`@ @{㿘`2  ?@  .@  ?"  @| `X ` `@(  8  @|`X `p ```&`P@&`T`X c @{  @|ǔ 㿘   @``` ````` `$`(`,`05ک`4x`8@ @ (`0`@:1V@@-` 5`@ ۆ@ @- 5 0os@ @ ) 1 =_㯆@ @(`0`@*@@-` 5`@* @ @ - 5 ?Q@ @) 1 `&؆@ @ (`0`@"=㯆@@-` 5`@?ֆ㱆@ @- 5 "W5㾆@ @ ) 1 "@ @(`0`@?fᓆ@@-` 5`@)P㎆@ @- 5 m!@ `<@) 1 =b@ @(`0`@0,@@@  -` 5`@ Q@ @ - 5 :m㪆@@ ) 1 5Ć]@ @(`0`@S@@ -` 5`@6(y⁆@ @- 5 9Ȇ@@) 1 xs@ @(`0`@0ֆ@@ -` 5`@=5Cᇆ@ @ - 5 V@@ ) 1 *x@ @(`0`@?;@@ -` 5`@ن@ @- 5 #J@@) 1 ?B@(`0`@!}⁆@@ -` 5`@gX"@ - 5 ?yN ) 1 )/D@(`0`@㩆@@-` 5`@=҆`@- 5 /p) 1  &߆Ɔ@(`0`@:I@@ -` 5`@5;̆@ - 5 " ) 1 6u49@(`0`@9@@-` 5`@蟆@- 5 1+e) 1 = HD@1 (`0`@ʿ㗆@0@-` 5`@*㧆5@@- 5 ?$95@) 1 VֆÆ@1(`0`@#3@0@ -` 5`@?}5@@- 5 !aц5@) 1 O@1 (`0`@?9@0@-` 5`@(P5@@ - 5 ᡆ5@) 1 =߆₆@1(`0`@/N5@0@ -` 5`@ ⻆5@@- 5 :ᴆ㑆5@) 1   && @ & & 㿘@x &"" "  㿘  0  ,@@``  ,  @ @8@ *  ,@@$" ?*  㿘  *  ' @@ !,  @?@ @  ,`  @   `@ ,`?@,` @ @2   `@87"6  &  &,  @x&  *`@ @y. ? @ +   " ?"`@ ,`  @" ` "  ,`@"@ @ `"`T  㿘  "!  ?@(   .` `" ` "`` ?@*  * ?   @x  ?&  㿘 2   @y@y 㿀 @쀢  2l  2 '@耢 `'' '@3 2T 耤N!ؐ@ E䀢 2B  @. T  ' $ ' '@  0'@ ' '@ "@  @8 ' " $  ' $'@ @y'@y% 耤 㿈쀢 -   `,   ''@ , @@@    ''@  X    @@?  @?0ܖؘ @?ԔЖ̘ @?`@'Ȑ?'Đ@!Ȑ@0Ƞ"@  #耤 T ` @ L@J ?'Đ@IJ @0 Ĕ@܀@  ؀ `?  `a  $a@ `  Ѐ@ ̀ `?  ` `a ` $a`` Ā`? a  $a2`Ȑ"  &$& $a @x   ' '耤Ȑ"  &$& 耤 " 㿘 `@, ` 1 2  ' ``, `  a   "ap` 'H@ <H   "ai   @?0 @ ?ܔؖԘ @?@H J @ Р @<@)Р @2@А P@TА `@dА @@ @' pА p@,`А p@p`@HА "@ bH@Hp@a`@@@w  "a㿈` 'H@ÒH H "aN H$ @ EH@ H'?'@̒@ے"  ?@   ?@  P@  `@  @@ @ p p@  p@ @H "@H@w-  "ah  @ 2`  @??`ܘ @7?@ؐ@ ' ?'̐@aА@pФ$Ԑ ?@P Ԑ Д ?@I Ԑ P@0 Ԑ `@, Ԑ @@( @Q pԐ p@V Ԑ p@ @Ԭ "@s@vؠ $@/@آ`Р@#@ؐ P@`Tؐ `@`dؐ @@ @ pؐ p@ ؐ p@a @" @`p@V @ӒА@ϒ @F@v{ذ H'D'H.`*  j ?#`@Ь :'-DGD@@`H -'H@ܬ '"!-D`p@ @ 'Ġ a !ؐ@̀ 2  @ T`?Ą'Ġ   'Ā `?' 'a  `?''- Ā`  -   ϘȢ $ ! 2  `2     2  2   >`4f  ?”&`  *' * ? )  `  `  ' 't`"  `#(@sD`  y ` 'H`+  㿘  #,   @s_a  , "! -  %, * "* "*    Ӕ ,  & & * "* "*  "`"`   ڑ,  㿘 ?͂a'D'L?ސ!@@s4 3?ސ!@,* "* "*   ",@t,"`,* "* "*   2 "`   |@g@m`p ֑, ?ޢ!,* "* "* ` 2@ !` ,/ ``c ?#``c #   `,D`& &@ ?ސ!@@ ?ަ!,* "* "*   @l`T 2* , `pD@   , ,  `$" & ` "`(`,@" ` 2@ `$ &@  ǒ? #?ޢa@rZ4 ?ްa ?̈́L f?Ȭ,* "* "* ?͚bL@@  ` "`(`,@"` 2 , `pD   , , @  `$' fPF‘, @' fPF fcX, ' fPF… ""fc`Dfh fD' ch…B' $2`$ A ,* "* "* ?̈́L1 %`8@%`8DLW  ?` @*` * " * " *    `@ *``" $2`$Ш ,* "* "*  "?̈́L` 8"8?ޚa  6,?͐"X@qu4 ?ސ!X?ު!? Ȧ,* "* "*  ` "A`(`,@"<` 28 ,* "* "* , @*`"@*`"@*` `@r`  *, , @*`"@*`"@*` ,* "* "*  8"`8 "` ,DL  $?͐"X@,* "* "*  ` "`(`,@ `   `8" 8 , ?ސ!@ ?ޢ!,* "* "*  @@r`  "" " "" "@  " " "@#  "@ "  "@ "  " " "  "  " " 㿘 @qޔ  " " " " 㿘 @qє    (    (  *    *   `?         "@ @      ("@  "@ "   @܅*` (쀠" `02` <` @*` 㿘 4 ! !@!,`* !0  `@ ,`!@4 ,`,   @q +8 @q  $!0$+&@ 㿘 = !@!!ܡ.`,  !8@o +8+@o `@ .`!!*` *   @p *` * +8 @pٔ *` * "!0*` * "+f 㿘 !@.`* !0 2  @ol   㿘 !@.`* !0 2  @o~ & @oP   㿘 !@.`* +Ѐ 2 +8@o6   㿘 !@.`* +Ѐ 2  @oH &+8@o   㿐 `  @ &@ $&  @ *` (0*`" ("  ((0 "@   " ((0 ( "@"@ 㿘@p6  '@n @p. &@n & 㿘  @pp@@p, &@ &@ 㿘 @p_ @ @p  @pT ?@?"&@ 㽐&@pB   #@n @pRL?@n}!$ @o; $ $   @n 2:? @o""23?6"@ @ @@ , 4 , @p@p&  @o @o $ &  @oY*+8 @oU*$ $  㿘@p @p  㿘 @mb_㽘 2`* @ *`    @oY  @n""?*`@!@ @n @ . @@mД   . & 㽘 4`,  ,`   @o%  @n""  ?.` ? @m ``.` U/ / @o  @n4""? X @nД @ 㿐`!@.`( * K 쀢 @! !ؐ?& .`,   @n $!0 㿘`!@.` *  a0 2  ` @n  &a0 㿘`!@.`* !0 2  @m    㿘`!@.`* !0 2  @m3 & @m   *` (0*`" ("  ((0 ( "@ ((0( "@  ((0 ( "@ p`͘`  ǘ`P.``. @?ɘܐؖØ䀢##'..2` `ߐ .؀##'..2` `Ӑ . 㿘` !@v㿘` !@㿘` !@ ؒ (( 0( 0(( І $ 㽘 @m$"6"7!7 77 7 7?6 7 7 7* @m2 @m''Đ /7    7  @l 2 ? @lH""? 㽐  @l 2S? @lo""2L?6"@ D l ,,`$$! @m_ @k`$!,  W*`"!"!,* 7   7  @k 2 ? @k""2?K  @k 2w? @l""n?6"@g e!ؒ &!& 6 * 2 @m @m & ! &a["8&  Xhȑ,`! :,` 5` С,`xR! @l!@l JG ,` B `? < fl  `0 ' '``,` 2  (    *`2    *`B``>*`:!x  @@k  f @ky!!2a? !W@ Y  v܀ , , @ $"`"`T   T  , @* @" " *   ސ7h  @@j̔ ( @k!!2#?  @j  @k.""2?  @j   @j""2?B?  @@j  @k !!l? !W@e c !ؒ &!& @k @k & ! &a\"&  @,`` ">` ` 9` ֡,``N PK H  " ,`  :7 4 ^d  `( 'ܐ 'ؐ``,` @ Ô  q 2<w8!42 0 !ؐ &!ܒ &!&a^"&  4P& X!ؐ= ܒj@i @k* @` "*' ` %xɒ @h`@ ` @  -  ' ''X&  !4ư '(,*    " ,& *   'XȐ$ 2 hX@i  @k@i @kVS}  HE 'T 'P  !@S,`@  (?  "<`  7`   @   @ @  @x=    h 17 |     ' 'c`! @,` *`   c !D, 8' @i @ ! !ؑ. ?D  Ĕ@j]  @i  .  `' y r@j6@b 2'! 2 @ic @@j`"$`Ȑڔ   n@j`$$`2 2Ӑ@h @h @i@h㿘      㿘    &@ 㿘!@0  (@(( g!㿘  1$ p 2  0 2 @  2  2  ig H,, $, $,   ѐ ,D@<8@H,* "* "*  ,`* "* "*  `  2+`   ? 40,p(@0@@ @g% ,`, $, $,  @g @g `@ ő,`? ,  㿘 `, * "* "*  @hd 2  `, `2&  㿘c 4 @, * "* "*  @h< 2  `, `2 @g,, $, $, $  @f $  &6 㿘 `, * "* "*  @h 2  `, ` , * "* "*  , 3 * "* "*   @ht@*`"@*`"@*`@``@f` `?@ .`*` * " * " * ?X @g ?& 㿘  * "* "* @hB   ,  @gx4& x * "* "*   2`,`* "* "*   ' | _ [  ,    , 2'  , 耢 2@ *  䀤21,`* "* "* *  2   쀢@ @  @e @g 䀤􀤠 7,`* "* "*   "@g?@, @*`"@*`"@*`@``@e  ? , *` * " * " * ?X @fÔ ?&`@ J,` 㿈 @ ,`  `@ ,`  0D @>'g,`v 23`8+`,`%쀢 2  T @Ւ @e[ '@fG @g+@g) (`@*ȡ,` 㿘 `, * "* "*  @ft 2  `, `" @e &, @*`"@*`"@*`@`@d  㿘 @ ,`* "* "*  @fD 2` @ ,` ,`, $, $, @f @e$   㿘 @ ,`* "* "*  @f 2` @ ,` "  2 ,`, $, $,  @d $  㿐@fZ@d  %g@fS @dIi 2& #& 㿘gaޔ㿘N 1"L* @ "L L * L " .@fJɖ bJ‑* @ 2* @  .` J@  @.㿘@dK " " "  "㿘  "  , @f   & @f   , @f   & @f @e'D'Hk"Hk@e+bX 'X?'d'xH#@ d@cX 'pd` `kb`@d    'd k@dbx  k@db  kb@dҘ d@cX y@e : q . @d: ( '*@dА@d͐@>k@d^b@ 'tD`  `  kbk bk@dFb 2 kc@d> 2 t`   2'l@el@ej) 'hk@d(c > d@cPX k@dc 2@e1 = .D`@e* . & ,@e$ = !D @e . D*@dc'l@d`'hlhh @c '`l @c  '\D`  `    " "$ ""?k@c͒c    ,* @c  "@d 4,  x+` k@cc .,*  \@2   `@,&  `2'|0 * @c  "@d 6'|,` | Jt`Gg#x+` *   p` x``H@@c*`H#@gH@"@ 'pH@`,` @c{H@@"`@ @crH@@"` @cH@@`.`"@@cH@@` "@}l`"h@d^ h`@dX @dV@dTp` H@x+` " H@ D"x`'x `W@cXx㿐'D`t' "D?    D"`P@a   @ @" p  㿐'D`t' "D D?    D"`P@a   @ @" p  㿐'D'H`t'/|"  D@ah`P@aj  H H@"`㿐'D`t'"  " "`P@a@  `   D@b  㿐 @a' "  @a"` @a"` "  "㿘'DD ` D @@cOD`@cKD ` D @@cAD` @c=D `D`@c4D@c1`'D'HH'k@R''$'ؐ#''А?'耢  `    ?BkP@bh kX!'耢   *`: @  *`: Z  *`: ,`'H k`@b'  kch'kc'Ok@b  kc'kc'?k@b k'耢    `kc'kc'k@a  k@a  kc'l` 'l0@a'ܒkX'耢  U *`: @  *`: Z  *`: ,`'H 0܀  l8@a "l8@a}  l`@'l`X'@lh@am  l`p'kc'0l@a]  l`'kc' l@aM  l`'l`'l@a= l`'l`' l@a- kX'耢   *`: @  *`: Z  *`: ,`'H l@` l@`  l@` yl(@`  la0' 'ylH@`  laP' 'jlh@`  lap' '[l@`  la' 'Ll@`  la' '=l@` "lD'耢   @la'lb' 'l@`a ''Ēl '耢   'Ȓl( '耢   '̒l0'耢   'Вl8'耢   'Ȁ =Ȓ*`hX $lb@'$lbP'lbh'Ā    lb' lb'lb' 'l@_ K'Ēl0'耢   'Вly'耢   @_    ?'    lb' lb'lc' '3l@_ $l:'耢  l@^ lc('lc8' ' lP@_U lcX<  lch' 'lcx' 'l@_8 5'Ēl0'耢   'Вl'耢   'Ā lc'lc' 'l@^ 'Ēl0'耢   'Вl'耢   'Đ Cz*`i\ l                                                         lc'/lc'*m`'%m` ' m`@'m``'m`'m`' m`'m`' '䀢 $m '耢   'ؒm'耢   '䀢  ` `` *@]"@3 *@ "@ `? @\ *@ @"` *@ `"` *@ `" ` *@ `" ` *@ `" @] *@ @"@ `2܀     m`' ma'ma'@]R *@ @ "@@]B *@ @ "@` *@@`"` " kX '耢  m(@]O  m0@]G  'D' D' H㿘'D'H" D" H" H"b @]"`P P? f"`` ``?`` a`P@]~ 㿘'DD"# 㿘'D "#㿘?㿘 @T @㿘@㿘@@G㿘@@   @q㿘 @  @@㿘'Dnb@@   @T  @C@@D @nb'c@\@@@Z'  " " @   @ m@ a @Z@ @# k@k" ( 㿘   @|@G@@ 㿘 n @ n  @  n  @ n  @ n  $@ n ( ,@ n 0 4@ n 8 <@ n @ D@ n H L@ n P T@ n X \@ n ` d@ n h l@ n p t@ n x |@ n  @ nm` @ nm` @ n  @ n  @ n  @~ n  @wx'@'?  #`  q  # `#   !                 #*`:@   @Zܒ '* @ =@<' #*`:@    @Z'ܒ '*mbx' ``ؒ@Z  Gؐ` 'mbx' ``ؒ@Z  $ؐ` 'ܐ'ܐ܀@ ܒ?'  @$ *`:㿘@@㿘 @ @㿀'D'H'L'P'T"`"" b ""bD" bH" bL" bP""T T@Z $ L`P *@Z @X"`H?'D?'''P`@$@hb * @ `@Y`` '`'`' @sHDPL @b `<"`@Zd 'L" : 2` :`D 'H? @  @3 u@ @- @ @="`@w @5 @ @ t@ @ @&HDPL @ @HP `L`D  @tDL  P H  @iH'HP  䀢 DL  @nb(@.`' 㿐'D'H'L H"@ : 2` : ' `   `' D"@ : 2` : 'DHL 㿈'''b 'b ''b`@$@jb * @ `@`` '`'`'"`@Y"`@Yb "" b "" @C)㿘'D'HDb"Hb"㿘'D'H"`bD @'DbH @'HD""H"""b@㿘'D'H'L'P'T"`bH @'HbD @'DHDPL@AT  @HP DL  @ZH`DL@ P  @P㿘'D'H'L'P"`bH @'HbD @'DHDPL @1'Dx   @X4DВb@@W$'pDВb@@Xz'txxxp @W%㿐@'D'""  㿐 @ `\"  2`*`#\ 2`*`' @W *"`""@@Xz@V   @<@㿘'DD #'D"`D@W "b" ""D@W"@㿘"`"@@X]b "" b ""z㿘'D'H'L @D D @'DH H @'HHD@L@6㿘'D'H'LL    DH H8 D  DH D㿘@㿘'D'HH H` "D D`"㿘'D'H'LDH" DL" 㿘'D'HDH" 㿐'D'H'L'P (@U' @U'" $L@V"@P" "  `  "L@W} $   "L@Wr $ H" D"  " "  ` 㿘'D'H'LDHL 㿘'D'H'LDHL 㿐'DD $'@@W]@WZD@WW㿘'D'H'LDL" DH" DD ` 㿘'DD  @㿐'D'H'LD $'D `h @ `%H  @ @D L@ DL`   <@t@@ >@m=L ) @D `D`D   @DDD ` DDD `  DDD `  wDHL@㿐'D'H'LD $'L  'LH  @ @{DL @ DL`  ) @@@ @㿈@'DD $'` N@    @D  ? '7D  6 '.` ` ! `D  aVD  aK '''$$  㿐'D'H'L (@TN' H@TJ'" $" "?" ?" " " $" H" $L"  "" ?" " " " (" <" D" @" 8@*@*` @T"` " 4 @T"`," 0  `  p@ID D" " 㿐'DD $'  * * @  㿈'D'HD $'' @ * * @  H@`' * * @  H@8'D `-D@ &?@= +  *` D@"@ " D`("@    D`("@ " @㿐'D'HD $' " DH"㿘'D'HDH" 㿐'D'HD $'D " ` @" * * @T "` * * @ ?"  * * @ ?" * * @ H" H `  `" ` " 㿈'H'L'P'T'X'DH'  '? @`'' D㿀'D'H'LD $'D@=DL "@'DH "@'DL" DH" ' ' @(``@ " @ "`` @ " ` " `'` '㿈'DD $'D@`4@&DDDD `3' ' @Q `  ` ` € ``€-D@ `@"@ "  ` ` € ``€  ` ` €`'` ' ` D("  `@w`@'DD $'  * * @  ''''' `$$   * * @  '` q   @ `   ' 'ܐ '`   '?'ܐ ' `F ''   @4@'`'`'Ԗ * * @  `Ԙ +  *` #@ ` А`'Ԑ`' @'t@'`'`'`#@ €     ' ' " L@'`'`'`#@ € 8`?ߒ 1*`v 8P٨8P8٨٨٨٨hو '?' ' ' '?'ܐ '  ' 'ܐ '܀  '؀ 2D@@R@'쀢 '  @ ' * * @  ` ܐ" '@ܐ '耢 쀢  '  @'쀢   @$$ u * * @  ` D@ Q?@܀  +  *` D@"@ "  +  *`  +` +  @@ DD "@ "  `" D`("@    D`("@ " D@ '$$  㿈'DD $'' @, * * @  ' `   `€ $``$@Q@Q`'`@Q@QD@Q㿐'DD@'  p  'D' 㿐'D'HD $'`0 " 0`0 *` , @Pp"`,`0 *` , H"?㿈'DD $' 8` " 8 `D"  `D"D``" D`` " ' ' @ `$ `` " `"D`  D`  " 'DD` " " DD` " D`  D` " 'DD`" "  `DD@ "DD ` ` @ D` @ D "@ "  `DD @ `@ D`@ D"@ "``  D`" `( `@ D"@ " (`'` 'IX'D'HD $''DD  @;` @4̀ H   @OȐ   @OH 'H' <@XД * @@   ` Д * @@ 2`* @ *` И + @   * P@ "?PД * @@   ` Д * @@ 2`* @ *` И + @   * ~Д@ ">А`' D`HȖ  @N)'Ѐ |H ` T' q l' 0@Д * ,@ Ԁ@ H"H"  'А`'̀   '''''#@D@؀   'H "H` " H " ' 㿀@'D$`@'`'`'D`#@ D€  $`@'`'`'D`#@ D€  $`@'`'`'D`#@ D€$$  p'D'HD  ''''DD  * * @ Д#@ DH" D ' ''''DD  * * @ ؔ#@ x㿘'D'H'LDH" DL" 㿘'D'HDH" 㿐'D'HD $'H" 4㿐'D'H'LD $'`< * @@M"`@`< *` @ H"`<"`< *` @ L"  DH@H" D㿐`$'+ * '`   ` @  @   㿈'D'H'L'P'TP  */ /* :`DHLnb0 @i' $' " T" '   $'"  '㿐'DD $' 'DD $'   *`: *  'DD $'D㿐'DD $' *`:㿐'D/D $' *@D@p㿈'D'H'L'T'X/T nb0'T (@K' 0@K'" $" (X X" `" L@L"@T@L"`" " , "  " * :`  *@`` *8" "  "L@Mg $`H" D"  " 㿐'DD $'D  D `@` @:DD ` `   nb8@e nb@@_@@W ,``@DD`    @* : @㿐'DD $'@@M%`@M!@MD@M㿀@'DD $'` @    v " ,D} 'l" ,Dt 'c` U `D@cI `C` *`: @L'䀢  `` *`' *`:  `` *` @*D, 'D ` DD D` €' ` '''$$  㿈'DD $' ' $'쀢  `*`: * :@ '쀢  $'쀢  ` *  ` @* DD ` DD D` €㿐'D'H'LD $'H@K`` `@LH@K $ ` @J7"` ```"   @KA`H@IH@K$ " L `" " D@㿐'D'H'L'P'T'X (@I' $@I'" $H" D"  "P" " " L" X"" " " P`" "  `  " " L L@KqP L@Ki $ ` @I"`T"  ```"   @JL `L@IL@K@$ `"   *@" " 㿈'DD $'D ` `  @ @  ` "DD ` 'D @  _@`'DD ` nDD `  ` `" D ` `  D`"@ `"  ` '@J'D @'@D @  _@<`'D`@ `  DD ` CDD" `   5㿈'D'H'LD $'@HLy"@ ` D " D" D1 㿐'DD $'`@Jw@JtD@Jq㿀@'DD $'` a@ (   6S `  DD ` DD" `    '5   'D ` DD D` €!`' `  D` '䀢  #@D@'$$  㿀@'D'HD $' 'H E  x   G a  @ C      E      B   `  ' 'D" @`" :`"  ` ` "@  @H' ` ` "  ` ' *`: &`' *`: ?  @*`'? *` "  `/ ` '` " ` "  *`: ?  @*`'? * `  ` " H H ~H H  `  D ` @p} `` $` "  ` @G"` ```" `     @G `  ` " 7 ` ?' `` ' ` "  ` '    @*'`" @ K*'D$$  㿐'DD $' 㿐'D'H'LD $'H" L" 㿐'D'H'L (@FQ' @FM'" $`"  "L@G$ H" D" " L@G$ L@G5"@㿐'D'HD $'H@G' @ @G,@H@E@@GH@G"@" D" D@㿐'DD $'D  @|DD ` E@@|㿐'DD $'@@G@GD@G㿐'D'HD $'DH" ` ` @H€㿐'D'H'LD $'DL" DH" ``DD  " D @ 㿈'D'H'L'P (@E~'`  <@Es'쀢`@GH t" 0" " $" " ," " (" " " P a!" 8 8 `  "  " L" *@"@ " L " 4P ` H @D  @' " ' " 4'"" $" D" H" t"  " "  @㿘"   +` "` ` ` # ?" 㿈'D'HD $' 0''   H@  '`' D@㿐'D'HD $'H @ `" $ H " $H" $ $`( `$" ( $`(" D@  D`$"@ `" (D (@ `  D`"@ " ( (`" (D@㿐'DD $'` `$@D@D ` DD D` €㿐'D'HD $'DH" D` "@  *"@ "  " ` @DD` @ " D@㿈'DD $'' 0'쀢   $@ `' '쀢   㿈'D'H'LD $' 0''쀢   H@  '`'쀢 <  `  ` " L      *  *   ` ` `?*   `  ` " D@*㿐'DD $' 0'  *  '" D@㿈'D'HD H  @D $'   ` /  *  @C-'' 0'耢   `   '* @ `" 'H`"㿈'D'H'LD $'' 0'쀢  H  `' '쀢 4 @@DL@C"@ `L@D~`  L@DvDH (@D (@ H@D@c㿈'D'H'LD $'' 0'쀢  H  `' 'L" 㿐'D'H'LD $' 0` 0' ` ' @Bf"` ' @B^"`0' `H H@D`  H@CDPH@CG"@L" " *  4`DDD@ "` " ` "  㿈'D'H'L'PD $' 0`?P - 0'   P@ '  v ' @A"` '"  0' @A"`0'" P  S  @A"`0'"  `H H@Cc`  H@C[DHH`nbH@B"@L" * `@DD` @ "@ " ` " D@/ 㿀'D'HD $''' 0`  ` '' 0'耢   H@ ' '`'耢 ?\䀢 ` " ` " 0@@C@B` "  `' 0'耢 @@B ' ' ' $@ `$ " $ `DD@ 㿈'DD  D $'`- 0'  '@@B@B'"("$"`" " 0 `D 㿈'D'H'L'PD $' 0` H @L L"P P"0' 0'쀢  H  `' '쀢 L L@"P P`"㿈'DD $'D ` 8 `  ,` @v @vDDDD ` ` `@€ @v' 0'   (@ `' '''   @L`<D @ ` D` @ 7 `$   `  @vl @vg  `  @v\ @vW`@v`' 'D`$("@  @ D` 㿈@'DD $''` ` $$ @     ,``  L   .  |  u  O     6d    X 8 a P`$ *` 0D` A ' `;` $ >`$ " $`(@  $ `$"@ `" ( (` `  `"@ " (` `$@=D~D ` DD D` € ' ` 8 `  ' ` $`%`$ " $ $`( `$" (` `$@D.D ` DD D` € ' ``("@ " ( (`" (`$"@ " $ $`" $D 'k `d`(@ " (`"@  (  `"@ " (`$@ " $ $` `" $D '2 `+D K '# ``"@ " ( (`" (`" $D ' " ,D ' " ,Dx '$$  㿈'DD $' 0''  '@@?{@?x'@?qD@?n㿐'D'H'LD $'D H@?:L L@='@ D @s"D @l㿐'D'H'L'P'T (@=Y' @=U'" $"P" T" " " D" H" L" " " 㿐'DD $'D `*`@s @s'D@D @ D` s a@uP`' @sD @㿐'D'HD $'H  # a/D `D` D` B @so`@s* : @u @sb㿐'DD $'@>D@>㿐'D'HD $'DH"  `  ` `H€㿐'D'H'LD $'DL" DH"  ` `DD  D ` 㿘'D'HDH"㿐'DD $' 㿈'D'H'L'P'T'XLPTX@,'DH @@'@}@>)㿐'D'H'L'P'T (@<>' @<:'" $" P"H" D" " L" T `@" " " "" L" T ` `"  ` `  "`" 㿀'DD@= (''  @;'D'' *`: D`  D@=2  ' @<' ' *`:  ` "@' @< ' '  ' @*`'`'*㿀'D'H'L'P'T'''H D@=1D@=- L@;r` @;p'*D *`: D @='쀢 D@= D@'D *`:  D쀢 D" L @ D" D@&!+ &!(`*`@@ -&!   2` !$&!  &!$*`@@ Ŗ$?`  ! `@ @ @" "?㿘 @ ?&! &?㿘` ``" `?* 2  ! @"@ Ր /&!  "` %?@*`@@ И$?`  !``@ T@ @"6 "?㿈'P\ 2d?P@ 4 * 2 ` P@S $ L?$ ` `"`` *`/`  `*`2 6`*`2 66*`2`@2`* 2 $P$  `` *` *   6* 2 2 P*@w2 ?6P`"$ $ 㿘   "   "    ?@6@ !ؓ*` -   ?!0    2@$  `?@g  - $  "` "@!& !&$! "㿘a a  "@Ր " @` & @! a t?r$a "` "@ 2   "f&  @ *  ?  @ 2d  `" `a0 `aؑ2* @ `2*`*` *`*` # *`#  2 $  + 2(&  @ *  ? @g 2' $  , "` "@a $ a$a"  "  2$ & & &.  . a& a&$a " @ :@`! "!"!ā"!㿘! 2 !".    `    @ 2?`"  "@  "` @ "!2  "`@"` `*` `@ !"`!"@! ` 㿘  . *   @ >`  'p= ` *  (( (( ( @ `O ` `J0(tX< * (   * (   * (   * (   * (   * (   * (   * ( Ȑ  `? ` `:0,(Lt`*  *  *  *  *  *  *  * ؐ    (  㿘`,  @$@ ,`2 @ , 2 6$@ ,`2 @ , 2 66, 4 ,  , $@2 2 㿘`.` >D" . "@ # `*  @ *2 @@m# 4. 22@2*  ,4 @` 24 8?& 8`  .`㿈  ]  V 2 n?-`.`3 @h3`  .   ^- .    -  ;  ߐ,  '2$@ '%@* " , 2  @$@  $44  '`" "'˴"5* 2 * @ * %@2`* 2   ?.   ?-p *    #\[ 2?܀؀(,`2 @  2# ` # 4+ 3 + @ + ' 3`+ 3 `  @?  e ,`2 ` ^-`  ' 2"'`' `" '`2"  @ *  `@ @Ȓ!y ". @ *  `@ @2?X .`* 2  ,`,`2  *P @˒ 㿘` 2 `*  8+` #` *  @ *  `  U? "S?` 2 ( @ *   `@8 `@<"7?` @ *   `@ ߔ ` 2?` .` 8   & 8 (@` 4 $   @ 㿘 4@@ `2  & 4 & 4``@Z.`,`2 ` &` ` *`*@`2`*  ?2`2`2`4`㿐!?  6@ ?6`  6` < d*  @6  *  <  R *  @  @. ?@?   `@ "F?2`2   2  6@ ?6` 66` ဢ@1`  :  + @'*@*`*`􀢀 *`` 7**    @7*@ *`` 㿐!? @ 2g?  ဢ@+!   :  $@'*@*`*`􀢀 *``@  @7*@򀢀 *``  <  *  @4  *  < '   *  @  @ߓ. ?@? @( "?㿘@   <  , Ḕ@$Ḣ  @"?* $  $.2 đ."!8     (㿘` ``$,:  D:@ ` * ?4 @. 8@?2` * ? ` `$* ? @  :  ? 4  * d   Ҭ,`D$`$`D "`D`@$'$` $ $`  ncX@x 1y , @  @" D" @` * ?2% `` , @ W ^  ,@`D' "`DՐ $` , @  @" D" @  :**%   * @$ 4, U   :**$   * @$ ` @f*` `$ ?$`$  `D  ` . @ @$'4 . . 6  㿘` *`2   g*  @ ? $@&& $  :@*!8 * ? @@b   :**$   * + ] 㾘x@1 @+#@?&!@! @  @ !8@?㿘`,``%4, @2 `@͐$6, 4 @Ð64`4``*` $2* 2 㿘!@6 @ .``$!8.`Ė  _  !8@!8  @&˰  ? ''''!''' '  ! @  "  "&  & . ``& i& &`A@/" @Ӕ ?` 2``j  & n@vc d&  @"&  !0&  0N  &  @ H ݐ !& !T&  (& ! & "& !x&  & "&  @ &`  2  "`   @{$   )!€??0@ "@ @@͐`"&@@&@ 㿘  `"" @K & " ("@? "㿈  `"" @5 & " ""*" "%Y!̀ !Ȁ @ߐ  @ M&!"&!!@{"!" @" !'"' 3'"|.@((((( ( " $@2"  @"@" T @ "N?"5" )2 "!€?"??" %" "" '@q" '"'@" "'@( 2#?"`" "@2@ 2 "& $ "  "" @ x! @䀢?/' ' '' "@   @e  ""@@?2 @E J?`    ?"@ @,`2 #\ @ !23 " &". ,`2`* 2 @ .`` `"@*   4 "@4 .`2   $  *@n " "  &"@&"  㿘 ,&!  @` M &@& 6 t  ?* 2 * 2   *`2`@  8!!"!2`! &!  ̒*2     ?*2     "@ @  @ @) ,!?&! `@@  `*    ?*     "  @x !@° "㿘  `"@h $ `7 *`@ŸTŸŸń8Ÿ\@ $)" ( $  $!   ( " "  $?2"J " )2"!€????"@z "7?" " )2 "!€2&" ؀8  ? $ $ (, (@" @"@@@  $ 㿘'L!Ā L! @  @s  9L&! &!!@>  &!& "= `@*  @    !@!̀ 2+?'!" @ @ !̔  !Ȁ @k  @< 2&!? &!!@' !' ' 㿘 ``@@  $`@. ?")?@ @?2`"? "a@$` $`a "a@ $a$aaȀ "a@$a$aa@@@` 㿘  ``@ P $ `"" @? " `  `@? ?@ \" ?$" 㿀 @  L!b' '!'!Ԑ'"'"   @'@   ?@ 9'h'l'p 't'x'|'' ?"@xvq|0 't|  !`'|"' "'!'|'l'h' 't"''x ဢ@dG@z"$G @"$?$a$a$a|$a $$a@i$b5$` @ $a"&b  $b &&  (& Ő & "& Ȑ#& "d& #l& ! & `    "b 00 $b @ $aaА` @E?$ab  $b aВ @ ? a@ ․`̀ la@  ׀ L!b@b ??$b  $b 'd'`g'\f/e\//d/c/b/a/`/_/^/]//'X[Z/Y/X//'TW'PVQ//U/T/S/R/P//L!b@ ?"@}{_x'xb  $b $a$bx hЀ!'x"'xx@ 8'xh 2$ab  $b $ab $b $b x$al` x?@ `*  'lxl* @ *'llaؐ?@l?t@g?4aܑ* 2   4aaА a@ )$@b  Ò`8Ĕ@ Ɩ@1?b  $b  b  $b @b  $b @ "` ` "a@aЀ?@@ 㿐 @ ˔ . @@ 2+?"@@ "#?@ | 2?$$ $  4 !ؐ4  $ !@  @ ,  @ ' 0?㾘n@#n#@ w #  `n#n#@zx@ @@5? @ @ @#d d$  #㿘  `"" @ ݔ & " !@"? "㿐@3 `@/ & :! @y  @J &#?'!?@  8@@  " '@' 㿐@ !ت `?@k2&`&?&`&` 6`6`@&@`@ٔ @"`@ i @@&@ۤ@ \  㿐@ `@ @  2` ? "!@ A  ?`@' @  "' 㿘"`!@"`" &!&" @  㿘!Ԁ`@  " !&@ " $!Ԑ $" @ ?h ``"b @@  $`b @A   ``(  " `@. "?`aܐ : (`A?' '@, ܒ`@( ``aܐ '?Ԑ' '@ @ ``aܐ ΐ2 a@`@  "?(`  @Ш2 @Ш?  Ѐ @@ u  Ѐ "b "@z?2 @@ _ ?`   ?  "@ @ #\@< `0j* 2  ,` `"@*   6 "@6 ,2  `& $ ,@ `@`@`(@  2 a`@2a`  4`a䀢 2@  2  ?2 ?@2@ $a 4a쀢 2 @2@ $a4a$a@@  2b  @b   $b 㿘!@F 2!F&!& 6 `   ?  "@ @*4&!!䀢    2,&! 2 ?@2%&!@@ &&!  6 6!6!  2&!䀢2&!@* 4&!6!쀠 `?& @  㿘 ,&!   @ 2& l ?2 *   , 2 6 @   "A!&Q, ?, 2   ," 2%&-  -   @[ 21 - 2`?2 @2&  @# 2 &6  ,` 2!"@!2 ! &!,`2  @ @ 㿐`@y ' 7@ @   @ $  $  &㿐`@T ' 2@f7 @Д   @ʔ $  $  &㿈  `"@ $ ` #*`@ ( @@&@? " @h#\!@!Ȱ" @@x 0$ 㿐`e ̓*`@D@DD@D  @ "J?@D @ "<?`?2  "` 2 &@`@ @4 '6`@. $  @ "?`?2 "`  *@ @ @ &@`?2 ?6` 㿐 (    @XT @h E "# (E&@ ( 2! `   *`2`?2 @26&@ @۔  @E " &&@ "   ` ,`&@` 6` ? @ 2 @% 2??2 ?&@6` 㿐"}  "Y" q' '@  @ ' ' 7  & +@@s @ߔ 2$@2C? @b =??2 4  @4  @@I &  ?2 @2 `@8 `2 @ 24 ?$&  &㿘  " (@& &  (&  . ( (6  . (x^@` 7ސ@ @``"4`*`@2``"  @  $@ , $@  $ , @ ?@ 9@ 2!"  @  ?@ T@3?"_! ,@&! @@ "K    7ހ  " 0? ; = 09   7 ?!`   ) ?  + ` 2 *2  (#` ? ? ' ' ' '!€ ?:    @ c``"@ @@  @` @`׺  ޑ* 2  *`@ `" @ *`  4`  "`  0 @ c0`ޖ"  4`* 2 *2@ @ py$ ސ"4`*`@2`* 2 @ $@ $@   $   , @ O  X` @Ő?}P`ހ * @  @   ` @$$ *``@$4`2`, @4 $@@*$  * @  @   `  ?2 $$ `ޒ"@ 4`* 2 *`2`?2 $@ @ $ @ `"@ " @ǒ?@?@s @o !@i @e  @_ @[ @W @S G ?㿐0 ^ 4`$@4``$`@$`` $` ` `?2 @ @&` 6 7&?&@ ؠ2@@ 4 $@$ `$  4 4 ` $ ``@w 2@@  "`@ @š@ W"@ &&㿐ɒĒ $@$@$`$ $ $` 4 4`!ڐ4 4``  $ $` @&&㿘!ؐ?6``6` @ ?2 @$$ `?6``6` @ ?2 @$  $ ` 6` ? &` @ 㿘!ؐ?6``6`@ &@  $, `  & 5`    ?" 6``6` @ &@  $ , @ Ȑ    @>?  ? `  " 6`6`` @@ $ @ N 6``  ? "` @7  p''   ` 2`*`2 a؀ ?* 2 2 v7'ܺ 'ԑ,2 2` 6  "-   - 0*  - 0$2  @ @2  @@@`    - 2    @2   @ @   ?@ ,2   / 2 ܐ  :*- 2   "  * "6 2 @ # * ԑ2     ,- 2  ,2   @6  `( ,`@@,`  5``- 2 @:%``%`"5`,2  "3- 2 + 2` L  - 2 @ `   "* " *0"  "*0 @ @  @ @    ?*   @ @ @   ?@ L ,2 " 62 @ , 4  + 2 ,2 @6 6㿘@ " ?`  "` @   (0 *``0 (0 㿘`@*  \7@     2l?(`2@ " @"@ @ @ @   @ Z "Q?&&@ $ && & "@   `` ْ 2?.@`2 " @" `  @ @ O  @  2'@?  '`@ ` @  ' @'  ' 㿐    1    *     2   *       ' '` !r!̀ "!?'!€ `8 @  " ` `` @ @    ``@@ @ Q ' <   @ 9 " @ $( &&   "`"` `&$ @&$&$&$"$"$ "$$㿘$?ɐ"n@c@@2$%  &$"&@ *? *    ""` 2 "`" "@" " 2 &" & 㿘$@^@1?`@? *   `"`"` @"@"@$@$`` 2@"`" "@`@` & "` ` @`&"`$` $` 2 &" &  `` I,`@"D $@ $@6 29 $`@$$  / @ } ") $` `,`? *    $@$`` 2 "`" "@$` $` 2 &" $& $$```    *㿘 @ & "`  @ &"`@  2@ } 㿘  "  @W?2  ?2 @$` 㿘$$ @*5$"1$  2)  @5?"0  ? *  @  ""` "@ @ $ "`  @ $"`2 $@H  & $ $$ 㿘$ "$$$``$@`$@e 2?$`@$$ ?` .`("   22 㿘` `= $ @$ ?"?" $ "@"` " ( @@! @" 2??"?p  ``  $ ` 2"  s  k 2 "!€??"b?" @ 2[? $ 'ܐ'" "ؔ   4?"@ 䀢 Aؔ   """?"' 'ؔ  ''"@ ` !ؔ   ?$ $" @ "?@"  ? " *@$" ?㿘  ` $ " (0!@`"@ @% " 2 $ @ $?$ $@?  " "  @$" 㿘X 2@?`@@  ; 㿘. @   Ԓ ?2F?`  ?@ @@& `.:`?# @`*6``  :2 *   `? ? @" : ?*  "` *2?*  `?6`b ?$b㿘  `ה $ @ 2"@? -"" )$ !€2? ?  x" @"@@ $ 㿐 Ȁ @O  @  $7?$''- @?2.2.  @E ڦ *   !$ 㿐"C "!!@!@!'!Ȁ&' (  +?2.!Ȥ!!̰& !!Ȁ $!@ސ @`$!ȑ. 2 @. ʤ*!Ȁ "  !$" 㿐!" !Ȁ @  @ $!2? !.$" "$!!'"'""@!" :" "!Ȁ *@  ` @ "H բ`@ 䀦$" 㿐bbb " b*'b  !$b  * & '  ?  $b P" `2@0'....'....'.. .  . '. . ..7..7 . `䀢.?K2 * 2   *2  7* *   '. ޒ *`*`*``@'*@*`*`*`` @ `@'*@*`*`*``@'*@*`*`*`* 2  *0fd* 2  ` *2  7* *   '. ʒ *`*`*``@'*@*`*`*`` @"4`@'*@*`*`*``@'*@*`*`*``@'*@*`*`*``@'*@*`*`*`* 2  *P" `2 @0 `?J2 * 2   *2  '.  *`*`*``@'*@*`*`*`` @ `@'*@*`*`*``@'*@*`*`*`7* 2 *怢 *i`2f* 2  ` *2   '.  *`*`*``@'*@*`*`*`` @1`@'*@*`*`*``@'*@*`*`*``@'*@*`*`*``@'*@*`*`*`*2`@`7ʐ* ˑ2 *`ʀ *`'....'....'.. .  . '. . ..7..7..#t w* v*  u*  t * #p s*  r*  q*  p * #l o*  n* m* l * #h k* j* i*  h * #d g*  f*  e*  d * #` c*  b*  a*  `* #㿐  `"" ^ $ " @H " (0?@=A 8  "?   1' ?2   @1 2,? @? 2``  2 @  ?`? @^ "? "  $" 㿐@ s " @@֒ ,` [  !?&! "8I "İ  ` ?2 ?@2! @"@!2 ! &!2  @!"!2 ! &! % ,   " @@2`@@r  2q @@b ,` \  t!?&! "Ք "P  2! @"@!2 ! &!!,2  @ C  `!"@?2 !?2`! &!+  " @@2`  &@`?㿐 |@?    r`? @  2X" `?2  2 @_ Z X?ߔ S  ?2 @  c ؐ ` ?2 " ?#@ 4  M  @ʔ?" " `4 `?2     ?  ?@ ?㿘?#! ,@&! "q@ "? -` @   ?"d`?2  2@@   4`!4` E$` @ 2a?$ "!Y?` ?@ @@$ ``4``  ?# :2 *  @ `?2 "?*     *2*  `?4`  @      ?@4 2  ͒  㿘 (@  . @.  .@p 2k?.   s ?"]?`  @` h@ ?2`P?`@   ? @@$ ?# .6.`   :2 *   ?2 "?*     *2*  ?6 (@  2   @2  ?6  㿈  ( " ` . (`'7 #\  ` 2 '7Ք 2 ` W,`?2 ?'7  ` C,`2`" %' 27 2 `"   ?2 ?2('`"$'m 2'/?7 2 ` ,` $@ 4`ߔ '7 #\`    `  ,`㿘``"`1 "?`"` ``" " 2`?"`  㿈  ` $ @? &" ? 2#\@    !"  @s 0@$ 0@//D? ` @ `2&  & $& (& D&& H& & & & @& 8& <  @$8 & L& P& X@@  i& T@}. \ r wN@ r". \N@ w a2@. \@А *`: ?, N@ ` 2N@N \ B w` 8#` ?   @A#\@& H`,&  H 0&? @ 8@& D`& D &  "@& @@& @ @2N \@ w`#\#`#d#h #p   #l @ 0@#㿘K?㿀@//` `  @Ĕ6 㿘@// %    < "  ? 2 " D  @@C  &  @@& < ?& 8 D& ?& `& @@@" & X  & & `? ʢ` < " #? 2  " D  @@   &  @ @& < ?& 8 D& ?& `& @ < " #? 2  " D  @@  &  @ @u& < ?& 8 D& ?& `& @ E?`" A& 8  ? < 2    2% D  @@  &  @@F& < 2 & 8   D& ?& `&  ( <`` < " #? 2  " D  @@  &  @ @& < ?& 8 D& ?& `& @ < " #? 2  " D  @@_  &  @ @& < ? & 8 D& ?& `& @* ??0  ? < " ? 2 % D  @@1  &  @@& < 2& 8 ? D& ?& `& @?`??2 <`.  ? < " ? 2 $ D  @@  &  @@& < 2& 8 ? D& ?& `& @`2 <`.  ? < " ? 2 $ D  @@  &  @@e& < 2& 8 ? D& ?& `& @`2 <`,   ? < 2    2$ D  @@  &  @@6& < 2 & 8   D& ?& `&  ( < <` ?& 8㿘  >? P " @P  " @N \ w r@Đ2 @@3 @ " 8@ 2? 8 & D " H@, H " T@& T  @  "@㿘@//|L \ r" 8??? ? |$ 8$ x$ 1  X "$   8  @@$  $"@ $ "$   @@  "@$ W   < " D  @@  $  @ @~$ < ? D$@Y $$ 8  L@ " $ L @ L ?@  ?$ 8c 8 2 @m  @  $ L 8 2   < 2   2 X  L@ ϔ"  $ L&㿘-?L \ w"$0'$ 8$ 1   H  H @@$ 2?$ @Z $ 8  2  L@  $ L&㿘  N \ w"& -?& 8*?%    H @@ؔ? H& & `@)  & 8`2 8  8 ( @h @ 8 ` 㿘@//` < $?  2 " D  @@!  &  @ @& < ?& 8 D& ?& `& @ < " #? 2  " D  @@  &  @ @& < ? & 8 D& ?& `& @*  <`$?  2 " D  @@  &  @ @d& < ? & 8 D& ?& `& @*  <`$?  2 " D  @@  &  @ @;& < ?& 8 D& ?& `& @2*`?& 8*`㿘 ?1$`8N \ wY  & '`  `H`@@?`H$`$` @B ` $`8`2`8 `8 (`@`@`8  `  +  P " @!  "; @N \ w1 r@2 @  L @``4  @   @``4   >? P " @  " @N \ w r@j2 @@ِ @ " 8@% 2? 8 & D " H@ H " T@ T  @ @㿘@//   $?&@:  8 &@ (2?  (`N@ 2  P`$ 8  " *   P @@^ T@[@  T@!& P P`,@  P@ P㿐#\#`   @ 㿘@//Ἦ\  `J 12?`8 ?"? &  0& (&  $  4& $" ?    2p? ` ` f? ( 2& \?$@$`$`$ ,$` ?$`( $`D,$`@?$`H`D @/ $`L (`   $`, (`   $`4 (`@  $`8" ,$@ (  `,  $``4  `8 2 $`x $ @Z" ?$`|,`@  $@ @`+ @  @W$@ 㿘   `"G? *" 0A?@ 9& 0 >$@ ,@$ `$ P ,  L @ ,$ < `*  H $ < < , L *@  8 H@ @$ < (*`  4* 2@ < 8* 2@ ( < 㿘 "*?  "&? ""? $ 2& ?& &   & , $   $ $    * q$  & 0$ @@$ 㿘@//0      ` .? x 8*@ *`@ .`* `  @"  x  @  x$ x 8.`@*`@ $ t@ $ $ $ p$ | 㿘@//``( l?   2`  `"2 `"  $ ?S$ `$@` *F$``$`x?* (:` 8 * ```  @H $ q`$``$`4 *@ ``$`*@ ``  `0`$`2*@ ``$``2* `0`$`?# 2*@ ``$`*@  $0` "-`8 " ` @r $ ` "` $"@$""` 2`"`  2`? 2 `@4`` `"   $ ?$  `h 2 `x`j``"f``x8 *@ *`@ `€ "$````  G?H``@ ]  @  `2`@`8*  2?`@ `8@?*`8 " ` @ $ ` "` $"@$""` 2`"`  `?$`N L ` H `0`$`2*@ ``$``2* `0`$`?# 2*@ ``$`*@ `8 ? ` @ $ ` "` $"@$""  ? & ?`$` `?㿘 "0? `2`*?`"  $€ (  8`"  $€ (  4`"  $€ (  ,`" ( $€ ( (  $€`&  q@??` "$?`2@? ` ` ` ` ` ` ` ` `$ $`( (`, ,`0 0`4? 4㿘@//  @*`& 0 8*  2? @  8@R* x`8*  *    x& t*` *   x& *` *    x& *` *   & p& `& P& h & l& T& \& <㿘 p l , ` >    , l  4 ( ` 0` h@8\@ W@ R@  L@   6'@ /'@ ('@ !'@ '@ '@  '@ *ɴ'@!  ~ ' d@ (@ ( h h8㿘  0 h `"  `82 4? `@ */ ,@4 d @ `"& d"@ P& ` 8"& P*@@ "2@2@ 4*@@ "2@2@2 A  , `@ h  `"  $ `  0@ٔ$ 0@ @ $ $  h & h , ` , L @ `& <@ `*  H & < h!  2z 0㿘?#? ?# h 8 `h h `R "R P ` h & ` ` & h( `& h& ` ` P "@ >@* h  ,  ` P @ #  `& P  `@8`" ` @  $ ` "`    $ "@$ "" ` 2`"`   2 hD `&  , ` `  P`?@ z#  `& P  `@8`" ` @C  $ ` "`    $ "@$ "" ` 2`"`   ``@?   㿘  h! Ð h!`"  " P h  < ` , L *@  H `@ @  (& < 8*`  4*2  < 8 `* 2" T ` "@>@8  T | & T TJ ` d@ "  h T T t" (& h%& T ` < , L & `  H*@  (@ @  `& < 8*`  4* 2@ < 8 `* 2 T? & T  ` ` T , L@& ` ` `& T  ,& <@ `*  H & < , ` @   h `& h & ` "k h P`&  ,  ` P @#  `& P  `@8`" ` @f  $ ` "`    $ "@$ "" ` 2`"`   22 hD `&  , ` `  P`?@a#  `& P  `@8`" ` @*  $ ` "`    $ "@$ "" ` 2`"`   ``@?   㿘   h!  h!`"k " \ h ( T < ` , L *@  H `@ @  (& < 8*`  4*2  < 8 `* 2 T d& l& X'& T l t@:# l ` "@>@8 l | ڒ& T T`8 l |  `2  l ` d"  ( l& T l(x \ T s X ` h`"  @ h l`"@ l& h?& l ` & ` < , L *@  H (@ @  `& < 8*`  4* 2@ < 8 `* 2 l? & l& \& T `  g& ` P`&  ,  ` P @#  `& P  `@8`"h ` @I  $ ` "`    $ "@$ "" ` 2N`"` J \ L ` ,@ @O "7 ` P`&  ,  ` P @=#  `& P  `@8`" ` ` @  $ ` "`    $ "@$ "" ` 2 ``"`  ` h & `& h  2 hX   `& \ h`& `?& h   ` ,@ @ & \ P`&  , ` `  P`?@#  `& P  `@8`" ` @  $ ` "`    $ "@$ "" ` 2`"`   ``@?   x@//\ < ӄ   @D  `H  "  +6  D * (    H  L`P   T  ?( " ,@6  P * +@  `   ';``LP  T  + !+`"@@ ?,@6  P +@@  ?*`  `2?? 62?  X 2`` 耤  7耤 ! X ,  2`` ꀤ  7ꀤ!! X ,  2`` 怤! 7怤! X ,  2`` 耤! 7 X!  @E \4`@В 4@  ` < "@㿘@//ܮb"  "+ `)|"+`d*p"+$b2 b" b  "   h "+"+ @"+,$t060 t0|60| H0p60p 2$""""㿘..D8PL) / TP.@/`@*   / /  / P@ .@ .   . P.. P㿈@`` '    '2k0@ 62k0`H * +P* @2   <: "",P,`@`* @  @ @ 2` .`@k0@ 2k0$@* @@@@ & @@@&<Ѭ B-.`k0 .`k0 .`0?220 220 ?20$".`+0`,P * @  " @ @i&@@&4 `2?x  * 2`  " *@ 2@w 6 x? @` D@`  H& "=&  L@ " 2`  & * "+P* `  D 4+&`   L""  & * "kP"kPkP"kP,`4 * `?& @   " &  䀤&` D2  :   ? 4 D H L,`+T&*P &+T?&* +T"+P?&* "+P, *@5    `**2 , 2 &+T W  Ƣ`H & *+T"P  +2?* 2 `  `"  *` @26  㿘?`      * ? :0`@`"/@.p0p .p0p* 6*` 4**6*6*        ʲ`㿘?       c  *  "R. * *r"@$*p*p.6 &.@ &0("@>6(6& x** r"@$pp.6 &.@ &0("@>6(6&"@$.6 &.@ &0("@>6(6&`.6`&.. `&0(6 "@>6(6 4N"@$.6 &.@ &0("@>6(6&` .6`&.. `&0(6 "@>6T(6L"@$.6 &.@ &0("@>6(6&` .6`&.. `&0(6 "@>6 (6&           㿘@//("  ~ *   6    & +@  *  &  2 *@ 2 :6  ?~ * @6  &"   *   6    & +@  *  &  2 *@ 2 :6  ? * @6  &"   *   6    & +@  *  &  2 *@ 2 :6  ? * @6   7&"  lb  @* *r+  @6 & *  &  2 *@  @;6 ?* *r* @6 &՚` Ŕ)|㿘"   .   6   & +   &  2 *@ . 2` :@ 6  ? . @ 6  & "* ` @ &@)㿘@//"    +@   6   & +   &  2 *@  ;@6  ?  * @6  & Xb$ #$ +@   6   & +   &  2 *@ #;@6  ?$ * @6 & ` @p& "b " 4a    +@   6   & +   &  2 *@  ;@6  ?  * @6  & Xb$ #$ +@   6   & +   &  2 *@ #;@6  ?$ * @6 & ` @& " &㿘@//㤮 x >   @u+ r++G +C)|g+$  l * *r 4 ✆ *  `@& ` "2` 2      `$t <"   *   6    & +@  *  &  2 *@ 2 :6  ? * @6  & X\ @ >""   *   6    & +@  *  &  2 *@ 2#:6  ? * @6  &++`] @Ô)| "`@& $t2 ? 62  t2)|? 62)| H2*p? 62*p 6$"&"&"&" &@3b  & "6 㿘@// "*`2  `& "`* . ` 32`b H  &  !*  ``2  T@ T6`! @* ` T@ T6`! @* )| 2| x *"/&*  P `  P t" i|@V``@"b 2 @4 4  "  `?㿘@//ီ"   "" "-H+`D) @ T'P%L9 ",`@`+`(@  $$@ @  +  @6   & *   &  2 *@ $;6 ? * @6 &) d$$dd +  @6   & *   &  2 *@ $;6 ? * @6 &)  +$    (  @6   & *   &  2 *@ (2`$:@6 ?  & (  6 @ &`9@ T0`! )   $$   +  @6   & *   &  2 *@ $;6 ? * @6 &)  +$   @ (@  @6   & *   &  2 *@ (`2`$:@6 ?  & (@  6 @ &"@*"d #d +@   6   & +   &  2 *@ #;@6  ?d * @6 &d"&   `` (`` 2(``2 `?*  0`* 2  "`"( `"0( 2" "`"(  02" `"*  " 0  "(2"    `# *   #   0    # (3# #   # ( 3`  # (   # 8 ( 0 `# *     # @(`㿘@// p㿘@’㿘@+㿐 "?  2& ?&  & ` ` "@  @ 㿐 "? `"? $ 2` ? @ ( $€ &  㿐@//쀦 N 12?8 ~?2 z? &  0& (&  $ 2 ( 4& $ (    & `?"  `"   "`  (  `"O? $ "K?` @ ( $€ & "     t @N*  "` "+? `"'? $ "#?` @k ( $€ &  "   & &  & ` ` "@  @ 㿘 m㿘@//ᐠW  "T? O`M? ` H*`@ @Txt$| `0 $   $ `$ @"     x  "$   2    | " `   $   $ $`  * @慐   $@`   $@$@ ` $  $ `$ @  * "`  "@ `Ԓ $   $ `$ @ *`  "  "@ ` $   $ `$ @ *`  "  "@ ` $   $ $`   "`    $ 0 "@ ?  " $ "   @?   " -" w @ `   "@ "@ `e $  $ `$ @  * "`  "@ `R $   $ `$ @ *`  "  "@ `< $   $ `$ @ *`  "  "@ `& $   $ $`   "` @    " $  "` " ??㿘   "#?  ?@ Δ 0  ? $ 06 * ?&@@   "@㿐"U? `2@O?  "@ "  `2C?    "  2  #  $  "@$  $" ?     $ $  $ ` ` "@  @ $ $    "@㿘 4 " 8&? 8`(`$€  2 & @ @Ғ @ϒ&&  $&  4& 0& ,   & 8&`0㿘 (   <2 (=    & $ ( $€0 & (& 4 4 & 8& 8? 8 ( $€  2 & @ @ @&&  $&  4& 0& ,   & 8$ 0p@@@` / 0$ , "? ("   ` *`@ @d0 {? *``  & 4  "  ) "+44 `4$@ &@@A  & & & &`@}?& & 4&4 & ?"`" " @e"`4? *`` 82`?# @ @& ?"`" " @E"`&  `  `     `& & &`@.2=  ( ` , $ @ "?"`2+ & 0@ 0 , "@? (" ( ` , $ @ "?"`2  & & &`@ 8@% %@" &  ` F ? *``  ?, `& 4   !& ?"`" " @"`@ ( `(`    & & & &`@?4&  & y? *``   `& *`@4 * "@  2  @ ` `& *` * "@ `` &    @ ?"&& & &`@\&  &   4  `a z  @,  -? *`@ ,   * @`` `4 $@ &  * J"@` `   @   ? *`@ 4$@*$@   4  4  ! @ `2  `&?"`" " @"`2  * ?* ?" &    4  `a *  @h& ''  #\#` !4  `@y` ?"&& & &`@@i2`(@>@;& & &`@?`$€ & && & & & &`@`$  &`&@@Q& 0 @C @ @ @`  0 ,  "? ("  `&  && 0@% , 0@  0& & &`@K && & &`@A & & &`@9?& & &`@1& & &`@)& & &`@!& & &`@& & &`@& & &`@ & & &`@?`$  "`"@" 0@㿘 4 " 8&? 8`(`$€  2 & @ @r @o&&  $&  4& 0& ,   & 8&`0`(`$€ $`(`$€ 㿘 $@ה $& 0& , ''''''''''''''''''\`*`@  "2 "     `@* 4 @ 8 "   *,   `  .,`@?" ' "@`   ,  :`":*`@ "z`@* '? 'p @   '.`@?"`M-  #@&@/ "  @*"  `/ '? (' '  p@{? " "x"z//'&t4@, "  "@4&@/(`   / !@? `/'"*  P/"* '&@4@ /,   "@"`* @/@@4 @@/?z @ " - &,? @ ?`@ S` `` ?㿐@//\#\#`    ??   @ ?&㿐@//Ю \`!  #\#`?? 3$ 1@@ ?($  #\#`,`   ^??  2 @@ ?$ @@0 @//  k"'<`'d<'h  4'`" 6"  8";   * ";   * "; `А@#` x # #\! ! l";? 6";`ؐ@#` x # #\ Ԕ   "@ ` & &@@ && 㿘  ?&?2?``(€``2`$ 㿘@//߮`ܐ"& * 㿘 (    "* * " " 㿘@@@`  / 0 ,@ " ? ("  7` ѓ*`@ @DlD `!*` ) & & @&``%  &`&@& 0    @@`  0 ,@  "@ ? (" 8 $  $ $ $  @ *`a *`@  *  *   4 $@ $  $  @ $ $  $T   $$?"`" " @Z"` @ *`- *`@  *$@  4  $  $ $  $ @ *` *`@  *  *   4  $@ $ $  A$ @2 $ :$ $ ?"`" " @"` @ *` *`@  *$@  4  $  $ $ #@ " ("@#@   "$ 26  (@   , $ @ " ?" 2$ & 0@֔ 0 ,@ "@ ? ("  (@   , $ @ " ?" "&  ?+@ (` $ ? $ $ 2=  (@   , $ @ " ?" 2+ & 0@ 0 ,@ "@ ? ("  (@   , $ @ " ?" 2  & & &`@[ ?+@`{$& 0@` , 0@  0& & &`@B $& & &`@8 & & &`@0?& & &`@(& & &`@ & & &`@& & &`@& &`@ & & &`@?`%  "`"@@ " 0㿘`$`(€㿘 , 0@`  ("`8 " ``"&`@&` 4 8& 8&`0@, (@@ ' 0  $& 0 0`" 8 " ``"&`@&` 4 8& 8&`0@@&` & ,㿘@@@` / 00 , "?3` @ `' ' '`@İ  (" . ` .`?* ```(@*    0 #@ ( 0j#@ #@ *`@ 0 @?* ```*  0:#@ @ : #@ @?* `@ `#@ *#   $  0 ?( (" (  " # ( $ ?(;@2 '`**  @@3` @ `' ' '`@3?@ **  @@  0#@(Q 3` @ `?'`' ' @'` ]`3` @ `' ' '`@ ` @  '`'@' 0㿘?#6 `Z "V. !#?8& `@ `              @͒` @`@Uc@Qc񀦠. 㿘@//ۮ  㿘@//ۮ`\ H8 @6  *  ` @6  *  ` @6  *  ` @6  *  ` @6  *  ` @6  *  ` @6  *  `@  *  `6 @"8 @ *  `6 @8㿐!@f"@'@В"@'    @㿘 a#" ` "` 'ɤ #a@−@ټ?2&@  Аb  Š #"a㿘 @`>##`%"`a"@$  @&@a$aa@a$a i  逢@*` *  "@( #`$ `8$`@ $`㿘 @ڕ㿐@/c &O  c "c c?"c2"c"##`   !` "##Ā"*z p  ''Ԁ` @`# 0 %2.@ `А 02`@` ?ـ Tّ* XP8@ 1`,`"?y`,`"?t`,``@"?m`@   , `@* ?Р `9`/,`"?ؐ }W`U`,`?ؠ c @ d 0. @S d   .  2 @  0. @?   0.  0&.% " @,`@Ԑ"Ԁ` ,`? ' 'Ԣ,`?ؔ "`. @`.&㾘`d㿘"! "!""#㿘  㿘"`"  ?2  㿐` 8"#! #  !` z#&` # `" `e`b``# ``#@`#@a`@M /G/# # " /"4* *,* *# %# `  *#"" * ** #4"#"# "c㿘!㿘!㿘@"P㿘oŐ" "c@w"# '@"` #Œ 0a#!! a!  &"p @נVa 㿘@"㿘 @"p ɔ 0 ??!"s??"㿘!!  q ! #Ѐ !  oW"0̐#Po"N㿘!?"@i?"@  „* (  J` Ѐ ((І J`Ѐ(ń 㿘a@?  ?!0&!  p&@"a@o@գ#!쀢  $! o@՜# $! `?  J@  J ; : *  " J   * J@ `"  !J@  J ; : *  " J   * ob@  !@ݒ  "! "!0&@ &v"a0&q"a &@ "a@ 㿘 . * ¢!  @Jcԕ2  ?* $ $Ő "a * („  ’a(*  " ń  ᨁ   ` @  `2 ` `* *`㿐? ?N " ` N@ " ` ? 0?@ @! "`" Ť! , @@;   ,  Ť! , @@.   (, ؀?֐& 㿐  ?P㿘G㿘 T . * ¦! ` @֌cԕ2  ?* @X@ԣ "*% @`%%  #@ ""`.`*   " `@Β 2`2  `$@c  , ”. @*`,*  "@ Ő "a㿘 !P ""o"!P㿘!p L!! H @4  X"0!*@$!ѐ ! ǐ @!@@4"  *!   !?c 6 2`k "!㿘!p 8 6 2 2"0" Ő?%"a  . * ’a  @ " 0* ’a  !@t 㿘 㿘oҐ#㿘o̐#㿘 !@]a``#`   #  @ "@ ? c 㾘?f ?#5®!-+Ŧ3 2  R   *` * *` *      a "2,@ @  @'@ ,@$@c &c  *` *   Ma  @"%aƐ %aؐ,@` @,@l#$@@ "#x Nؐ @%*?Uc"c"`ؐ# ##R Ē0#@㽘 .@?  #˜!@@  @% @ @$ 2 * * 2 * @ *`@ 2 * * 2`*` *   @`Ҡ $B:`!  @ ?#@ `@*@@0? # ”!!@  @  2`` @ 2 * @*`@ 2`@ @ 2`*` *   @@`8ݪ0? # ”!!    2` @ 2 * @*`@ 2 @ 2`*` *   @8ݤ`  ?6  ? -#/€¨ ˜!@   2@  @2`*` *  @"x@2`*` *    @2n@   2f@  @2`*` *  @JW@2`*` *    @2M@<  @2`*` *  @";$ @ @2`*` *    @/$    &  @2`*` *  @" $ 2`*` *    @$   `@ ِ  $ 3:   @- @ @2#  2 * * 2`*`  *  2 * * 2`*` *   @ `6  D6ΐ >+!  2 * * 2`*`  *  @"&2 * * 2`*` *   @`6 @  @ @ @ &:   @26& :  $ 6 @6Ţ `@f@!`  #`  "#㿐o@В#Ȁ@ "`֒?!      㿘@EN`@@ `.N ." ?А ( N *" N +J@ $!`J@ < @>"J@`J@  @J@  ` @* ` @*`  J@ ݀ $N  㿐!'㿘@`㿘@˒`㽐o@#آ o@# p` @᠀  p`@  2$ $p@~` L@ vL` t  `?ϐ Ő "ap` @ٔ !`?  ! 2   2  p@S`(  @ "` p '@A`0 "'@̐0p`8@M@Bp`!u"a쀢  "bpn!쀢 "cp@-! pd!H쀢 "ap]!P쀢  "apV!X쀢 "bP "`pL!`"cpG!h"bpB!p"bp=!x"b`p8!"bpp3!"cp.!쀤"c ! " p"!"cp!"c0! L` 1 ! 쀥 pb` 2p!"b`bp 2pp!"bpp!!@ $"" "` "p p" p ! @! p "`pӐ!"b@pΐ!!쀢 $" pǐ!$" pÐ!"ap!쀢 "a "pp!"ap!"ap!'$p"%$p"!$"p" "`!  p"$p" $p"($"  pb0@Ϯ  p""bp" "bp"8"b  "Ѐ "  " "" "`#a?*pp"@`@3  $apO"H"c@pJ"P"cPpE"X"c`p"`@"cp"h@ 쀢 "cp"cpp1"p!쀢 $"0p*"x$"0p&""bp!""bp""bp"`@ "a`p"@ !!p` "p"@ ’ 4  $!p!p " ` 0`p""a & p" 2! p" 2 pސ"Ȁ 2 pؐ"Ѐ 2 pې"؀?2  pՐ"?"$ $㿘! pG"p 0p p p p p p p( @p0 p8 p@  pP pX p` Pp `p p  ` p   㿘##T" "`㿐  ^?"#"0Ő?"aP   !    ?"pTŐ#hŐ?"a#0# 7" 㿘!Ё㿘` o@;#ؒp @4    ?p#pp#x 㿘! }#@㿘!  #`3cP   ? fdcP 㿐  ' h@Ɣ  h@  h@̺ @ι  ` p@ې#   @ޖ 4 p@ΐ#   @і  8  8 P" " p@ " !#a?$"@ %p#@Ξ  $a $"" 2ɠ"@΂@$a @{#@@$a p@Dch?""#!a@!?2 #@M a0Ta@? @? a0F >'Ԑ ?'5$ $@7&$ Ő!*`@ "` ;$'А /// ?'""/"//! @?Ѐ?Ő "b@  0 @ @ ?p@ `" $!!@ͅЀ? @ ! / !+/!! @ Ѐ?@ !@ Y㿘@ 2" %!#a @!? @ͱ a" !@!?@͡ ""?$!""@ *㿘@͑Œ ""  "b  @ aX$㿘@{ !X @ Ӓ$㿐"  :?@ @> * @*`@ *`@*`@*` @Ԓ#@,#* "@*`@*`''!!@ @Δ Ŕ ! `3`( ` *   @˜㿘 (  !ş!?! ? 㿐" !@ސ#@?1?JH"F#1?"  d ?%" @ 2 !?)#!#'p1?@ ?2@  ?"1?"  b @E 2#@# ? 0 M E(<HTl`xp.p+q(q%q"(q8qHqXqhqxqq q qqq 0㻘/q!q!@, 4` !ɠ"@̃q! @0@㻘'H'L'P'T'X@DH֐㿘 ,` @ ɐ"qa(@@/?㿘b ?# 0 @"b @@Y    @: @  @  *  :  *   㿘!"@  $  @@"$"㿐/Ȓ 㿐"  U $ / 㿘"b" ""A $b""*` @ (2 *2㿘"@4 @# & . ,  b۔   $   㿘"0!" !@ '" "@" "#! @b **` *  b "@  b *` *  `" 㿘 "? `L @*@  *`* *   @ `"`   "``@* *  "   `" btb ?"b   0 0㿘" bj 􀠠   P P"@P""@""@ P @㿘 P @ @ @  0@@  㻰'H'L'P'T'X@ȮH@㿘@Ɛ@X㿐 / @ʸ4 @B 㿘6 3 @,:  ` $`@$`  ?@ ??0 2߸ G@  ` Ұ㿐  "@ @ "@ * !'e "0" * @*` @@`  $* @``~.2 `^-2   "T  ^  "/ @`  v @@* 2 @"l`h4@( "(`" @Œ&@ 4%` U* 2  $ @ "`4@`2 C x  "$  25?4  @4@(`   @4@` @ ?  @@* 2 @"`4@`s""0" `@* *  b `-"   N  *N ""0 !"@ !" " $ '㿐/ 㿘!"$"@  bP"$"@  0("@*`  8  2 *  0* @? 㿘"?  @-*    @",*    @ -  @- *    @"  ,*    @ - Ϫ @57 -`* `"` ""`@6 *` *  "@ *` *  " * *  *&%@  * **` *  @@ " * "l* *   " 2@ *` *  *$J@ &@) N B04 * * " "+&@,`*  @*@ *`* *  @"` "`,, $   be$ &@@4;-` @ @15 -`* `""``"``4`* *  *4`" "* *"*` *  @@ " * "k`*" *   " 2"@ *` *  *$I`@>&@p  Tw4 * * " "+&@,* *@ *`* *  @"` "`,`, $   b"$ &@`@T-`㿘# b @ @' ,`*    $ `@,`"    " @L @+'%,`*   ";  ? b   5  b ,`` ,`*  @ =$@$@,`,  *2  2   ]  @* $ $ "`@,`   " b0!a"’" ""` 6  @    & @ 6 ##@ 㿐1! !" '"@  ' @ * *    `" 㿘 bԀ (bԢ  @ ,@``$,@   0"8@w  "T     * 㿘@!#  $#@㿘@c "c """  @ * *    `" @㿘@# @V#"!"!"" ""0""@""P "b $b !}$"" b 0 ,/Ŭ? @@Q@L% @i 0!/ + ,, $ $ $ b"b$ b $  @I"c 㿘@!# (b @ @ ,`*   " @ "$ @$ $ `@,`7""@""P"#@㿘   " !@"@*` b0* a  " * 㻰@c` @ "@ 2  "㿘"" 1&"0n   !"@.: `$"@$"@`&"0㿐" )"0! ;"@6 j (%  q@Ę "  : %"0,`& @ "@  ! @""@""0㿈 x/#b0!1"  " ! "" b@"b@ &" $b0s "   &" ""0"" ""@㿘'%'$ %$0r$ $0jQ l@L kG mC j$ $0㿘=:j'0"#"b "4! !А !Г/ :`@ $b $0: !Г/ & !В ?b  $b "" 0 0xس.`"@ @4` @2 *@@ے"@$@*@ `؀@"ϒ"@""@㿘>   "0! "@"@ " # *@ *`@@ ` +` @4. 㿘  ( "0! "@"@ " # . * * @ +`@ @  $ x ܐ @@'ؐ '\@h??hx@'ؐ '\@ h??hc "ccc x@@. @+ @( @% @"  @  㿘c ?c?"ccc   c @ì    ?(?(㿈q@ǒa0!  @° ߐ!ڐ&`א&` Ԑ&`ѐ&`ΐ&`$@´ 㿘@  @ˆ@@[ 㿘`&`㿘`` @ `@ &`㿘`ؓ*`&`㿘`Г*`&` 㿘`$ɐ&`(㾘U @L ,"Q @2 Kq@!"bP bP)q,  !L@‘y  , `* #    @- &@ @ @ @ @ @ؐ  J *`8* 8(8@2 J2  ?J ?㿘`"  @`" @ @`͔`  * ` @ & `( 㿘`"?@`"?@ @j` * `Ґ@?㿘`"?@`"?@ @ ` ?` `2`      *8* 8H2H *H  `  @ @  @2 ` `"` `@@ * @ 㿘``   @ ?㿘`(`$Ґ :" "  :"?㿐!0 8qa@Ɣ  1q@!"? /(ِ?   t    c   = @@!  &`@?@,@ @&`&`( ?:     =  .2 $/ \  @k ^:,@/ ? / ?/,@ `,@`$@,İ `(&`$@&`$c?     #  .  ,@  `,@`$@ *` `&`$@&`<?    ` . 8,@  ,` ` &@` $@&` 㿘   Б* : `HQ  *`@""""""""!!!!!!!!!!!!!"!!!!!!!!!!!!!!!!!!!!!!!!!!!"!!","!!!!!!!!!!!!!!!!!!"<*<: : 8 6 4 2 0 . ,  7  *: %?Ф   9  9    /@x? ? 8.@@k , :`  2N.@㿐@:.@/ \`X@.  .㿐L` L  " ,:   2,@& ` - L`-  `= ?А ,,@&,:  " `? '' L   \2LL '  qa@@@D 'Ő "b @,d!<,!8  7,* "2,\2,@ ,:  &  # \,@`?ؒƐ!8  2?,@`@q ,: `"ؠ ` `Б: ,:   "?" ",@`Ő "b ,@$@ &L`+ `-2 L@2 `@* ,@ ,@@: ,@, J-" H.00Є ("K Hx 2H Є   ` ?Є ( (H2H( .2 HЄ (HeE H-"+2Є (H  㿘 0  @* t  x2     Ő "b d? ^   l'Ť  ?Б* :  6<* )`)`)`)`)`)`)`)`)T)T)H)H)H)H)H)H)H)H)H)H)H)H)H)H)H)H)H)H)H)H)H)H)H)H)H)H)H)H)H)H)H)H)H)H)H)H)H)H)H)h)h)h)h)h)h$   `2$ ?Ѐ`2$ ? @, :`   㿘?    M@ . \/I?4D?@ @:??/@`@/ ,-@@ .` \2 /@@:)?/@`/@@`<@@? @?@(@ @ &@&@ ?`/@ @㿘    @  2  B ?@n `;:,@*`" 7* ?$$`@  @,@`   . \ $@ ?? " > *@@*,@2%?`$@      ? * " ?? * * 㿘D`4 ` ' `?8?, ., \"  Ґ < ` "&`."  *  @ `Ц &*?J .* J." .`.`Ѐ    Ѐ -_2 @2J 㿘N * N  .   㿘N    ߀ ]`. `\ " N` `. J߀](J    (  ((*`  2 *@*`2 *@2 *`2 *`*`㻈@ ?$@# 2#\@6?2#\@b?"c<M"#`$#d  @ @N  @M6 @@Bɔ "c<," `` %` !*`@2$28212828@' @"  @ @ɔ "c<"?㿘  # @?@?"c<"@< "b@"ɔ "c<"N  J@ .`J@d?  .@ J .`? @ɐ` 2  ? @y 4t@` # 2  A`@`#";` #܀`4#-ɐ@@T 4O@ =B@ "     2    2  "" `@  Ґ`  @  4@b?"c<" @Z  ?@Sɔ "c<"?㷐# @? `@>?"c<("`@??"N .2(4@ *7qaȔ$$@-?c#@q@v!؀ }q@Ȓa褒y @L /)?@+#@s eL@ b* @ 2L L * @ 2L" L * @ " L C@,@J Ԑ Lb* @  " L* @ 2 L )L   b*  2*@L   *  2*@"`J@ *  "`*@.$@$@a0@^ Ɓ DƁ H #`  #d #h #l Ɇ2 ` 2`@  #㻐 )$ @?`* 4 `*  2  @   ܤ 㻐  ' %? !ܘ$ @`* 4 `* 2 ߐ  X'D#'H'̀ @?$?# 'H"  ' 'Į < #@  )# @9ɓ,`ɐ#@'.bD $  DHbD * c;>,;BCl   )4ܰ?`` "8ɀ`#"@ 2ހ` @  @] %"8@"b$"8@ϔ  ""@J' '"8D H'@'H` @ 7"8@ ސ"7ޑ*  @ @@6-Ā`* @{'x.* 2 ' 77ހ"8*@2 ސ"7ޔ*  @  @`@S*b%""""8@kސ"7ޑ*  @@"8 "@ "@  @"  @ %"8 b<# `ƀ`b<b<  "8@  & b<"8DH@Ė Hb<  7p't7r"8p@  @ b<"b""8DH @1 H ɑ.c`*'c@b` '؀ $'"8 $x'ܠ @^   "80( .@@R 蠒 @ 0XU @"b" '"8 `@#Ԁ C'@@Ǻ #$#Ր "#(2 DH "  ?  #/@@oX D#  " @a'^.`# `#!@PbH "  "DHbH 9* B>,BBCl   )4,?`'#`@,`#`@@``@ =@ɔ <"b"@"b"?㿘!"8  @F?$"8""<""@Hd# `@~? @"c<"?` @  ''ɔ@ 2@4* * @$ ~*  !@ E$[?2Y? А ǰ$@.2  .2   <5` 9x  В ̒  ̒  Ē 5` ` @., 2  .2  /`2 `@ 4&㽸r@ q!@yk ?#`@@p@3/r@`3/%<# /@Y$r@R @' ( $r@A @  (   r@a`Ԑ@[ @ېp +@4 'll @ lJ`.l @ lJ`.h @~ lh`@ . ,  ?㿘@@  N@ _  J  R @0N _ J  R@ܒ0@f㿘@͐`  @J _J R"@ U㿐  @  "` 2  "`? @ #\ " ` @ 㿘   #@      ɒ@ "`$`㄀@  #"c@㿘r ` @  ` "` 2㿐' L@  L@ @ @ ?㿀3 b؛2` # c@ @@!(r!T'D!T ' ' ' ''''''߿߿߿r  r@ zD < D!r ?2  `"  ( ! @ c  0 2 D`0* j2 * # ` * 8  2  "@   ?#?"D`\ " 4  4 *  "  2 `,  j ?# `?#?"D*  \ " 4  4&*  "&  2 D @r@ !8,  >?#   ?  AD U  8*@ 2  B    T R D  @ 2   r*#:` r!H *: @  *㿘@Ő r@ e!hu @-@ r@ Y!@lg  N  #=?? N  8N D # @@L #2@$: ? `@ $ " " " @ݑ,  $`   @ "`"@` @N  #"N "#"cN  #" @&: %"# #@,    $@ "`"@` @ 㿘#  1#r @baЀ 2 # 㿐r@ `"2? 8* @ , @ @' @! J`. @ J`. @  `@ . .` ?㿘r@ aЀ@ 㿐ra @ ~ ra?  4  #\@ Y 㿐`?## =@m '*@ 'r$ 8r !* @ ,J`" @D  j ?#``'J` " J` r" @ E `\2+@' ?Б* :  Ds* UUUUUUUUUtUtUtUtUtUtUtUtUtUtUtUtUtUtUtUtUtUtUtUtUtUtUtUtUtUtUtUtUtUtUtUtUtUtUtUtUtUtUtUtUtTTUtUtTTUtUtUtUtUtUtUtTUtUtUtTUtU+ ) ' % # !  J ?А А'J+ @ ?А А'J+  ?+@ +@ 'J  "p`+@)?А   @ $ 'J , @ , , $@@ ڢ`'$@@ Ӳ`4 㿐 "\ !  ?#\`" `2  " @`4 @$```@U`@`2 `#c-`,   @ %%c"\ %%`"* @@ \ "   &@ $@$$` @`  2  "#  -` #6#` `" `r@ W`Ȓ@ o'r@ O`ؒ@ g'@@ "P  @ur@"P@@`?㿀!@!  @s  @ r@y"`"#-`, @o"c @ M  @I " $@o 4r"p@R$ @5 "$@[  r@I"@J  $$  $@`@ "@ ` `@X  !@  @  @! r@"@M 0"#   "#`@ "@ ` 㿘  #%r  @Ѐ  c   㿘@r@b 2 ,. , ' @ =@ &2`@ ` $@2`@m ڠ` ߐ 㿐r’`)'@Ք  @4 J`. @* J`. @  `@ . .` ?㿘rbЀ    @ 㿐`Ӷr" t =@''"@ p ?#r "`, , , , ,@" "  W*' r"@r?#@r!J"*`   @ J`-  @    8* @'J`,@ J s cJ@ " @  j ?#``'J` "J` r7" `\2+' ?Б* :  Ds* aaaaaaaab,b,b,b,b,b,b,b,b,b,b,b,b,b,b,b,b,b,b,b,b,b,b,b,b,b,b,b,b,b,b,b,b,b,b,b,b,b,b,b,b,aab,b,aab,b,b,b,b,b,b,ab,b,b,ab,a+ ) ' % # !  J ?А А'J*@ ?А А'J* ?+ + 'J  "s + @| ,$ k ?#`@$,'r#'J s2 J$@@`B"*` 2r#  @ @B r#H}?@$@ @C J@`h"4@`i`b" ,@r `l" $@ r ` `$@`#pJ@VJ`,D *`@eeeeeeeeeddeedeeeeeeeeeeeeeeeeeedeeeeeeeeeeed ' r# 'r#@ޒ  r#ؒ@Ӱ 0`46 㿐rc @ L  ,@ Ls`?  4 L#\@   4@ 㿘# 0s` +  @k* s@` @  ,-  `  `$ , 4@$ $  c`@"\ Ws` @ 2Q  @3  0,` j2 * # `,` 8  2  "@  ?#?"`\ "&`,  2  " 44*  ", 4@ 4 @p 2 `bת`@8, 㿘r@c,s `  L$P$ ` @$  #  c $ 2 $ #c  s@k` c$ $$ r@5`Ȓ@M$ ,r@-`ؒ@E$ 0s@S`0  $ 4  $ 8s@F`@ "$ Hs@<`P" H` "@ "$ H@   @ _@ɒ@ r@"P@`?㿘s `@b@` X  sc8"#"5Ơ /+'%#Ɛs@Ɩd@] ?N? "G* kkkkkkkkkkkkkkkkkXkkkkk`kkhkpkxkkkkkkkkk&L%P%b`Ƭ #,$Ts@#8$Xs#P@+b$b\$b\!# # *  @ 4$#@ /`@  J . J o ? J .J m J oJ d"?@  @-@ے / @Ւ .  D 2s#h̒"#s@cs#@" @ْؐ?   ݒ?s#ؐ@ "L  st X@ð #@ޖ    @ + `?  " L ` " `ĐӐ`H@ ɐ " @͐ " @#`& *@  & *@ i @j# [ "T V @$@$@O    t0  tt t @  00!(@ 0,@p & @A" ֔g#  @)  "`   㿘t!@@  !@@`t@!Pk   @, , @u@  @Q* 5t7t?`@b,$$$ @ -%@ , @ [. @. ]*"h @@   `p@v `$@-*`$ h* "@zݰ *`"#"# 㿐$@$  @  @  t@7!-`@ @ $ @ @ $@Ӑ$ I7t @  @ t@ƒ!@ 04%@* 􀤀  %  @p     p@ ,@"@  􀤀 @  @"#"# 㿘 t!"ct@Ȥ%a sVtt tt@ Y 0@!!@bݐ!@b #t    @* 6  ~ #( 5-, @+@,`@  c`@*@t"@b @`  "`  0Pt@j!L #H '㰓,      2  $   @6    ` "` 4  ` "` ?$ `@  "t& @Z 6 t"("0@  # 㰁㻘'H'L'P'T# ;'X#Ѐ #$t@Ҕ@  $"@ @%H tbH@L#ɐ"t@b@ɠ"ؐ@ؔH  @ @ `$  *@c "c㻘'H'L'P'T'X# ##Ѐ  $@H tbH@0ɠ" @H  @ @ 0`$  *@㿘 @o  "cЁ` < *  0*2 㿘@V < . @ 2`. 2 p`2& L"& P \@Z($ @($ w؀ "`ƀ @" *  \$" \`b`㿘 P@@̒" -`@ \ Q2 ?`\?#?#  L€ 2A     82 `I`` `@@""2 2&`@,$'$  &@ @!t"P֒ 2 @ -` \$" \?$  X."@$ $ \$ $ $ 㿘 P@@U" *  \ "   L€  2  `?`$ 8 `*`  㿘 0 6  8,  (@   8& 8 㿘`(J@ .`@T 2  `(tbh@    2  "  2 ` 2 㿘ڐ @`  0` 0&`0&㿘`0`8 4`0 @*`@f$`8 `8, " @{ 8 &  & & & & (& 4@̐& ,ʒ㿘`0`8 4`0 @ʓ*`@B$`8 `8, " @W 8 &  & & & & (& 4@& ,`<& 0$`<`@`<@ 0$`@㿘  ,@& & ,㿐@ @/(Ȑ"& L"& P <& @ @  4 @ t"pS F@t" @! @t  t"  t" .`(t") ( 0-@P& 8 @,  r4 , #  @]h (@ǖt^# #İ # t# y 0 6Y 2 #d#@  8 8,@# @$`$ `$ ` $ `$ `$ `$ `$ `  $ `$` $ $*$ 4*`  "$ ,@$ , @  ,  @m  t#Ht#p' 0h @t`( 2 8* @   , 8,@@"`( L 8,      "7 $8 $`ut ,    8** @2`,@& T& X @7 @:`@   8* @ (  ?`#\@  ` F& 8㿘@ @i  Du`($$ $ #& D 2   n$  ,$ @ 㿘@H  H"" " " & H 㿘  ?#%u \ "`  2 2  2 $ $ v8  2 `b  㿐' ?#`\"!2  ` (  @ 2`"" "2ܚ` T *?# X,@ " T  2 T " T  @: `"" " 2 T* X N  0 8 @   " 0 ` 0 8@,`@-& 8  8 8,# @A6 0 $  $ u P$ ($ 4 8,   ` 8? "`"   8, "  8 "  0   8,   2  0@f  @ $ ,$  0* 8 <  0㿘& 4 0    8,@` "`  6u D 8, 2j,* *` * @ * @*`, T ,  @2  *@ ` 2  2@  X*@`"`  8* @ ( $ `@z " u*  " u  Xu p ` uu@ `  `    ` & 8 D u~`( D  8* @ , " 2 H ` 8* ` O ,`" @`2`㿘 <  4 " 0  ,"@@ 0 2  㿘@}(㿘@x 8㿘@s `,  ` -ߐ#̇*, Dl(((((((( ((((((,H((((((((d(`8 @ `?@8 @? @#@`8 @ `#@?@8 @? @#@"@#@`2 @0x3`#@`2 @?+`n0 @?i3` @8 @?_ @@8 @?U @@ cQ@#@ cL#@@?F3` 3`*@3`*`3`*`B*`c8 @ c7g8 @ g0#@`2 @? +`+`0$"@#@`2 @?+` 0 `8 @ ``8 @ ``?8 @ `?"@    㿘 ݖ      @ "?㿘 ޒ     @s "?㿘 ߒ     @^ "?㿘       @H "?㿘   @2 "?㿘   @ "?㿘@ uG @ 㿘@L u9 @ xu @!  %@gؐ @z @ @ @n  @?@@ 1  @㿘u @  0@3Hu @ڔ  "`ua8@  @z@H@3@u  @@@#@ߔ@۔@ה@T`  @͔H`@ƔH /而` @H4```H@4 @` @@(  @H@  @H` @HH@ `cՔ8:u`@o   @f  & $+ u  *`* @@  ?2  `+ u  *`* @@  ?2  `+ u  *`* @@  ?2  `+ u  *`* @@  ?2  `+ u  *`* @@  ?2  `+  u  ?2  `+ 4+@ ɔ ""b" @ 㿘@ @  "!"@ $"  bbH";j" &."  v" " " " ?* (2 2 "@ * (2 2 "` * (2 2 "` *  (2  2 "`  㿘  &   &  7 8 x" ua@@[ ? ** * 3   3    +`2@ +` @* 3`  3` @ X?# % $@S@o   @   @VX `?#@@XX XK@㿘 ! " @@& @@` ?@ϔ&&@`@@ `?`@& ' &@' " @?''''15ک x@((00' @`) 1 1:1#V@@((00' `(` 0`@1  @((00'@`-510os"@((@0@0@'Ą@  `-5 1=_#@((@0@0@'Ȅ @`) 1 1"*@@((00'̄  `(` 0`@1* "@((00'Є@ `-51?Q!@((00'Ԅ@ `-5 1`& @((@0@0@'؄ @ `) 1 1"=#@@((00'܄  `(` 0`@1?ְ#@((@0@0@'@`-51"W5#@(('00`'''@ -5 1!"@((00' @`) 1 1?f!@@((00' `(` 0`@1)P#@((@0@0@'@`-51m !@((00'@ `-5 =b@) 1 0,@@  (` 0`@ Q@ -5:m㪆 @-5 5Ć]@ ) 1 S@ (` 0`@6(y⁆@ -59Ȇ @-5 xs@ ) 1 0ֆ@ (` 0`@=5Cᇆ@  -5V @ -5 *x@) 1 ?;@ (` 0`@ن@ -5#J @-5 ?B ) 1 !}⁆@ (` 0`@gX"@-5?yN -5 )/D) 1 㩆@(` 0`@=҆`@-5/p-5  &߆Ɔ) 1 :I@(` 0`@5;̆@ -5" -5 6u49 ) 1 9@(` 0`@蟆@-51+e-5 = HD5) 1 ʿ㗆@1(` 0`@*㧆0@-5?$95@ -5 VֆÆ5) 1 #3@1 (` 0`@?}0@-5!aц5@-5 O5 ) 1 ?9@1(` 0`@(P0@ -5ᡆ5@-5 =߆₆5) 1 /N5@1(` 0`@ ⻆0@-5:ᴆ㑆5@ -5 @@*N'"" " " 㿘?@`@`` N?   6 @@ @6 @@@ 6 @@ @6 @@@ø?"@"`"`"` 㾈'  '@ '` !#`' :"# !# @ u!x#9x#P ?   $ @ * @"` < @w, * ,` $ ``쀌@  7ج!# @m u"x#9x"ج   ?@ @@ * @" `@F * ,` @" ``@  / !# @= u#v Tx#8x"ت @*  2`* ' ` @@"@  @m, * @$@  /ߪ` /vT 0* ">??* "?|!# @ x!x#   <@,?* >%@֐@.  ?,, !* ,`@@ "? $?@  ?ت`Ɛ "c F" @    @ @  @ `  @   v آ!  +#3 ;   * + `< / *`8  * ( `<@ + @ +@3`*`3` @ " @`"  @"  3` @" @" ` +`@"@@ @" @ ? # ?$  b```  & 㿘f#/  " "㿘 @ HN N@ @  N  N@@?.@   x"ؚ   .@N `?ŀ @?˔?Ғ  : "` * @``:   `! @`@  @@@@ @@@` @@@&@㿘    (    u."66`6 `6@(@@@ @/"77 `7  7 @ (@@@ @Ȃ`"@㿘  @# @@@@2`37`6?6?6 `?7``?7` ?3 ?3 `?2`.`@* `?2` ?/ 6*+ +`@, @,@@,`@@`?.7`a@@@@@,@@n@n@,@ ?(3 @@d@d `?(@2` a@@@`@&&  *J  *  2 ?% ; (.5( ? `(2`*   2@?% ; (.5(  ? % ;  5 .**㿈x#Y `?`?@  #@ * $"   " " &  u#x x"ؒ @*  J?  @ @ ` / u#x x"x+ @*  J?  @  /`  u#x!Tx"ؒ @* J?  @  ` / u#x!Tx"x+ @* J?  @ /`'''' Ĕ x#@    @ @ *  x#@     @ * 㿘P㿐x#   * @  2 *㿘c㿘>@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@@@ 㿘@//༮S @ & F` @  & & `@ & :`  @   € # C ` €  # # ` # :  @ & F` @  & & `@ & :`{ ?t #@? ?#@  2@   @  @2   W U " . 2 * 6. 6.    @ #C ` @  ## `@ #;`  : @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@82      2@ *@*@ *    * 22 2@   㿘Ơ##? ??㿘㿘/etcHostnameDetermining host name and domain...reverse name lookup failedreverse name lookup workedsocket: %sSIOCADDRT: %sconfiguring %s ip: %s nm: %s nw: %s bc: %sSIOCSIFADDR: %sSIOCSIFNETMASK: %sSIOCSIFFLAGS: %sloeth0tr0plip0plip1plip2fddi0%s is available -- using it for networkingEthernet ProbeOkThe Ethernet probe failed to find a card on your system. Press to manually configure one.ack! loadDriveDriver() worked but didn't load a DRIVE_NET!!Please enter the IP configuration for this machine. Each item should be entered as an IP address in dotted-decimal notation (for example, 1.2.3.4).IP address:Netmask:Default gateway (IP):Primary nameserver:BackConfigure TCP/IPMissing InformationRetryYou must enter both a valid IP address and a netmask.255.255.255.255configuring point to point deviceDHCPBOOTPStatic IP addressbootprotogatewayipnameservernetmaskȐbȠgȨiȰnmnetworkgot %d argsrc is %c arg is %sbootpdhcpkickstartbad ip number in network command: %sbad argument to kickstart network command %s: %sErrorkickstart network command is missing ip addressBoot ProtocolHow should the IP information be set? If your system administrator gave you an IP address, choose static IP.Sending DHCP request...Sending BOOTP request....255.0.0.0255.255.0.0255.255.255.0%s/networkwcannot create network config file: %sNETWORKING=yes FORWARD_IPV4=false HOSTNAME=%s HOSTNAME=localhost.localdomain DOMAINNAME=%s GATEWAY=%s GATEWAYDEV=%s NS%d=%s %s/hosts%s already exists -- won't crunch it%s doesn not exist -- creatingcannot create /etc/hosts: %swriting host information to %s127.0.0.1 localhost localhost.localdomain %s %s %s %s %s %s/resolv.confneither domain name nor dns server are configuredCannot create %s: %s search %s nameserver %s %s/ifcfg-%scannot create network device config file: %swriting network information to %sDEVICE=%s BOOTPROTO=bootp BOOTPROTO=dhcp IPADDR=%s NETMASK=%s NETWORK=%s BROADCAST=%s ONBOOT=yes rcannot open file: %sIPADDR=DEVICE=BOOTPROTO=bootpBOOTPROTO=dhcpNETMASK=NETWORK=BROADCAST=Ack! HAS_BOOTPROTO isn't set!reverse name lookup worked; skipping hostname configHostname LookupI cannot automatically determine the hostname. Press to enter hostname information.Please enter your domain name, host name, and the IP addresses of any additional nameservers. Your host name should be a fully-qualified host name, such as mybox.mylab.myco.com. If you don't have any additional nameservers, leave the nameserver entries blank.Domain name:Host name:Secondary nameserver (IP):Tertiary nameserver (IP):Configure NetworkHOSTNAME=localhost.localdomainDOMAINNAME=GATEWAY=NS0=NS1=NS2=Keep the current IP configurationReconfigure network nowDon't set up networkingNetwork ConfigurationLAN networking has already been configured. Do you want to:YesNoDo you want to configure LAN (not dialup) networking for your installed system?* /dev/tty3w/tmp/install.logadebug.logDEBUGmount: excessively long host:dir argument mount: directory to mount not in host:dir format mount: can't get address for %s mount: excessively long option argument %s%saddr=%s,rsizewsizetimeoretransacregminacregmaxacdirminacdirmaxactimeoretryportmountportmounthost ,mountprogmountversnfsprognfsversnamlenaddrunknown nfs mount parameter: %s=%d nobgfgsofthardintrposixctoactcpudplockunknown nfs mount option: %s%s mount clntudp_createrpc mountmount: %s:%s failed, reason given by server: %s nfs socketnfs bindresvportunknown nfs status return value: %d: %sErrorOksjcdscd1scd0sbpcdoptcdnst0mcdxmcdlp2lp1lp0gscdfd1fd0cm206cdcdu535cdu31abpcdaztcdIRQ level:irq=0x300:0x280:0x320:0x340:0x360Base IO port:io=0x0bcdu31a_irq=cdu31a_port=IO base, IRQ:cm206=mcd=optcd=10Interrupt level (IRQ):interrupt_level=0xd800port_base=1Use other optionssetup_called=IO base, IRQ, label:sbpcd=vfattcicsmbfsromfspcmcia_corenfsio=0x300nelploopisofsi82365fdomaindsio=0de4x5cm2068390Parallel PrinterLoopback deviceWindows SMBNetwork File System (nfs)iso9660fc4:soc:plutoSun SparcSTORAGE ArrayqlogicptiPerformance Technologies ISPncr53c8xxNCR 53C8xx PCIaic7xxxAdaptec 2740, 2840, 2940sunqeSun Quad EthernetsunhmeSun Happy Meal Ethernetmyri_sbusMyriCOM Gigabit EthernetDigital 425,434,435,450,5003c59x3com 3c59x (Vortex)Specify optionsAutoprobeErrorOkIllegal device name %srammknod() failed: %sremoving device file %sLoad moduleWhich driver should I try?Backpicked driver %sopenprommissingokoptsSCSIethernetcdromin loadDeviceDriver, ks = %d, typName = %spci probing for %s devicespci probe found %d %s devicessbus probing for %s devicessbus probe found %d %s devicesmultiple %s devices foundtulipmodule %s not in install tablefound driver for %sProbeA %s card has been found on your system.device commandbad argument to kickstart device command %s: %sbad arguments to kickstart device commandNo module exists for %sI can't find the device anywhere on your system!device check function failed to find device/bin/rmmod/modules/.o/bin/insmodScanning %s SCSI bus...insmod failed!In some cases, the %s driver needs to have extra information to work properly, although it normally works fine without. Would you like to specify extra options for it or allow the driver to probe your machine for the information it needs? Occasionally, probing will hang a computer, but it should not cause any damage.In many cases, the %s driver needs to be provided with extra information on your hardware. If you prefer, some common values for those parameters will be tried. This process can hang a machine, although it should not cause any damage.Module OptionsMiscellaneous options:Module options:Module Parameters/conf.modulesrfailed to open %s for module informationalias ethscsi_hostadapteroptions awbacking up old conf.modules.origcannot open module config file: %salias tr%d %s alias eth%d %s alias scsi_hostadapter %s alias scsi_hostadapter%d %s options %s %s eth0tr0plip0plip0 will be used for PLIPplip1plip1 will be used for PLIPplip2plip2 will be used for PLIP/proc/filesystemsCannot open /proc/filesystems: %d %s /proc/scsiI have found the following types of SCSI adapters on your system: scsi Do you have any more SCSI adapters on your system?Do you have any SCSI adapters?SCSI ConfigurationNoYesBack/proc/scsi/scsifailed to open /proc/scsi/scsi: %sfailed to read /proc/scsi/scsi: %s/proc/scsi/scsi: %sdevices: noneno scsi devices are availablescsi devices are availableAttached devices: unexpected line in /proc/scsi/scsi: %sHost: Id: Id: missing in /proc/scsi/scsi Vendor: Model:Model missing in /proc/scsi/scsiRev:Rev missing in /proc/scsi/scsi Type:Direct-Accesssd%csd%c%cSequential-Accessst%cCD-ROMscd%c/var/log/dmesg/tmp/syslogErrorOkFailed to stat %s: %s Failed to open %s: %s hdaCDROMTAPEFLOPPYCHSDevice Size (k)/dev/%-5s %9dBad Mount PointOkMount points must begin with a leading /.Mount points may not end with a /.Mount points may only printable characters./var/tmp/bin/sbin/etc/boot/dev/root/libSystem partitions must be on Linux Native partitions./usr/usr must be on a Linux Native partition or an NFS volume.Edit Network Mount PointNFS Server :NFS Path :Mount point :Cancel%s:%smke2fs/tmp/-cMaking ext2 filesystem on /dev/%s...Running/usr/bin/mke2fsWhat partitions would you like to format? We strongly suggest formatting all of the system partitions, including /, /usr, and /var. There is no need to format /home or /usr/local if they have already been configured during a previous install./dev/%-5s %-33sCheck for bad blocks during formatBackPartitions To Formatnfsmounting %s on %s as type %sTest mountI would mount /dev/%s on %susing a(n) %s filesystem.smbguestbad smb mount point %ssmbfs only works on Intel machinescalling nfsmount(%s, %s, &morejunk, &junk, &mount_opt) nfsmount returned non-zerocalling mount(%s, %s, %s, %ld, %p)mount failed: %s Errormount failed: %s//mntext2unmounting all filesystems due to mount errorcreating directory %sunmounting all filesystemserror unmounting %s: %s error unmounting filesystem: %screating directory %s rc = %d error: %s/dev/%-18s %-23s %-7s %-15s %d %d %-23s %-23s %-7s %-15s %d %d scanning /proc/mounts for iso9660 filesystems/proc/mounts error opening /proc/mounts -- skipping check: %s error reading /proc/mounts -- skipping check: %siso9660found mounted cdrom drive %sroottouching /etc/mtab/mnt/etc/mtabw+error touching /mnt/etc/mtabcreating /etc/fstab/mnt/etc/fstabwerror creating /mnt/etc/fstabdefaultsroswapvfathpfsfd0/mnt/floppynoauto/mnt/mnt/cdromfailed to mkdir /mnt/mnt/cdrom: %s/mnt/dev/cdromfailed to symlink /mnt/dev/cdrom: %scdrom/mnt/cdromnoauto,ronone/procproc%s/%sif I weren't testing I would run: running: RunningSucceedFailcannot run %s: %sErrorOkI cannot run %s: %s root is %s/dev/null/dev/tty5/tmp/exec.log/exec of %s failed: %scScSIOCSIFADDRSIOCSIFNETMASKSIOCSIFBRDADDRSIOCSIFFLAGSSIOCSADDRTsetsockoptdhcp overload option is currently ignored!%s: %sSIOCSIFHWADDRsendtorecvfromselectNo BOOTP reply receivedNo DHCP reply receivedDHCP FAILED TO RENEW LEASE -- KILLING INSTALLsocketbindDHCPOFFER didn't include server addressfailed to get lease time %s.%s.%s.%s.in-addr.arpanetworklangdevicecdromtimezonemousekeyboardxconfigzerombrclearpartpartsilorootpwupgradeinstallnfsKickstart ErrorOkError opening: kickstart file %s: %sError reading contents of kickstart file %s: %s%post%packagesError on line %d of kickstart file %s.Unknown command %s on line %d of kickstart file %s.running kickstart post-install script/mnt/tmp/ks.scriptErrorFailed to create /mnt/tmp/ks.script: %s#!/bin/sh Failed to write ks post script: %s/mnt/tmp/ks.scriptexec failed: %s ( xh`XH@80( tr_TRlat5-16trTurkishsv_SEseSwedishsk_SKskSlovaksr_YUsrSerbianro_ROroRomanianno_NOnoNorwegianit_ITitItaliande_DEdeGermanfr_FRfrFrenchfi_FIfiFinnishda_DKlat1-16daDanishcs_CZlat2-16csCzechen_USenEnglish no argument passed to keyboard kickstart commandunknown language %sLANGLC_ALLLINGUASChoose a LanguageWhat language should be used during the installation process?Okinstall%d.tr/etc/install%d.trrErrorCannot open %s: %s. Installation will proceed in English.%s%d.tr/tmp/translationCannot get translation file %s. Failed to open /tmp/translation: %s /etc/fonts.cgzCannot open fonts: %s/tmp/fontPIO_FONT failed: %sPIO_UNIMAPCLR failed: %sPIO_UNIMAP failed: %sPIO_UNISCRNMAP failed: %s(K%s/etc/sysconfig/i18nwLANG=%s LINGUAS=%s LC_ALL=%s SYSFONT=%s cdu535sonycd535cm206cdcm206using device %sscd0CDROMInitializing CDROM...ErrorOkCannot find archive member %s. sparc64usage: insmod .o [params] /modules/modules64.cgz/modules/modules.cgzr/tmp/%s/bin/insmod64/dev/tty5127.0.0.1 localhost localhost.localdomain .devetctmpvarvar/tmpvar/libvar/lib/rpmremoving /mnt/usr/X11R6 symlink/mnt/usr/X11R6%s/etc/hostsFailed to create etc/hosts: %s.%s/tmp/%s.logupgradeinstallwopened %sfailed to open %s :-(ErrorOkFailed to open %s. No upgrade log will be kept.failed to open /dev/tty5!/tmp/exec.logfailed to open %s: %s! Fatal error opening RPM databaseopened rpm databasebasesystemError ordering package list: %sStatusPackages would be installed nowinstalling %d packagesrpm database closed%s %s. UpgradingInstallinggetFile method failed for %sFailed to get file for package %s. cannot open RPM file %s: %sError installing package: cannot open RPM file for %s: %s cannot open RPM file %s: %s lilokernelError installing package: package install of %s failed: %sRPM install of %s failed: %s%s/usr/X11R6/bin/Xconfigurator%s cannot be run%s/proc/procproc--pick%s/tmp/SERVERfailed to open %s: %scouldn't find ' ' in %sXFree86-I will install the %s package found package: %s--continue%s Install StatusPackage:Size :Summary: Packages Bytes TimeTotal :Completed :Remaining :%8d%4uM(no summary)%s-%s-%s%dk%4dMA%01d:%02d.%02dXFree86-Sun24XFree86-SunMonoXFree86-SunmetrotmplmetroessXFree86-I128XFree86-W32XFree86-VGA16XFree86-SVGAXFree86-S3VXFree86-S3XFree86-P9000XFree86-MonoXFree86-Mach8XFree86-Mach64XFree86-Mach32XFree86-AGXXFree86-8514scanning %s for packageserror opening directoryerror reading from directoryRunningScanning available packages...%s/%sfailed to open %s: %sfailed to rpmReadPackageHeader %s:(unknown group)error reading from directory (2): %srCannot open components file: %sCannot read components file: %s0 0.1 ErrorOkComps file is not version 0.1 as expectedbad comps file at line %d--hide comps Errormissing component name at line %dendBasepackage %s at line %d does not exist%dM will show you a size and description of a packageCancelSize of all selected packages:What packages should be installed?Select PackagesKickstart ErrorComponent %s does not exist. Package %s does not exist. /mnt/var/lib/rpm/packages.rpm/mnt%-20s %-20s%-20s %sno suggestion Some of the packages you have selected to install require packages you have not selected. If you just select Ok all of those required packages will be installed.PackageRequirementBackInstall packages to satisfy dependenciesUnresolved DependenciesEverythingSelect individual packagesChoose components to install:Components to Installerror reading header at %d psFromHeaderListDesc read %d headerserror opening header file: %sDoneEdit Size:Choose a group to examine:Select Group(none available)Package:Size :%s-%s-%s%dUpgrade PackagesYesNoThe packages you have installed, and any other packages which are needed to satisfy their dependencies, have been selected for installation. Would you like to customize the set of packages that will be upgraded?running %s/ tool canceled tool failedtimeconfig/usr/sbin/timeconfig/usr/sbin/ntsysvmouse--kickstart--expert--noprobe/usr/sbin/mouseconfigxconfig/usr/X11R6/bin/Xconfigurator%s/etc/sysconfig/pcmciawPCMCIA=yes PCIC=%s PCMCIA=no PCIC= PCIC_OPTS= CORE_OPTS=    Linux nativeLinux swapWhole disk/tmp/%s%s%dHard DrivesScanning hard drives.../sbin/fdisk/usr/bin/fdiskOkYou don't have any hard drives available! You probably forgot to configure a SCSI controller.To install Red Hat Linux, you must have at least one parition of 150 MB dedicated to Linux./dev/%ssd%d - SCSI ID  - Model Partition DisksDoneEditBackThis is the fdisk program for partitioning your drive. It is running on /dev/%s. running fdisk on %sReboot NeededThe kernel is unable to read your new partitioning information, probably because you modified extended partitions. While this is not critical, you must reboot your machine before proceeding. Insert the Red Hat boot disk now and press Return to reboot your system. If you have a ZIP or JAZ drive, make sure there is a disk in the drive as an empty SCSI drive can also cause this problem.ftpFTPhdhard drivenfsNFS imagecdromLocal CDROMhdlistrpmconvertinstall.tr/tmp/rhimage/RedHat/base//tmp/rhimage/RedHat/RPMS//What partition and directory on that partition hold the RedHat/RPMS and RedHat/base directories?OkCancelDirectory holding Red Hat:Select Partitionext2vfat/tmp/hdimage/tmp/rhimage/tmp/hdimage/%sErrorFailed to create /tmp/rhimage symlink: %s/tmp/rhimage/RedHat/base/hdlistDevice %s does not appear to contain a Red Hat installation tree./tmp/rhimage/RedHat/RPMS/tmp/rhimage/RedHat/base/compsdevice %s is already mounted -- using symlink/mnt/%sfailed to create symlink %s: %s Failed to create symlink for package source.mounting device which contains packagesmaking symlink from /tmp/rhimage to imagerhimage/tmp/imageftping %s to a fdRetrieving%s %s.../RedHat/ftping %s as %sopen of %s failed: %s I cannot get file %s: %s FTP SetupPlease choose a FTP server containing UltraPenguin 1.1 distribution:Ultra.Penguin.CZOther FTP serverultra.penguin.cz/OS/Linux/Sparc/ultrapenguin-1.1/sparcBackPlease enter the following information: o the name or IP number of your FTP server o the directory on that server containing Red Hat Linux for your architecure FTP site name:Red Hat directory:Use non-anonymous ftp or a proxy serverIf you are using non anonymous ftp, enter the account name and password you wish to use below. If you are using an FTP proxy enter the name of the FTP proxy server to use.Account name:Password:FTP Proxy:Further FTP Setuprhinstall@I cannot log into machine: %s base/hdlistbase/comps/tmp/comps/mnt/var/tmp/tmp//mnt/var/tmp/base/RPMS/YesNoI'm having trouble getting %s. Should I keep trying?Install bootloaderCreate bootdiskSet root passwordConfigure printerConfigure servicesConfigure timezoneConfigure networkingInstall systemChoose packages to installChoose partitions to formatFind installation filesSetup swap spaceSetup filesystemsSetup SCSISelect installation classSelect installation pathUpgrade systemChoose packages to upgradeFind current installationSwap-auto/home/var/usr//dev/tty2cannot open /dev/tty2 -- no shell will be provided/bin/shcannot open shell - /usr/bin/sh doesn't existcould not set new controlling tty-/bin/shexec of /bin/sh failed: %sDisk SetupDisk DruidfdiskBackDisk Druid is a tool for partitioning and setting up mount points. It is designed to be easier to use than Linux's traditional disk partitioning sofware, fdisk, as well as more powerful. However, there are some cases where fdisk may be preferred. Which tool would you like to use?install3.trgetFile method failed for %sLANGScanningScanning packages...Install logOkA complete log of your installation will be in /tmp/install.log after rebooting your system. You may want to keep this file for later reference.Upgrade logA complete log of your upgrade will be in /tmp/upgrade.log when the upgrade is finished. After rebooting, please read it to ensure configuration files are properly updated.RebuildingRebuilding RPM database.../mntErrorRebuild of RPM database failed. You may be out of disk space?:netSharedPath is: %s %s/etc/rpmrccreating /etc/rpmrc for netshared info (as none exists)werror creating path: %snetsharedpath: %s iscryptedrootpw commandbad argument to kickstart rootpw command %s: %sMissing passwordUnexpected argumentsPassword:Password (again):Pick a root password. You must type it twice to ensure you know what it is and didn't make a mistake in typing. Remember that the root password is a critical part of system security!Root PasswordPassword MismatchThe passwords you entered were different. Please try again.The root password must be at least 6 characters long./bin/sed 's&root:[^:]*:&root:%s:&' < /etc/passwd > /etc/passwd.new%s/etc/passwd%s/etc/passwd.new/mnt/etc/conf.modules/mnt/etckernelI couldn't find a kernel!installed kernel version %s%s/etc/sysconfig/network-scripts%s/etcInstallation PathInstallUpgradeWould you like to install a new system or upgrade a system which already contains Red Hat Linux 4.2 or later?WorkstationServerCustomInstallation ClassWhat type of machine are you installing? For maximum flexibility, choose "Custom"./mnt/var/lib/rpm/packages.rpm/mnt/var/lib/rpm/packagesNo RPM database exists!rpmconvert/mnt/varConverting RPM database...Finding packages to upgrade...PreviousRetryMenuAn error occured during step "%s" of the install. You may retry that step, return to the previous step in the install, or see a menu of installation steps which will allow you to move around in the install more freely. It is not recommended to use the menu unless you are already familiar with UltraPenguin Linux. What would you like to do? Continue with install* Installation StepsWhat step would you like to run? Steps with a * next to them have already been completed.CancelledI can't go to the previous step from here. You will have to try again. Type to return to the install program. error execing /bin/sh/usr/sbin/setconsole--speederror stat'ing stdin: %sstdin isn't a character device!!! ack!ttyattyb38400192009600/mnt/usr/sbin/setconsole/mnt/usr/sbin/setconsole does not exist -- skippingsetting up %s as serial console, speed is %s%s/usr/bin/lpr/mnt/sbin/mkbootdisk/mnt/sbin/mkinitrdBootdiskYesNoA custom bootdisk provides a way of booting into your Linux system without depending on the normal bootloader. This is useful if you don't want to install silo on your system, another operating system removes silo, or silo doesn't work with your hardware configuration. A custom bootdisk can also be used with the UltraPenguin rescue image, making is much easier to recover from severe system failures. Would you like to create a bootdisk for your system?Insert a blank floppy in the first floppy drive. umountmountmkdirmknodcatlslnrmchmodlsmodmkswapswaponuncpioinsmodrmmod/sbin/install--method--method requires argument unknown install method: %s --force--kickstart--ks--kickstart requires argument --expert--test--pcmcia--pcmcia requires argument --kernel--kernel requires argument --rootpath--rootpath requires argument unknown argument: %s --method argument is required you're running me on a live system! that's incredibly stupid. in second stage install second stage install running (version 1.2 built Nov 3 1998 14:30:24)extra log messages are enabledUltraPenguin 1.1 Linux (C) 1998 Red Hat Software and the UltraLinux team / between elements | selects | next screen /tmpfailed to open directory /tmp: %sifcfg-error reading directory entry: %sfound network config file %sreading /usr/lib/rpmrc donePATH=/usr/bin:/bin:/sbin:/usr/sbinLD_LIBRARY_PATH=CompleteDoneCongratulations, installation is complete. Remove the floppy from the drive and press return to reboot. For information on fixes which are available for this release of UltraPenguin, consult the Errata available from http://ultra.penguin.cz/ultrapenguin-1.1/. Information on configuring your system is available in the post install chapter of the Official Red Hat Linux User's Guide.550 anonymous@root@%s@%sUSERPASSTYPEIPASV %d,%dRETR %s Bad FTP server responseFTP IO errorFTP server timeoutUnable to lookup FTP server host addressUnable to lookup FTP server host nameFailed to connect to FTP serverFailed to establish data connection to FTP serverIO error to local fileError setting remote server to passive modeFile not found on serverFTP Unknown or unexpected error/etc/rc.d/metroessFailed with bad headermarked %d packages for upgradeugFindUpgradePackages() ...failed opening %s/var/lib/rpm/packages.rpmadded lost filesfound basic packages to upgraderemoved extra files which have movedfound packages with relocated filesfound packages that obsolete installed packagesunmarked packages already installedTotal Buckets : %d Empty Buckets : %d Total Entries : %d Total Data : %d Total Overhead: %d Avergage Depth: %f error writing output: %s error reading input: %s cannot open %s: %s Module: #pages: Used by:/proc/modules/proc/mountsnfsext2usage: mount -t (if /dev/ is left off the device name, a temporary node will be created) -t/dev/umount expects a single argument error unmounting %s: %s umount expects one or more arguments error creating directory %s: %s usage: mknod [b|c] or mknod bcunknown node type %s bad major number %s bad minor number %s mknod failed: %s -f-s-fs-sfln: unknown argument %s ln requires exactly two filenames errorrm expects one or more arguments (no flags are supportedunlink of %s failed: %s usage: chmod illegal mode %s error in chmod of %s to 0%o: %s mkswap swapon swapon:uncpio reads from stdinrllCCddggnnppaaLLffrrttSSRRargument error: %s %sa4a3ledgerlegalletterrStartEntry:EndEntryGSDriver:Description:About:Resolution:%sx%sBitsPerPixel:Printer InformationOk will give you information on a particular printer typeWhat type of printer do you have?PostScript printerBackConfigure PrinterHP will give you information on this printer driver.You may now configure the paper size and resolution for this printer.Paper SizeResolution%4sx%4s %sDefaultFix stair-stepping of text?%2s %sYou may now configure the color options for this printer.Configure Color Depth/dev/lpXWhat device is your printer connected to (note that /dev/lp0 is equivalent to LPT1:)?Auto-detected ports: /dev/lp: Not Detected Printer Device:/dev/lp1Local Printer DeviceRemote hostname:Remote queue:Remote lpd Printer OptionsTo use a remote lpd print queue, you need to supply the hostname of the printer server and the queue name on that server which jobs should be placed in.LAN manager host:LAN manager IP:Share name:User name:Password:LAN Manager Printer OptionsTo print to a LAN manager printer, you need to provide the LAN manager host name (this is not always the same as the machines TCP/IP hostname) and possibly the IP address of the print server, as well as the share name for the printer you wish to access and any applicable user name and password.lp/var/spool/lpd/lpName of queue:Spool directory:Standard Printer OptionsEvery print queue (which print jobs are directed to) needs a name (often lp) and a spool directory associated with it. What name and directory should be used for this queue?YesNoWould you like to configure a printer?LOCALREMOTESMBLocalRemote lpdLAN ManagerSelect Printer ConnectionHow is this printer connected?Printer type:Queue:Printer device:Remote host:Server:Share:User:Printer driver:Paper size:Bits per pixel:Please verify that this printer information is correct: %-*s %s %-*s %s %-*s %s %-*s %s Printer device %-*s %s %-*s %s %-*s %s <> %-*s %s %-*s %s