# PaCkAgE DaTaStReAm cyrus-imapd 1 207411 # end of header 070701000a2e55000081a40000000000000000000000015126e8a000000114000000b500010002ffffffffffffffff0000001400000000cyrus-imapd/pkginfoPKG=cyrus-imapd NAME=cyrus-imapd 2.4.17 i86pc Solaris 10 VERSION=2.4.17 PSTAMP=21st February 2013 VENDOR=Carnegie Mellon University EMAIL=http://cyrusimap.web.cmu.edu DESC=Cyrus IMAP Server ARCH=i386 CATEGORY=utility CLASSES=none BASEDIR=/ ISTATES=S s 1 2 3 RSTATES=S s 1 2 3 070701000a2e54000081a40000000000000000000000015126e8a100003846000000b500010002ffffffffffffffff0000001300000000cyrus-imapd/pkgmap: 1 207411 1 d none /usr ? ? ? 1 d none /usr/local ? ? ? 1 d none /usr/local/bin 0755 root root 1 f none /usr/local/bin/cyradm 0555 root root 12914 62885 1361504377 1 l none /usr/local/bin/imtest=/usr/local/bin/pop3test 1 f none /usr/local/bin/installsieve 0755 root root 4712 39145 1361504382 1 l none /usr/local/bin/lmtptest=/usr/local/bin/pop3test 1 l none /usr/local/bin/mupdatetest=/usr/local/bin/pop3test 1 l none /usr/local/bin/nntptest=/usr/local/bin/pop3test 1 f none /usr/local/bin/pop3test 0755 root root 220292 3531 1361504382 1 f none /usr/local/bin/sieveshell 0755 root root 8815 31938 1361504382 1 l none /usr/local/bin/sivtest=/usr/local/bin/pop3test 1 l none /usr/local/bin/smtptest=/usr/local/bin/pop3test 1 l none /usr/local/bin/synctest=/usr/local/bin/pop3test 1 d none /usr/local/include 0755 root root 1 d none /usr/local/include/cyrus 0755 root root 1 f none /usr/local/include/cyrus/acl.h 0644 root root 4526 33255 1361504381 1 f none /usr/local/include/cyrus/assert.h 0644 root root 2265 49118 1361504381 1 f none /usr/local/include/cyrus/auth.h 0644 root root 3124 59366 1361504381 1 f none /usr/local/include/cyrus/bsearch.h 0644 root root 2308 52222 1361504381 1 f none /usr/local/include/cyrus/byteorder64.h 0644 root root 2705 22456 1361504381 1 f none /usr/local/include/cyrus/charset.h 0644 root root 5672 844 1361504381 1 f none /usr/local/include/cyrus/crc32.h 0644 root root 357 29579 1361504381 1 f none /usr/local/include/cyrus/cyr_lock.h 0644 root root 2396 60364 1361504381 1 f none /usr/local/include/cyrus/cyrusdb.h 0644 root root 7501 19508 1361504381 1 f none /usr/local/include/cyrus/glob.h 0644 root root 3936 47691 1361504381 1 f none /usr/local/include/cyrus/gmtoff.h 0644 root root 2146 38153 1361504381 1 f none /usr/local/include/cyrus/hash.h 0644 root root 2958 52152 1361504381 1 f none /usr/local/include/cyrus/imapopts.h 0644 root root 9492 15362 1361504381 1 f none /usr/local/include/cyrus/imapurl.h 0644 root root 3213 60374 1361504381 1 f none /usr/local/include/cyrus/imclient.h 0644 root root 3985 63179 1361504381 1 f none /usr/local/include/cyrus/imparse.h 0644 root root 2258 50003 1361504381 1 f none /usr/local/include/cyrus/iptostring.h 0644 root root 2164 41495 1361504381 1 f none /usr/local/include/cyrus/libconfig.h 0644 root root 3600 43981 1361504381 1 f none /usr/local/include/cyrus/libcyr_cfg.h 0644 root root 4843 51672 1361504381 1 f none /usr/local/include/cyrus/lsort.h 0644 root root 785 63180 1361504381 1 f none /usr/local/include/cyrus/map.h 0644 root root 3095 55781 1361504381 1 f none /usr/local/include/cyrus/md5.h 0644 root root 1774 12227 1361504381 1 f none /usr/local/include/cyrus/mkgmtime.h 0644 root root 2175 41020 1361504381 1 f none /usr/local/include/cyrus/mpool.h 0644 root root 2663 18889 1361504381 1 f none /usr/local/include/cyrus/nonblock.h 0644 root root 2195 43136 1361504381 1 f none /usr/local/include/cyrus/parseaddr.h 0644 root root 2381 57087 1361504381 1 f none /usr/local/include/cyrus/prot.h 0644 root root 10012 63743 1361504381 1 f none /usr/local/include/cyrus/retry.h 0644 root root 2684 16003 1361504381 1 f none /usr/local/include/cyrus/rfc822date.h 0644 root root 2108 35359 1361504381 1 f none /usr/local/include/cyrus/signals.h 0644 root root 2169 42791 1361504381 1 f none /usr/local/include/cyrus/strarray.h 0644 root root 3942 2907 1361504381 1 f none /usr/local/include/cyrus/strhash.h 0644 root root 2200 44629 1361504381 1 f none /usr/local/include/cyrus/stristr.h 0644 root root 269 20984 1361504381 1 f none /usr/local/include/cyrus/sysexits.h 0644 root root 7353 4695 1361504381 1 f none /usr/local/include/cyrus/util.h 0644 root root 7886 7847 1361504381 1 f none /usr/local/include/cyrus/xmalloc.h 0644 root root 2539 8493 1361504381 1 f none /usr/local/include/cyrus/xstrlcat.h 0644 root root 2270 49296 1361504381 1 f none /usr/local/include/cyrus/xstrlcpy.h 0644 root root 2312 53241 1361504381 1 d none /usr/local/lib 0755 root root 1 f none /usr/local/lib/libcyrus.a 0644 root root 1776076 23491 1361504381 1 f none /usr/local/lib/libcyrus_min.a 0644 root root 218508 28364 1361504381 1 d none /usr/local/lib/perl5 0755 root root 1 d none /usr/local/lib/perl5/5.12.3 0755 root root 1 d none /usr/local/lib/perl5/5.12.3/i86pc-solaris 0755 root root 1 d none /usr/local/lib/perl5/site_perl 0755 root root 1 d none /usr/local/lib/perl5/site_perl/5.12.3 0755 root root 1 d none /usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris 0755 root root 1 d none /usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/Cyrus 0755 root root 1 d none /usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/Cyrus/IMAP 0755 root root 1 f none /usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/Cyrus/IMAP.pm 0444 root root 14402 34662 1354391874 1 f none /usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/Cyrus/IMAP/Admin.pm 0444 root root 31791 58046 1354391874 1 f none /usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/Cyrus/IMAP/IMSP.pm 0444 root root 7331 11835 1354391874 1 f none /usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/Cyrus/IMAP/Shell.pm 0444 root root 50569 48393 1354391874 1 d none /usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/Cyrus/SIEVE 0755 root root 1 f none /usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/Cyrus/SIEVE/managesieve.pm 0444 root root 3692 37959 1354391874 1 d none /usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/auto 0755 root root 1 d none /usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/auto/Cyrus 0755 root root 1 d none /usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/auto/Cyrus/IMAP 0755 root root 1 f none /usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/auto/Cyrus/IMAP/.packlist 0644 root root 670 57724 1361504382 1 f none /usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/auto/Cyrus/IMAP/IMAP.bs 0444 root root 0 0 1361504377 1 f none /usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/auto/Cyrus/IMAP/IMAP.so 0555 root root 177044 8842 1361504377 1 d none /usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/auto/Cyrus/SIEVE 0755 root root 1 d none /usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/auto/Cyrus/SIEVE/managesieve 0755 root root 1 f none /usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/auto/Cyrus/SIEVE/managesieve/.packlist 0644 root root 325 29108 1361504382 1 f none /usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/auto/Cyrus/SIEVE/managesieve/managesieve.bs 0444 root root 0 0 1361504379 1 f none /usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/auto/Cyrus/SIEVE/managesieve/managesieve.so 0555 root root 678464 8135 1361504379 1 d none /usr/local/sbin 0755 root root 1 f none /usr/local/sbin/arbitron 0755 root root 2596448 51950 1361504382 1 f none /usr/local/sbin/chk_cyrus 0755 root root 2583824 59003 1361504382 1 f none /usr/local/sbin/ctl_cyrusdb 0755 root root 2591700 57405 1361504382 1 f none /usr/local/sbin/ctl_deliver 0755 root root 2606756 24166 1361504382 1 f none /usr/local/sbin/ctl_mboxlist 0755 root root 2633152 52695 1361504382 1 f none /usr/local/sbin/cvt_cyrusdb 0755 root root 2583224 29118 1361504382 1 f none /usr/local/sbin/cyr_dbtool 0755 root root 2586944 27678 1361504382 1 f none /usr/local/sbin/cyr_df 0755 root root 2583396 18694 1361504382 1 f none /usr/local/sbin/cyr_expire 0755 root root 2627416 3028 1361504382 1 f none /usr/local/sbin/cyr_sequence 0755 root root 2585368 58665 1361504382 1 f none /usr/local/sbin/cyr_synclog 0755 root root 2582908 22843 1361504382 1 f none /usr/local/sbin/cyr_userseen 0755 root root 2584700 19039 1361504382 1 f none /usr/local/sbin/cyrdump 0755 root root 2911192 15786 1361504382 1 f none /usr/local/sbin/deliver 0755 root root 2909180 56988 1361504382 1 f none /usr/local/sbin/fud 0755 root root 2621396 43159 1361504381 1 f none /usr/local/sbin/idled 0755 root root 2591660 36897 1361504382 1 l none /usr/local/sbin/imapd=/usr/local/sbin/proxyd 1 f none /usr/local/sbin/ipurge 0755 root root 2591476 36172 1361504382 1 l none /usr/local/sbin/lmtpd=/usr/local/sbin/lmtpproxyd 1 f none /usr/local/sbin/lmtpproxyd 0755 root root 3465876 23491 1361504381 1 f none /usr/local/sbin/master 0755 root root 255732 6254 1361504381 1 f none /usr/local/sbin/mbexamine 0755 root root 2593380 8027 1361504382 1 f none /usr/local/sbin/mbpath 0755 root root 2583872 60059 1361504381 1 f none /usr/local/sbin/mupdate 0755 root root 2855256 50996 1361504382 1 f none /usr/local/sbin/notifyd 0755 root root 2656444 30010 1361504382 1 l none /usr/local/sbin/pop3d=/usr/local/sbin/pop3proxyd 1 f none /usr/local/sbin/pop3proxyd 0755 root root 2864604 2095 1361504381 1 f none /usr/local/sbin/proxyd 0755 root root 3537116 38650 1361504381 1 f none /usr/local/sbin/ptdump 0755 root root 2582652 44967 1361504382 1 f none /usr/local/sbin/ptexpire 0755 root root 2583860 35146 1361504382 1 f none /usr/local/sbin/ptloader 0755 root root 2660100 62272 1361504382 1 f none /usr/local/sbin/quota 0755 root root 2605956 62963 1361504381 1 f none /usr/local/sbin/reconstruct 0755 root root 2595536 25673 1361504381 1 f none /usr/local/sbin/sievec 0755 root root 1541348 46239 1361504381 1 f none /usr/local/sbin/sieved 0755 root root 1501108 25417 1361504381 1 f none /usr/local/sbin/smmapd 0755 root root 2699840 24486 1361504381 1 f none /usr/local/sbin/squatter 0755 root root 2942344 34472 1361504382 1 f none /usr/local/sbin/timsieved 0755 root root 3303212 31005 1361504382 1 f none /usr/local/sbin/tls_prune 0755 root root 2581200 36324 1361504382 1 f none /usr/local/sbin/unexpunge 0755 root root 2592836 39753 1361504382 1 d none /usr/local/share 0755 root root 1 d none /usr/local/share/man 0755 root root 1 d none /usr/local/share/man/man1 0755 root root 1 f none /usr/local/share/man/man1/cyradm.1 0444 root root 23304 14302 1361504382 1 f none /usr/local/share/man/man1/imtest.1 0644 root root 5529 63182 1361504381 1 f none /usr/local/share/man/man1/installsieve.1 0644 root root 3441 24552 1361504381 1 f none /usr/local/share/man/man1/lmtptest.1 0644 root root 4961 19479 1361504381 1 f none /usr/local/share/man/man1/mupdatetest.1 0644 root root 4894 13360 1361504381 1 f none /usr/local/share/man/man1/nntptest.1 0644 root root 5098 30134 1361504381 1 f none /usr/local/share/man/man1/pop3test.1 0644 root root 5118 31408 1361504381 1 f none /usr/local/share/man/man1/sieveshell.1 0644 root root 5676 40340 1361504381 1 f none /usr/local/share/man/man1/sivtest.1 0644 root root 4988 21624 1361504381 1 f none /usr/local/share/man/man1/smtptest.1 0644 root root 5014 23400 1361504381 1 d none /usr/local/share/man/man3 0755 root root 1 f none /usr/local/share/man/man3/Cyrus::IMAP.3 0444 root root 8571 23468 1361504377 1 f none /usr/local/share/man/man3/Cyrus::IMAP::Admin.3 0444 root root 12393 58745 1361504377 1 f none /usr/local/share/man/man3/Cyrus::IMAP::IMSP.3 0444 root root 7531 858 1361504377 1 f none /usr/local/share/man/man3/Cyrus::IMAP::Shell.3 0444 root root 22992 53817 1361504377 1 f none /usr/local/share/man/man3/Cyrus::SIEVE::managesieve.3 0444 root root 4292 50723 1361504379 1 f none /usr/local/share/man/man3/imclient.3 0644 root root 11208 27280 1361504381 1 d none /usr/local/share/man/man5 0755 root root 1 f none /usr/local/share/man/man5/cyrus.conf.5 0644 root root 7350 37647 1361504381 1 f none /usr/local/share/man/man5/imapd.conf.5 0644 root root 57461 48130 1361504381 1 f none /usr/local/share/man/man5/krb.equiv.5 0644 root root 2630 15979 1361504381 1 d none /usr/local/share/man/man8 0755 root root 1 f none /usr/local/share/man/man8/arbitron.8 0644 root root 4323 33340 1361504381 1 f none /usr/local/share/man/man8/chk_cyrus.8 0644 root root 3004 48526 1361504381 1 f none /usr/local/share/man/man8/ctl_cyrusdb.8 0644 root root 3361 15510 1361504381 1 f none /usr/local/share/man/man8/ctl_deliver.8 0644 root root 2793 30471 1361504381 1 f none /usr/local/share/man/man8/ctl_mboxlist.8 0644 root root 4777 5333 1361504381 1 f none /usr/local/share/man/man8/cvt_cyrusdb.8 0644 root root 2831 34930 1361504381 1 f none /usr/local/share/man/man8/cyr_dbtool.8 0644 root root 3157 60019 1361504381 1 f none /usr/local/share/man/man8/cyr_df.8 0644 root root 2505 5167 1361504381 1 f none /usr/local/share/man/man8/cyr_expire.8 0644 root root 4831 18703 1361504381 1 f none /usr/local/share/man/man8/cyr_synclog.8 0644 root root 2964 41332 1361504381 1 f none /usr/local/share/man/man8/deliver.8 0644 root root 4240 17955 1361504381 1 f none /usr/local/share/man/man8/fetchnews.8 0644 root root 3612 32377 1361504381 1 f none /usr/local/share/man/man8/fud.8 0644 root root 3822 54769 1361504381 1 f none /usr/local/share/man/man8/idled.8 0644 root root 2694 21073 1361504381 1 f none /usr/local/share/man/man8/imapd.8 0644 root root 4632 60105 1361504381 1 f none /usr/local/share/man/man8/ipurge.8 0644 root root 3946 56861 1361504381 1 f none /usr/local/share/man/man8/lmtpd.8 0644 root root 3253 2460 1361504381 1 f none /usr/local/share/man/man8/master.8 0644 root root 5036 30159 1361504381 1 f none /usr/local/share/man/man8/mbexamine.8 0644 root root 3100 55442 1361504381 1 f none /usr/local/share/man/man8/mbpath.8 0644 root root 2821 30255 1361504381 1 f none /usr/local/share/man/man8/nntpd.8 0644 root root 4532 50016 1361504381 1 f none /usr/local/share/man/man8/notifyd.8 0644 root root 4017 5769 1361504381 1 f none /usr/local/share/man/man8/pop3d.8 0644 root root 3772 45868 1361504381 1 f none /usr/local/share/man/man8/quota.8 0644 root root 3222 3231 1361504381 1 f none /usr/local/share/man/man8/reconstruct.8 0644 root root 6103 58951 1361504381 1 f none /usr/local/share/man/man8/rmnews.8 0644 root root 3176 1504 1361504381 1 f none /usr/local/share/man/man8/smmapd.8 0644 root root 3189 63141 1361504381 1 f none /usr/local/share/man/man8/squatter.8 0644 root root 4251 26770 1361504381 1 f none /usr/local/share/man/man8/sync_client.8 0644 root root 5435 63294 1361504381 1 f none /usr/local/share/man/man8/sync_reset.8 0644 root root 2695 20358 1361504381 1 f none /usr/local/share/man/man8/sync_server.8 0644 root root 2834 34189 1361504381 1 f none /usr/local/share/man/man8/syncnews.8 0644 root root 3064 55650 1361504381 1 f none /usr/local/share/man/man8/timsieved.8 0644 root root 2804 31770 1361504381 1 f none /usr/local/share/man/man8/tls_prune.8 0644 root root 2595 13236 1361504381 1 f none /usr/local/share/man/man8/unexpunge.8 0644 root root 3416 14828 1361504381 1 i checkinstall 790 2504 1361504416 1 i pkginfo 276 21517 1361504416 07070100000000000000000000000000000000000000010000000000000000000000000000000000000000000000000000000b00000000TRAILER!!!070701000a2e55000081a40000000000000000000000015126e8a000000114000000b500010002ffffffffffffffff0000000800000000pkginfoPKG=cyrus-imapd NAME=cyrus-imapd 2.4.17 i86pc Solaris 10 VERSION=2.4.17 PSTAMP=21st February 2013 VENDOR=Carnegie Mellon University EMAIL=http://cyrusimap.web.cmu.edu DESC=Cyrus IMAP Server ARCH=i386 CATEGORY=utility CLASSES=none BASEDIR=/ ISTATES=S s 1 2 3 RSTATES=S s 1 2 3 070701000a2e54000081a40000000000000000000000015126e8a100003846000000b500010002ffffffffffffffff0000000700000000pkgmap: 1 207411 1 d none /usr ? ? ? 1 d none /usr/local ? ? ? 1 d none /usr/local/bin 0755 root root 1 f none /usr/local/bin/cyradm 0555 root root 12914 62885 1361504377 1 l none /usr/local/bin/imtest=/usr/local/bin/pop3test 1 f none /usr/local/bin/installsieve 0755 root root 4712 39145 1361504382 1 l none /usr/local/bin/lmtptest=/usr/local/bin/pop3test 1 l none /usr/local/bin/mupdatetest=/usr/local/bin/pop3test 1 l none /usr/local/bin/nntptest=/usr/local/bin/pop3test 1 f none /usr/local/bin/pop3test 0755 root root 220292 3531 1361504382 1 f none /usr/local/bin/sieveshell 0755 root root 8815 31938 1361504382 1 l none /usr/local/bin/sivtest=/usr/local/bin/pop3test 1 l none /usr/local/bin/smtptest=/usr/local/bin/pop3test 1 l none /usr/local/bin/synctest=/usr/local/bin/pop3test 1 d none /usr/local/include 0755 root root 1 d none /usr/local/include/cyrus 0755 root root 1 f none /usr/local/include/cyrus/acl.h 0644 root root 4526 33255 1361504381 1 f none /usr/local/include/cyrus/assert.h 0644 root root 2265 49118 1361504381 1 f none /usr/local/include/cyrus/auth.h 0644 root root 3124 59366 1361504381 1 f none /usr/local/include/cyrus/bsearch.h 0644 root root 2308 52222 1361504381 1 f none /usr/local/include/cyrus/byteorder64.h 0644 root root 2705 22456 1361504381 1 f none /usr/local/include/cyrus/charset.h 0644 root root 5672 844 1361504381 1 f none /usr/local/include/cyrus/crc32.h 0644 root root 357 29579 1361504381 1 f none /usr/local/include/cyrus/cyr_lock.h 0644 root root 2396 60364 1361504381 1 f none /usr/local/include/cyrus/cyrusdb.h 0644 root root 7501 19508 1361504381 1 f none /usr/local/include/cyrus/glob.h 0644 root root 3936 47691 1361504381 1 f none /usr/local/include/cyrus/gmtoff.h 0644 root root 2146 38153 1361504381 1 f none /usr/local/include/cyrus/hash.h 0644 root root 2958 52152 1361504381 1 f none /usr/local/include/cyrus/imapopts.h 0644 root root 9492 15362 1361504381 1 f none /usr/local/include/cyrus/imapurl.h 0644 root root 3213 60374 1361504381 1 f none /usr/local/include/cyrus/imclient.h 0644 root root 3985 63179 1361504381 1 f none /usr/local/include/cyrus/imparse.h 0644 root root 2258 50003 1361504381 1 f none /usr/local/include/cyrus/iptostring.h 0644 root root 2164 41495 1361504381 1 f none /usr/local/include/cyrus/libconfig.h 0644 root root 3600 43981 1361504381 1 f none /usr/local/include/cyrus/libcyr_cfg.h 0644 root root 4843 51672 1361504381 1 f none /usr/local/include/cyrus/lsort.h 0644 root root 785 63180 1361504381 1 f none /usr/local/include/cyrus/map.h 0644 root root 3095 55781 1361504381 1 f none /usr/local/include/cyrus/md5.h 0644 root root 1774 12227 1361504381 1 f none /usr/local/include/cyrus/mkgmtime.h 0644 root root 2175 41020 1361504381 1 f none /usr/local/include/cyrus/mpool.h 0644 root root 2663 18889 1361504381 1 f none /usr/local/include/cyrus/nonblock.h 0644 root root 2195 43136 1361504381 1 f none /usr/local/include/cyrus/parseaddr.h 0644 root root 2381 57087 1361504381 1 f none /usr/local/include/cyrus/prot.h 0644 root root 10012 63743 1361504381 1 f none /usr/local/include/cyrus/retry.h 0644 root root 2684 16003 1361504381 1 f none /usr/local/include/cyrus/rfc822date.h 0644 root root 2108 35359 1361504381 1 f none /usr/local/include/cyrus/signals.h 0644 root root 2169 42791 1361504381 1 f none /usr/local/include/cyrus/strarray.h 0644 root root 3942 2907 1361504381 1 f none /usr/local/include/cyrus/strhash.h 0644 root root 2200 44629 1361504381 1 f none /usr/local/include/cyrus/stristr.h 0644 root root 269 20984 1361504381 1 f none /usr/local/include/cyrus/sysexits.h 0644 root root 7353 4695 1361504381 1 f none /usr/local/include/cyrus/util.h 0644 root root 7886 7847 1361504381 1 f none /usr/local/include/cyrus/xmalloc.h 0644 root root 2539 8493 1361504381 1 f none /usr/local/include/cyrus/xstrlcat.h 0644 root root 2270 49296 1361504381 1 f none /usr/local/include/cyrus/xstrlcpy.h 0644 root root 2312 53241 1361504381 1 d none /usr/local/lib 0755 root root 1 f none /usr/local/lib/libcyrus.a 0644 root root 1776076 23491 1361504381 1 f none /usr/local/lib/libcyrus_min.a 0644 root root 218508 28364 1361504381 1 d none /usr/local/lib/perl5 0755 root root 1 d none /usr/local/lib/perl5/5.12.3 0755 root root 1 d none /usr/local/lib/perl5/5.12.3/i86pc-solaris 0755 root root 1 d none /usr/local/lib/perl5/site_perl 0755 root root 1 d none /usr/local/lib/perl5/site_perl/5.12.3 0755 root root 1 d none /usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris 0755 root root 1 d none /usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/Cyrus 0755 root root 1 d none /usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/Cyrus/IMAP 0755 root root 1 f none /usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/Cyrus/IMAP.pm 0444 root root 14402 34662 1354391874 1 f none /usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/Cyrus/IMAP/Admin.pm 0444 root root 31791 58046 1354391874 1 f none /usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/Cyrus/IMAP/IMSP.pm 0444 root root 7331 11835 1354391874 1 f none /usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/Cyrus/IMAP/Shell.pm 0444 root root 50569 48393 1354391874 1 d none /usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/Cyrus/SIEVE 0755 root root 1 f none /usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/Cyrus/SIEVE/managesieve.pm 0444 root root 3692 37959 1354391874 1 d none /usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/auto 0755 root root 1 d none /usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/auto/Cyrus 0755 root root 1 d none /usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/auto/Cyrus/IMAP 0755 root root 1 f none /usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/auto/Cyrus/IMAP/.packlist 0644 root root 670 57724 1361504382 1 f none /usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/auto/Cyrus/IMAP/IMAP.bs 0444 root root 0 0 1361504377 1 f none /usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/auto/Cyrus/IMAP/IMAP.so 0555 root root 177044 8842 1361504377 1 d none /usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/auto/Cyrus/SIEVE 0755 root root 1 d none /usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/auto/Cyrus/SIEVE/managesieve 0755 root root 1 f none /usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/auto/Cyrus/SIEVE/managesieve/.packlist 0644 root root 325 29108 1361504382 1 f none /usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/auto/Cyrus/SIEVE/managesieve/managesieve.bs 0444 root root 0 0 1361504379 1 f none /usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/auto/Cyrus/SIEVE/managesieve/managesieve.so 0555 root root 678464 8135 1361504379 1 d none /usr/local/sbin 0755 root root 1 f none /usr/local/sbin/arbitron 0755 root root 2596448 51950 1361504382 1 f none /usr/local/sbin/chk_cyrus 0755 root root 2583824 59003 1361504382 1 f none /usr/local/sbin/ctl_cyrusdb 0755 root root 2591700 57405 1361504382 1 f none /usr/local/sbin/ctl_deliver 0755 root root 2606756 24166 1361504382 1 f none /usr/local/sbin/ctl_mboxlist 0755 root root 2633152 52695 1361504382 1 f none /usr/local/sbin/cvt_cyrusdb 0755 root root 2583224 29118 1361504382 1 f none /usr/local/sbin/cyr_dbtool 0755 root root 2586944 27678 1361504382 1 f none /usr/local/sbin/cyr_df 0755 root root 2583396 18694 1361504382 1 f none /usr/local/sbin/cyr_expire 0755 root root 2627416 3028 1361504382 1 f none /usr/local/sbin/cyr_sequence 0755 root root 2585368 58665 1361504382 1 f none /usr/local/sbin/cyr_synclog 0755 root root 2582908 22843 1361504382 1 f none /usr/local/sbin/cyr_userseen 0755 root root 2584700 19039 1361504382 1 f none /usr/local/sbin/cyrdump 0755 root root 2911192 15786 1361504382 1 f none /usr/local/sbin/deliver 0755 root root 2909180 56988 1361504382 1 f none /usr/local/sbin/fud 0755 root root 2621396 43159 1361504381 1 f none /usr/local/sbin/idled 0755 root root 2591660 36897 1361504382 1 l none /usr/local/sbin/imapd=/usr/local/sbin/proxyd 1 f none /usr/local/sbin/ipurge 0755 root root 2591476 36172 1361504382 1 l none /usr/local/sbin/lmtpd=/usr/local/sbin/lmtpproxyd 1 f none /usr/local/sbin/lmtpproxyd 0755 root root 3465876 23491 1361504381 1 f none /usr/local/sbin/master 0755 root root 255732 6254 1361504381 1 f none /usr/local/sbin/mbexamine 0755 root root 2593380 8027 1361504382 1 f none /usr/local/sbin/mbpath 0755 root root 2583872 60059 1361504381 1 f none /usr/local/sbin/mupdate 0755 root root 2855256 50996 1361504382 1 f none /usr/local/sbin/notifyd 0755 root root 2656444 30010 1361504382 1 l none /usr/local/sbin/pop3d=/usr/local/sbin/pop3proxyd 1 f none /usr/local/sbin/pop3proxyd 0755 root root 2864604 2095 1361504381 1 f none /usr/local/sbin/proxyd 0755 root root 3537116 38650 1361504381 1 f none /usr/local/sbin/ptdump 0755 root root 2582652 44967 1361504382 1 f none /usr/local/sbin/ptexpire 0755 root root 2583860 35146 1361504382 1 f none /usr/local/sbin/ptloader 0755 root root 2660100 62272 1361504382 1 f none /usr/local/sbin/quota 0755 root root 2605956 62963 1361504381 1 f none /usr/local/sbin/reconstruct 0755 root root 2595536 25673 1361504381 1 f none /usr/local/sbin/sievec 0755 root root 1541348 46239 1361504381 1 f none /usr/local/sbin/sieved 0755 root root 1501108 25417 1361504381 1 f none /usr/local/sbin/smmapd 0755 root root 2699840 24486 1361504381 1 f none /usr/local/sbin/squatter 0755 root root 2942344 34472 1361504382 1 f none /usr/local/sbin/timsieved 0755 root root 3303212 31005 1361504382 1 f none /usr/local/sbin/tls_prune 0755 root root 2581200 36324 1361504382 1 f none /usr/local/sbin/unexpunge 0755 root root 2592836 39753 1361504382 1 d none /usr/local/share 0755 root root 1 d none /usr/local/share/man 0755 root root 1 d none /usr/local/share/man/man1 0755 root root 1 f none /usr/local/share/man/man1/cyradm.1 0444 root root 23304 14302 1361504382 1 f none /usr/local/share/man/man1/imtest.1 0644 root root 5529 63182 1361504381 1 f none /usr/local/share/man/man1/installsieve.1 0644 root root 3441 24552 1361504381 1 f none /usr/local/share/man/man1/lmtptest.1 0644 root root 4961 19479 1361504381 1 f none /usr/local/share/man/man1/mupdatetest.1 0644 root root 4894 13360 1361504381 1 f none /usr/local/share/man/man1/nntptest.1 0644 root root 5098 30134 1361504381 1 f none /usr/local/share/man/man1/pop3test.1 0644 root root 5118 31408 1361504381 1 f none /usr/local/share/man/man1/sieveshell.1 0644 root root 5676 40340 1361504381 1 f none /usr/local/share/man/man1/sivtest.1 0644 root root 4988 21624 1361504381 1 f none /usr/local/share/man/man1/smtptest.1 0644 root root 5014 23400 1361504381 1 d none /usr/local/share/man/man3 0755 root root 1 f none /usr/local/share/man/man3/Cyrus::IMAP.3 0444 root root 8571 23468 1361504377 1 f none /usr/local/share/man/man3/Cyrus::IMAP::Admin.3 0444 root root 12393 58745 1361504377 1 f none /usr/local/share/man/man3/Cyrus::IMAP::IMSP.3 0444 root root 7531 858 1361504377 1 f none /usr/local/share/man/man3/Cyrus::IMAP::Shell.3 0444 root root 22992 53817 1361504377 1 f none /usr/local/share/man/man3/Cyrus::SIEVE::managesieve.3 0444 root root 4292 50723 1361504379 1 f none /usr/local/share/man/man3/imclient.3 0644 root root 11208 27280 1361504381 1 d none /usr/local/share/man/man5 0755 root root 1 f none /usr/local/share/man/man5/cyrus.conf.5 0644 root root 7350 37647 1361504381 1 f none /usr/local/share/man/man5/imapd.conf.5 0644 root root 57461 48130 1361504381 1 f none /usr/local/share/man/man5/krb.equiv.5 0644 root root 2630 15979 1361504381 1 d none /usr/local/share/man/man8 0755 root root 1 f none /usr/local/share/man/man8/arbitron.8 0644 root root 4323 33340 1361504381 1 f none /usr/local/share/man/man8/chk_cyrus.8 0644 root root 3004 48526 1361504381 1 f none /usr/local/share/man/man8/ctl_cyrusdb.8 0644 root root 3361 15510 1361504381 1 f none /usr/local/share/man/man8/ctl_deliver.8 0644 root root 2793 30471 1361504381 1 f none /usr/local/share/man/man8/ctl_mboxlist.8 0644 root root 4777 5333 1361504381 1 f none /usr/local/share/man/man8/cvt_cyrusdb.8 0644 root root 2831 34930 1361504381 1 f none /usr/local/share/man/man8/cyr_dbtool.8 0644 root root 3157 60019 1361504381 1 f none /usr/local/share/man/man8/cyr_df.8 0644 root root 2505 5167 1361504381 1 f none /usr/local/share/man/man8/cyr_expire.8 0644 root root 4831 18703 1361504381 1 f none /usr/local/share/man/man8/cyr_synclog.8 0644 root root 2964 41332 1361504381 1 f none /usr/local/share/man/man8/deliver.8 0644 root root 4240 17955 1361504381 1 f none /usr/local/share/man/man8/fetchnews.8 0644 root root 3612 32377 1361504381 1 f none /usr/local/share/man/man8/fud.8 0644 root root 3822 54769 1361504381 1 f none /usr/local/share/man/man8/idled.8 0644 root root 2694 21073 1361504381 1 f none /usr/local/share/man/man8/imapd.8 0644 root root 4632 60105 1361504381 1 f none /usr/local/share/man/man8/ipurge.8 0644 root root 3946 56861 1361504381 1 f none /usr/local/share/man/man8/lmtpd.8 0644 root root 3253 2460 1361504381 1 f none /usr/local/share/man/man8/master.8 0644 root root 5036 30159 1361504381 1 f none /usr/local/share/man/man8/mbexamine.8 0644 root root 3100 55442 1361504381 1 f none /usr/local/share/man/man8/mbpath.8 0644 root root 2821 30255 1361504381 1 f none /usr/local/share/man/man8/nntpd.8 0644 root root 4532 50016 1361504381 1 f none /usr/local/share/man/man8/notifyd.8 0644 root root 4017 5769 1361504381 1 f none /usr/local/share/man/man8/pop3d.8 0644 root root 3772 45868 1361504381 1 f none /usr/local/share/man/man8/quota.8 0644 root root 3222 3231 1361504381 1 f none /usr/local/share/man/man8/reconstruct.8 0644 root root 6103 58951 1361504381 1 f none /usr/local/share/man/man8/rmnews.8 0644 root root 3176 1504 1361504381 1 f none /usr/local/share/man/man8/smmapd.8 0644 root root 3189 63141 1361504381 1 f none /usr/local/share/man/man8/squatter.8 0644 root root 4251 26770 1361504381 1 f none /usr/local/share/man/man8/sync_client.8 0644 root root 5435 63294 1361504381 1 f none /usr/local/share/man/man8/sync_reset.8 0644 root root 2695 20358 1361504381 1 f none /usr/local/share/man/man8/sync_server.8 0644 root root 2834 34189 1361504381 1 f none /usr/local/share/man/man8/syncnews.8 0644 root root 3064 55650 1361504381 1 f none /usr/local/share/man/man8/timsieved.8 0644 root root 2804 31770 1361504381 1 f none /usr/local/share/man/man8/tls_prune.8 0644 root root 2595 13236 1361504381 1 f none /usr/local/share/man/man8/unexpunge.8 0644 root root 3416 14828 1361504381 1 i checkinstall 790 2504 1361504416 1 i pkginfo 276 21517 1361504416 070701000a2f02000041ed0000000000000000000000025126e8a100000000000000b500010002ffffffffffffffff0000000800000000install070701000a2f03000081ed0000000000000000000000015126e8a000000316000000b500010002ffffffffffffffff0000001500000000install/checkinstall#!/bin/sh # expected_bits="64" expected_release="5.10" expected_platform="i386" # release=`uname -r` platform=`uname -p` bits=`isainfo -b` # if [ ${platform} != ${expected_platform} ]; then echo "\n\n\n\tThis package must be installed on a ${expected_platform} architecture\n" echo "\tAborting installation.\n\n\n" exit 1 fi if [ ${release} != ${expected_release} ]; then echo "\n\n\n\tThis package must be installed on a ${expected_release} machine\n" echo "\tAborting installation.\n\n\n" exit 1 fi #if [ ${bits} != ${expected_bits} ]; then # echo "\n\n\n\tThis package must be installed on a ${expected_bits} bit machine\n" # echo "\tYour machine is running a ${bits} bit O.S. currently\n" # echo "\tAborting installation.\n\n\n" # exit 1 #fi exit 0 070701000a2e56000041ed0000000000000000000000035126e8a100000000000000b500010002ffffffffffffffff0000000500000000root070701000a2e57000041ed0000000000000000000000035126e8a100000000000000b500010002ffffffffffffffff0000000900000000root/usr070701000a2e58000041ed0000000000000000000000075126e8a100000000000000b500010002ffffffffffffffff0000000f00000000root/usr/local070701000a2e5e000041ed0000000000000000000000035126e8a100000000000000b500010002ffffffffffffffff0000001700000000root/usr/local/include070701000a2e5f000041ed0000000000000000000000025126e8a100000000000000b500010002ffffffffffffffff0000001d00000000root/usr/local/include/cyrus070701000a2e83000081a40000000000000000000000015126e87d000009eb000000b500010002ffffffffffffffff0000002700000000root/usr/local/include/cyrus/xmalloc.h/* xmalloc.h -- Allocation package that calls fatal() when out of memory * * Copyright (c) 1994-2008 Carnegie Mellon University. All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in * the documentation and/or other materials provided with the * distribution. * * 3. The name "Carnegie Mellon University" must not be used to * endorse or promote products derived from this software without * prior written permission. For permission or any legal * details, please contact * Carnegie Mellon University * Center for Technology Transfer and Enterprise Creation * 4615 Forbes Avenue * Suite 302 * Pittsburgh, PA 15213 * (412) 268-7393, fax: (412) 268-7395 * innovation@andrew.cmu.edu * * 4. Redistributions of any form whatsoever must retain the following * acknowledgment: * "This product includes software developed by Computing Services * at Carnegie Mellon University (http://www.cmu.edu/computing/)." * * CARNEGIE MELLON UNIVERSITY DISCLAIMS ALL WARRANTIES WITH REGARD TO * THIS SOFTWARE, INCLUDING ALL IMPLIED WARRANTIES OF MERCHANTABILITY * AND FITNESS, IN NO EVENT SHALL CARNEGIE MELLON UNIVERSITY BE LIABLE * FOR ANY SPECIAL, INDIRECT OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES * WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN * AN ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING * OUT OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. * * $Id: xmalloc.h,v 1.29 2010/01/06 17:01:47 murch Exp $ */ #ifndef INCLUDED_XMALLOC_H #define INCLUDED_XMALLOC_H /* for size_t */ #include /* for free() */ #include extern void *xmalloc (unsigned size); extern void *xzmalloc (unsigned size); extern void *xrealloc (void *ptr, unsigned size); extern char *xstrdup (const char *str); extern char *xstrndup (const char *str, unsigned len); /* Functions using xmalloc.h must provide a function called fatal() conforming to the following: */ extern void fatal(const char *fatal_message, int fatal_code); /* __attribute__ ((noreturn));*/ #endif /* INCLUDED_XMALLOC_H */ 070701000a2e6a000081a40000000000000000000000015126e87d00000862000000b500010002ffffffffffffffff0000002600000000root/usr/local/include/cyrus/gmtoff.h/* gmtoff.h -- Get GMT offset * * Copyright (c) 1994-2008 Carnegie Mellon University. All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in * the documentation and/or other materials provided with the * distribution. * * 3. The name "Carnegie Mellon University" must not be used to * endorse or promote products derived from this software without * prior written permission. For permission or any legal * details, please contact * Carnegie Mellon University * Center for Technology Transfer and Enterprise Creation * 4615 Forbes Avenue * Suite 302 * Pittsburgh, PA 15213 * (412) 268-7393, fax: (412) 268-7395 * innovation@andrew.cmu.edu * * 4. Redistributions of any form whatsoever must retain the following * acknowledgment: * "This product includes software developed by Computing Services * at Carnegie Mellon University (http://www.cmu.edu/computing/)." * * CARNEGIE MELLON UNIVERSITY DISCLAIMS ALL WARRANTIES WITH REGARD TO * THIS SOFTWARE, INCLUDING ALL IMPLIED WARRANTIES OF MERCHANTABILITY * AND FITNESS, IN NO EVENT SHALL CARNEGIE MELLON UNIVERSITY BE LIABLE * FOR ANY SPECIAL, INDIRECT OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES * WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN * AN ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING * OUT OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. * * $Id: gmtoff.h,v 1.8 2010/01/06 17:01:45 murch Exp $ */ #ifndef INCLUDED_GMTOFF_H #define INCLUDED_GMTOFF_H #ifndef P #ifdef __STDC__ #define P(x) x #else #define P(x) () #endif #endif #include extern int gmtoff_of P((struct tm *tm, time_t time)); #endif /* INCLUDED_GMTOFF_H */ 070701000a2e73000081a40000000000000000000000015126e87d00000311000000b500010002ffffffffffffffff0000002500000000root/usr/local/include/cyrus/lsort.h/* lsort.h -- linked list (merge) sort */ /* $Id: lsort.h,v 1.2 2002/05/25 19:57:47 leg Exp $ */ #ifndef INCLUDED_LSORT_H #define INCLUDED_LSORT_H /* * returns: head of the sorted list * * list: head of the linked list * getnext: function that returns the next node of the given node * setnext: function that sets the next node of the first arg to the second arg * compar: function that compares two nodes (first two args). The third arg * is a pointer to user data that may be used in comparing the nodes * call_data: pointer to user data that is passed to compar() */ extern void *lsort(void *list, void *(*getnext)(void *), void (*setnext)(void *, void *), int (*compar)(void *, void *, void *), void *call_data); #endif /* INCLUDED_LSORT_H */ 070701000a2e76000081a40000000000000000000000015126e87d0000087f000000b500010002ffffffffffffffff0000002800000000root/usr/local/include/cyrus/mkgmtime.h/* mkgmtime.h -- make a time_t from a gmtime struct tm * * Copyright (c) 1994-2008 Carnegie Mellon University. All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in * the documentation and/or other materials provided with the * distribution. * * 3. The name "Carnegie Mellon University" must not be used to * endorse or promote products derived from this software without * prior written permission. For permission or any legal * details, please contact * Carnegie Mellon University * Center for Technology Transfer and Enterprise Creation * 4615 Forbes Avenue * Suite 302 * Pittsburgh, PA 15213 * (412) 268-7393, fax: (412) 268-7395 * innovation@andrew.cmu.edu * * 4. Redistributions of any form whatsoever must retain the following * acknowledgment: * "This product includes software developed by Computing Services * at Carnegie Mellon University (http://www.cmu.edu/computing/)." * * CARNEGIE MELLON UNIVERSITY DISCLAIMS ALL WARRANTIES WITH REGARD TO * THIS SOFTWARE, INCLUDING ALL IMPLIED WARRANTIES OF MERCHANTABILITY * AND FITNESS, IN NO EVENT SHALL CARNEGIE MELLON UNIVERSITY BE LIABLE * FOR ANY SPECIAL, INDIRECT OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES * WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN * AN ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING * OUT OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. * * $Id: mkgmtime.h,v 1.7 2010/01/06 17:01:46 murch Exp $ */ #ifndef INCLUDED_MKGMTIME_H #define INCLUDED_MKGMTIME_H #ifndef P #ifdef __STDC__ #define P(x) x #else #define P(x) () #endif #endif #include extern time_t mkgmtime P((struct tm * const tmp)); #endif /* INCLUDED_MKGMTIME_H */ 070701000a2e6e000081a40000000000000000000000015126e87d00000f91000000b500010002ffffffffffffffff0000002800000000root/usr/local/include/cyrus/imclient.h/* imclient.h -- Streaming IMxP client library * * Copyright (c) 1994-2008 Carnegie Mellon University. All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in * the documentation and/or other materials provided with the * distribution. * * 3. The name "Carnegie Mellon University" must not be used to * endorse or promote products derived from this software without * prior written permission. For permission or any legal * details, please contact * Carnegie Mellon University * Center for Technology Transfer and Enterprise Creation * 4615 Forbes Avenue * Suite 302 * Pittsburgh, PA 15213 * (412) 268-7393, fax: (412) 268-7395 * innovation@andrew.cmu.edu * * 4. Redistributions of any form whatsoever must retain the following * acknowledgment: * "This product includes software developed by Computing Services * at Carnegie Mellon University (http://www.cmu.edu/computing/)." * * CARNEGIE MELLON UNIVERSITY DISCLAIMS ALL WARRANTIES WITH REGARD TO * THIS SOFTWARE, INCLUDING ALL IMPLIED WARRANTIES OF MERCHANTABILITY * AND FITNESS, IN NO EVENT SHALL CARNEGIE MELLON UNIVERSITY BE LIABLE * FOR ANY SPECIAL, INDIRECT OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES * WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN * AN ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING * OUT OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. * * $Id: imclient.h,v 1.31 2010/01/06 17:01:45 murch Exp $ */ #ifndef INCLUDED_IMCLIENT_H #define INCLUDED_IMCLIENT_H #include struct imclient; struct sasl_client; /* to avoid having to include sasl sometimes */ struct imclient_reply { char *keyword; /* reply keyword */ long msgno; /* message number (-1 = no message number) */ char *text; /* subsequent text */ }; /* Flags for untagged-reply callbacks */ #define CALLBACK_NUMBERED 1 /* Has a message sequence number */ #define CALLBACK_NOLITERAL 2 /* Data cannot contain a literal */ /* Connection flags */ #define IMCLIENT_CONN_NONSYNCLITERAL 1 /* Server supports non-synchronizing literals */ #define IMCLIENT_CONN_INITIALRESPONSE 1 /* Server supports SASL initial response */ typedef void imclient_proc_t(struct imclient *imclient, void *rock, struct imclient_reply *reply); extern int imclient_connect(struct imclient **imclient, const char *host, const char *port, sasl_callback_t *cbs); extern void imclient_close(struct imclient *imclient); extern void imclient_setflags(struct imclient *imclient, int flags); extern void imclient_clearflags(struct imclient *imclient, int flags); extern char *imclient_servername(struct imclient *imclient); extern void imclient_addcallback(struct imclient *imclient, ...); extern void imclient_send(struct imclient *imclient, imclient_proc_t *proc, void *rock, const char *fmt, ...); extern void imclient_processoneevent(struct imclient *imclient); extern void imclient_getselectinfo(struct imclient *imclient, int *fd, int *wanttowrite); extern int imclient_authenticate(struct imclient *imclient, char *mechlist, char *service, char *user, int minssf, int maxssf); extern int imclient_havetls (void); extern int imclient_starttls(struct imclient *imclient, char *cert_file, char *key_file, char *CAfile, char *CApath); extern void imclient_write (struct imclient *imclient, const char *s, size_t len); #endif /* INCLUDED_IMCLIENT_H */ 070701000a2e6b000081a40000000000000000000000015126e87d00000b8e000000b500010002ffffffffffffffff0000002400000000root/usr/local/include/cyrus/hash.h/* +++Date last modified: 05-Jul-1997 */ /* $Id: hash.h,v 1.9 2003/10/22 18:50:12 rjs3 Exp $ */ #ifndef HASH__H #define HASH__H #include /* For size_t */ #include "strhash.h" #include "mpool.h" /* ** A hash table consists of an array of these buckets. Each bucket ** holds a copy of the key, a pointer to the data associated with the ** key, and a pointer to the next bucket that collided with this one, ** if there was one. */ typedef struct bucket { char *key; void *data; struct bucket *next; } bucket; /* ** This is what you actually declare an instance of to create a table. ** You then call 'construct_table' with the address of this structure, ** and a guess at the size of the table. Note that more nodes than this ** can be inserted in the table, but performance degrades as this ** happens. Performance should still be quite adequate until 2 or 3 ** times as many nodes have been inserted as the table was created with. */ typedef struct hash_table { size_t size; bucket **table; struct mpool *pool; } hash_table; /* ** This is used to construct the table. If it doesn't succeed, it sets ** the table's size to 0, and the pointer to the table to NULL. */ hash_table *construct_hash_table(hash_table *table, size_t size, int use_mpool); /* ** Inserts a pointer to 'data' in the table, with a copy of 'key' as its ** key. Note that this makes a copy of the key, but NOT of the ** associated data. */ void *hash_insert(const char *key,void *data,hash_table *table); /* ** Returns a pointer to the data associated with a key. If the key has ** not been inserted in the table, returns NULL. */ void *hash_lookup(const char *key,hash_table *table); /* ** Deletes an entry from the table. Returns a pointer to the data that ** was associated with the key so the calling code can dispose of it ** properly. */ /* Warning: use this function judiciously if you are using memory pools, * since it will leak memory until you get rid of the entire hash table */ void *hash_del(char *key,hash_table *table); /* ** Goes through a hash table and calls the function passed to it ** for each node that has been inserted. The function is passed ** a pointer to the key, a pointer to the data associated ** with it and 'rock'. */ void hash_enumerate(hash_table *table,void (*func)(char *,void *,void *), void *rock); /* ** Frees a hash table. For each node that was inserted in the table, ** it calls the function whose address it was passed, with a pointer ** to the data that was in the table. The function is expected to ** free the data. Typical usage would be: ** free_table(&table, free); ** if the data placed in the table was dynamically allocated, or: ** free_table(&table, NULL); ** if not. ( If the parameter passed is NULL, it knows not to call ** any function with the data. ) */ void free_hash_table(hash_table *table, void (*func)(void *)); #endif /* HASH__H */ 070701000a2e81000081a40000000000000000000000015126e87d00001cb9000000b500010002ffffffffffffffff0000002800000000root/usr/local/include/cyrus/sysexits.h/* * Copyright (c) 1994-2008 Carnegie Mellon University. All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in * the documentation and/or other materials provided with the * distribution. * * 3. The name "Carnegie Mellon University" must not be used to * endorse or promote products derived from this software without * prior written permission. For permission or any legal * details, please contact * Carnegie Mellon University * Center for Technology Transfer and Enterprise Creation * 4615 Forbes Avenue * Suite 302 * Pittsburgh, PA 15213 * (412) 268-7393, fax: (412) 268-7395 * innovation@andrew.cmu.edu * * 4. Redistributions of any form whatsoever must retain the following * acknowledgment: * "This product includes software developed by Computing Services * at Carnegie Mellon University (http://www.cmu.edu/computing/)." * * CARNEGIE MELLON UNIVERSITY DISCLAIMS ALL WARRANTIES WITH REGARD TO * THIS SOFTWARE, INCLUDING ALL IMPLIED WARRANTIES OF MERCHANTABILITY * AND FITNESS, IN NO EVENT SHALL CARNEGIE MELLON UNIVERSITY BE LIABLE * FOR ANY SPECIAL, INDIRECT OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES * WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN * AN ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING * OUT OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. * * $Id: sysexits.h,v 1.6 2010/01/06 17:01:47 murch Exp $ */ /* * Copyright (c) 1987, 1993 * The Regents of the University of California. All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in the * documentation and/or other materials provided with the distribution. * 3. All advertising materials mentioning features or use of this software * must display the following acknowledgement: * This product includes software developed by the University of * California, Berkeley and its contributors. * 4. Neither the name of the University nor the names of its contributors * may be used to endorse or promote products derived from this software * without specific prior written permission. * * THIS SOFTWARE IS PROVIDED BY THE REGENTS AND CONTRIBUTORS ``AS IS'' AND * ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE * IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE * ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE LIABLE * FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL * DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS * OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) * HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT * LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY * OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF * SUCH DAMAGE. * * @(#)sysexits.h 8.1 (Berkeley) 6/2/93 */ #ifndef _SYSEXITS_H_ #define _SYSEXITS_H_ /* * SYSEXITS.H -- Exit status codes for system programs. * * This include file attempts to categorize possible error * exit statuses for system programs, notably delivermail * and the Berkeley network. * * Error numbers begin at EX__BASE to reduce the possibility of * clashing with other exit statuses that random programs may * already return. The meaning of the codes is approximately * as follows: * * EX_USAGE -- The command was used incorrectly, e.g., with * the wrong number of arguments, a bad flag, a bad * syntax in a parameter, or whatever. * EX_DATAERR -- The input data was incorrect in some way. * This should only be used for user's data & not * system files. * EX_NOINPUT -- An input file (not a system file) did not * exist or was not readable. This could also include * errors like "No message" to a mailer (if it cared * to catch it). * EX_NOUSER -- The user specified did not exist. This might * be used for mail addresses or remote logins. * EX_NOHOST -- The host specified did not exist. This is used * in mail addresses or network requests. * EX_UNAVAILABLE -- A service is unavailable. This can occur * if a support program or file does not exist. This * can also be used as a catchall message when something * you wanted to do doesn't work, but you don't know * why. * EX_SOFTWARE -- An internal software error has been detected. * This should be limited to non-operating system related * errors as possible. * EX_OSERR -- An operating system error has been detected. * This is intended to be used for such things as "cannot * fork", "cannot create pipe", or the like. It includes * things like getuid returning a user that does not * exist in the passwd file. * EX_OSFILE -- Some system file (e.g., /etc/passwd, /etc/utmp, * etc.) does not exist, cannot be opened, or has some * sort of error (e.g., syntax error). * EX_CANTCREAT -- A (user specified) output file cannot be * created. * EX_IOERR -- An error occurred while doing I/O on some file. * EX_TEMPFAIL -- temporary failure, indicating something that * is not really an error. In sendmail, this means * that a mailer (e.g.) could not create a connection, * and the request should be reattempted later. * EX_PROTOCOL -- the remote system returned something that * was "not possible" during a protocol exchange. * EX_NOPERM -- You did not have sufficient permission to * perform the operation. This is not intended for * file system problems, which should use NOINPUT or * CANTCREAT, but rather for higher level permissions. */ #define EX_OK 0 /* successful termination */ #define EX__BASE 64 /* base value for error messages */ #define EX_USAGE 64 /* command line usage error */ #define EX_DATAERR 65 /* data format error */ #define EX_NOINPUT 66 /* cannot open input */ #define EX_NOUSER 67 /* addressee unknown */ #define EX_NOHOST 68 /* host name unknown */ #define EX_UNAVAILABLE 69 /* service unavailable */ #define EX_SOFTWARE 70 /* internal software error */ #define EX_OSERR 71 /* system error (e.g., can't fork) */ #define EX_OSFILE 72 /* critical OS file missing */ #define EX_CANTCREAT 73 /* can't create (user) output file */ #define EX_IOERR 74 /* input/output error */ #define EX_TEMPFAIL 75 /* temp failure; user is invited to retry */ #define EX_PROTOCOL 76 /* remote error in protocol */ #define EX_NOPERM 77 /* permission denied */ #define EX_CONFIG 78 /* configuration error */ #define EX__MAX 78 /* maximum listed value */ #endif /* !_SYSEXITS_H_ */ 070701000a2e82000081a40000000000000000000000015126e87d00001ece000000b500010002ffffffffffffffff0000002400000000root/usr/local/include/cyrus/util.h/* util.h -- general utility functions * * Copyright (c) 1994-2008 Carnegie Mellon University. All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in * the documentation and/or other materials provided with the * distribution. * * 3. The name "Carnegie Mellon University" must not be used to * endorse or promote products derived from this software without * prior written permission. For permission or any legal * details, please contact * Carnegie Mellon University * Center for Technology Transfer and Enterprise Creation * 4615 Forbes Avenue * Suite 302 * Pittsburgh, PA 15213 * (412) 268-7393, fax: (412) 268-7395 * innovation@andrew.cmu.edu * * 4. Redistributions of any form whatsoever must retain the following * acknowledgment: * "This product includes software developed by Computing Services * at Carnegie Mellon University (http://www.cmu.edu/computing/)." * * CARNEGIE MELLON UNIVERSITY DISCLAIMS ALL WARRANTIES WITH REGARD TO * THIS SOFTWARE, INCLUDING ALL IMPLIED WARRANTIES OF MERCHANTABILITY * AND FITNESS, IN NO EVENT SHALL CARNEGIE MELLON UNIVERSITY BE LIABLE * FOR ANY SPECIAL, INDIRECT OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES * WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN * AN ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING * OUT OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. * * $Id: util.h,v 1.28 2010/06/28 12:06:44 brong Exp $ * * Author: Chris Newman * Start Date: 4/6/93 */ #ifndef INCLUDED_UTIL_H #define INCLUDED_UTIL_H #include #include #include #include #define BIT32_MAX 4294967295U #if UINT_MAX == BIT32_MAX typedef unsigned int bit32; #elif ULONG_MAX == BIT32_MAX typedef unsigned long bit32; #elif USHRT_MAX == BIT32_MAX typedef unsigned short bit32; #else #error dont know what to use for bit32 #endif #ifdef HAVE_LONG_LONG_INT typedef unsigned long long int bit64; typedef unsigned long long int modseq_t; #define MODSEQ_FMT "%llu" #define atomodseq_t(s) strtoull(s, NULL, 10) #else typedef unsigned long int modseq_t; #define MODSEQ_FMT "%lu" #define atomodseq_t(s) strtoul(s, NULL, 10) #endif #define Uisalnum(c) isalnum((int)((unsigned char)(c))) #define Uisalpha(c) isalpha((int)((unsigned char)(c))) #define Uisascii(c) isascii((int)((unsigned char)(c))) #define Uiscntrl(c) iscntrl((int)((unsigned char)(c))) #define Uisdigit(c) isdigit((int)((unsigned char)(c))) #define Uislower(c) islower((int)((unsigned char)(c))) #define Uisspace(c) isspace((int)((unsigned char)(c))) #define Uisupper(c) isupper((int)((unsigned char)(c))) #define Uisxdigit(c) isxdigit((int)((unsigned char)(c))) extern const unsigned char convert_to_lowercase[256]; extern const unsigned char convert_to_uppercase[256]; #define TOUPPER(c) (convert_to_uppercase[(unsigned char)(c)]) #define TOLOWER(c) (convert_to_lowercase[(unsigned char)(c)]) #ifndef MAX #define MAX(x, y) ((x) > (y) ? (x) : (y)) #endif #ifndef MIN #define MIN(x, y) ((x) < (y) ? (x) : (y)) #endif typedef struct keyvalue { char *key, *value; } keyvalue; /* convert string to all lower case */ extern char *lcase (char *str); /* convert string to all upper case */ extern char *ucase (char *str); /* clean up control characters in a string while copying it * returns pointer to end of dst string. * dst must have twice the length of source */ extern char *beautify_copy (char *dst, const char *src); /* clean up control characters in a string while copying it * returns pointer to a static buffer containing the cleaned-up version * returns NULL on malloc() error */ extern char *beautify_string (const char *src); /* Same semantics as strcmp() but gracefully handles * either or both it's arguments being NULL */ int strcmpsafe(const char *a, const char *b); /* Same semantics as strcasecmp() but gracefully handles * either or both it's arguments being NULL */ int strcasecmpsafe(const char *a, const char *b); /* do a binary search in a keyvalue array * nelem is the number of keyvalue elements in the kv array * cmpf is the comparison function (strcmp, stricmp, etc). * returns NULL if not found, or key/value pair if found. */ extern keyvalue *kv_bsearch (const char *key, keyvalue *kv, int nelem, int (*cmpf)(const char *s1, const char *s2)); /* Examine the name of a file, and return a single character * (as an int) that can be used as the name of a hash * directory. Caller is responsible for skipping any prefix * of the name. */ extern int dir_hash_c(const char *name, int full); /* * create an [unlinked] temporary file and return the file descriptor. */ extern int create_tempfile(const char *path); /* Close a network filedescriptor the "safe" way */ extern int cyrus_close_sock(int fd); /* Reset stdin/stdout/stderr */ extern void cyrus_reset_stdio(); /* Create all parent directories for the given path, * up to but not including the basename. */ extern int cyrus_mkdir(const char *path, mode_t mode); extern int become_cyrus(void); /* Some systems have very inefficient implementations of isdigit, * and we use it in a lot of inner loops */ #define cyrus_isdigit(x) ((x) >= '0' && (x) <= '9') extern int parseint32(const char *p, const char **ptr, int32_t *res); extern int parseuint32(const char *p, const char **ptr, uint32_t *res); /* Timing related funcs/vars */ extern void cmdtime_settimer(int enable); extern void cmdtime_starttimer(); extern void cmdtime_endtimer(double * cmdtime, double * nettime); extern void cmdtime_netstart(); extern void cmdtime_netend(); #define BUF_CSTRING 1 struct buf { char *s; unsigned len; unsigned alloc; int flags; }; #define BUF_INITIALIZER { NULL, 0, 0, 0 } const char *buf_cstring(struct buf *buf); void buf_ensure(struct buf *buf, int morebytes); void buf_getmap(struct buf *buf, const char **base, int *len); unsigned buf_len(const struct buf *buf); void buf_reset(struct buf *buf); void buf_truncate(struct buf *buf, unsigned int len); void buf_setcstr(struct buf *buf, const char *str); void buf_setmap(struct buf *buf, const char *base, int len); void buf_copy(struct buf *dst, const struct buf *src); void buf_append(struct buf *dst, const struct buf *src); void buf_appendcstr(struct buf *buf, const char *str); void buf_appendbit32(struct buf *buf, bit32 num); void buf_appendmap(struct buf *buf, const char *base, int len); void buf_putc(struct buf *buf, char c); void buf_printf(struct buf *buf, const char *fmt, ...) __attribute__((format(printf,2,3))); unsigned int buf_replace_all(struct buf *buf, const char *match, const char *replace); int buf_cmp(const struct buf *, const struct buf *); void buf_init(struct buf *buf); void buf_init_ro(struct buf *buf, const char *base, int len); void buf_free(struct buf *buf); void buf_move(struct buf *dst, struct buf *src); /* use getpassphrase on machines which support it */ #ifdef HAVE_GETPASSPHRASE #define cyrus_getpass getpassphrase #else #define cyrus_getpass getpass #endif /* * Given a list of strings, terminated by (char *)NULL, * return a newly allocated string containing the * concatention of all the argument strings. The * caller must free the returned string using free(). * * This API idea based on glib's g_strconcat() which * is really quite amazingly convenient. */ char *strconcat(const char *s1, ...); #endif /* INCLUDED_UTIL_H */ 070701000a2e75000081a40000000000000000000000015126e87d000006ee000000b500010002ffffffffffffffff0000002300000000root/usr/local/include/cyrus/md5.h/* MD5.H - wrapper for MD5 message digest routines */ #ifndef _CYRUS_MD5_H_ #define _CYRUS_MD5_H_ 1 #ifdef HAVE_CONFIG_H #include #endif /* * This is gnarly, sorry :( We might have been configured to build * with OpenSSL, or we might not. Some older versions of OpenSSL * will drag in their own md5.h when we include , but * newer ones don't. The OpenSSL header might be included before or * after this header file is included. * * So, we *might* have a definition of the MD5_CTX structure from * OpenSSL, now or later, or not. * * LibSASL also has MD5 routines, declared in , and that * header also defines a MD5_CTX structure. So we can't include * both md5.h's, but we need one. * * So we explicitly include the OpenSSL md5.h if OpenSSL is configured * in, otherwise we fallback to the libSASL routines. Note that we * cannot build without libSASL anyway, so we don't need to fallback * any further. * * The MD5 API varies slightly from library to library. Here's a * description of the API that Cyrus is expecting and that we try * to provide on top of whatever the library has. * * typedef struct ... { ... } MD5_CTX; * void MD5Init(MD5_CTX *); * void MD5Update(MD5_CTX *, const void *data, size_t len); * void MD5Final(unsigned char[MD5_DIGEST_LENGTH], MD5_CTX *); */ #ifdef HAVE_SSL #include #define MD5Init MD5_Init #define MD5Update MD5_Update #define MD5Final MD5_Final #else #include #include #define MD5Init _sasl_MD5Init #define MD5Update _sasl_MD5Update #define MD5Final _sasl_MD5Final #endif /* !HAVE_SSL */ #ifndef MD5_DIGEST_LENGTH #define MD5_DIGEST_LENGTH 16 #endif #endif /* _CYRUS_MD5_H_ */ 070701000a2e63000081a40000000000000000000000015126e87d00000904000000b500010002ffffffffffffffff0000002700000000root/usr/local/include/cyrus/bsearch.h/* bsearch.h -- binary search * * Copyright (c) 1994-2008 Carnegie Mellon University. All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in * the documentation and/or other materials provided with the * distribution. * * 3. The name "Carnegie Mellon University" must not be used to * endorse or promote products derived from this software without * prior written permission. For permission or any legal * details, please contact * Carnegie Mellon University * Center for Technology Transfer and Enterprise Creation * 4615 Forbes Avenue * Suite 302 * Pittsburgh, PA 15213 * (412) 268-7393, fax: (412) 268-7395 * innovation@andrew.cmu.edu * * 4. Redistributions of any form whatsoever must retain the following * acknowledgment: * "This product includes software developed by Computing Services * at Carnegie Mellon University (http://www.cmu.edu/computing/)." * * CARNEGIE MELLON UNIVERSITY DISCLAIMS ALL WARRANTIES WITH REGARD TO * THIS SOFTWARE, INCLUDING ALL IMPLIED WARRANTIES OF MERCHANTABILITY * AND FITNESS, IN NO EVENT SHALL CARNEGIE MELLON UNIVERSITY BE LIABLE * FOR ANY SPECIAL, INDIRECT OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES * WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN * AN ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING * OUT OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. * * $Id: bsearch.h,v 1.10 2010/01/06 17:01:44 murch Exp $ */ #ifndef INCLUDED_BSEARCH_H #define INCLUDED_BSEARCH_H extern int bsearch_mem(const char *word, int caseSensitive, const char *base, unsigned long len, unsigned long hint, unsigned long *linelenp); extern int bsearch_compare(const char *s1, const char *s2); extern int bsearch_ncompare(const char *s1, int l1, const char *s2, int l2); #endif /* INCLUDED_BSEARCH_H */ 070701000a2e64000081a40000000000000000000000015126e87d00000a91000000b500010002ffffffffffffffff0000002b00000000root/usr/local/include/cyrus/byteorder64.h/* byteorder64.h -- convert 64-bit values between host and network byte order * * Copyright (c) 1994-2008 Carnegie Mellon University. All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in * the documentation and/or other materials provided with the * distribution. * * 3. The name "Carnegie Mellon University" must not be used to * endorse or promote products derived from this software without * prior written permission. For permission or any legal * details, please contact * Carnegie Mellon University * Center for Technology Transfer and Enterprise Creation * 4615 Forbes Avenue * Suite 302 * Pittsburgh, PA 15213 * (412) 268-7393, fax: (412) 268-7395 * innovation@andrew.cmu.edu * * 4. Redistributions of any form whatsoever must retain the following * acknowledgment: * "This product includes software developed by Computing Services * at Carnegie Mellon University (http://www.cmu.edu/computing/)." * * CARNEGIE MELLON UNIVERSITY DISCLAIMS ALL WARRANTIES WITH REGARD TO * THIS SOFTWARE, INCLUDING ALL IMPLIED WARRANTIES OF MERCHANTABILITY * AND FITNESS, IN NO EVENT SHALL CARNEGIE MELLON UNIVERSITY BE LIABLE * FOR ANY SPECIAL, INDIRECT OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES * WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN * AN ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING * OUT OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. * * $Id: byteorder64.h,v 1.5 2010/01/06 17:01:44 murch Exp $ */ #ifndef _BYTEORDER64_H #define _BYTEORDER64_H #include #ifdef HAVE_LONG_LONG_INT /* 64-bit host/network byte-order swap macros */ #ifdef WORDS_BIGENDIAN #define htonll(x) (x) #define ntohll(x) (x) #else #define htonll(x) _htonll(x) #define ntohll(x) _ntohll(x) /* little-endian 64-bit host/network byte-order swap functions */ extern unsigned long long _htonll(unsigned long long); extern unsigned long long _ntohll(unsigned long long); #endif /* WORDS_BIGENDIAN */ /* 64-bit host/network byte-order swap functions to/from non-aligned buffers */ extern void *align_htonll(void *dst, unsigned long long src); extern unsigned long long align_ntohll(const void *src); #endif /* HAVE_LONG_LONG_INT */ #endif /* _BYTEORDER64_H */ 070701000a2e80000081a40000000000000000000000015126e87d0000010d000000b500010002ffffffffffffffff0000002700000000root/usr/local/include/cyrus/stristr.h/* stristr.h -- locate a substring case-insensitively */ /* $Id: stristr.h,v 1.2 2002/05/25 19:57:47 leg Exp $ */ #ifndef INCLUDED_STRISTR_H #define INCLUDED_STRISTR_H extern char *stristr(const char *haystack, const char *needle); #endif /* INCLUDED_STRISTR_H */ 070701000a2e60000081a40000000000000000000000015126e87d000011ae000000b500010002ffffffffffffffff0000002300000000root/usr/local/include/cyrus/acl.h/* acl.h -- definitions for access control lists * * Copyright (c) 1994-2008 Carnegie Mellon University. All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in * the documentation and/or other materials provided with the * distribution. * * 3. The name "Carnegie Mellon University" must not be used to * endorse or promote products derived from this software without * prior written permission. For permission or any legal * details, please contact * Carnegie Mellon University * Center for Technology Transfer and Enterprise Creation * 4615 Forbes Avenue * Suite 302 * Pittsburgh, PA 15213 * (412) 268-7393, fax: (412) 268-7395 * innovation@andrew.cmu.edu * * 4. Redistributions of any form whatsoever must retain the following * acknowledgment: * "This product includes software developed by Computing Services * at Carnegie Mellon University (http://www.cmu.edu/computing/)." * * CARNEGIE MELLON UNIVERSITY DISCLAIMS ALL WARRANTIES WITH REGARD TO * THIS SOFTWARE, INCLUDING ALL IMPLIED WARRANTIES OF MERCHANTABILITY * AND FITNESS, IN NO EVENT SHALL CARNEGIE MELLON UNIVERSITY BE LIABLE * FOR ANY SPECIAL, INDIRECT OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES * WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN * AN ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING * OUT OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. * * $Id: acl.h,v 1.20 2010/01/06 17:01:43 murch Exp $ * * Author: Chris Newman * Start Date: 6/28/93 */ #ifndef INCLUDED_ACL_H #define INCLUDED_ACL_H #include "auth.h" /* max length of an acl string */ #define ACL_MAXSTR 32 /* ACL bits */ #define ACL_LOOKUP 0x000001L #define ACL_READ 0x000002L #define ACL_SEEN 0x000004L #define ACL_WRITE 0x000008L #define ACL_INSERT 0x000010L #define ACL_POST 0x000020L #define ACL_CREATE 0x000040L #define ACL_DELETEMBOX 0x000080L #define ACL_DELETEMSG 0x000100L #define ACL_EXPUNGE 0x000200L #define ACL_ADMIN 0x000400L #define ACL_ALL 0x0007FFL #define ACL_USER0 0x000800L #define ACL_USER1 0x001000L #define ACL_USER2 0x002000L #define ACL_USER3 0x004000L #define ACL_USER4 0x008000L #define ACL_USER5 0x010000L #define ACL_USER6 0x020000L #define ACL_USER7 0x040000L #define ACL_USER8 0x080000L #define ACL_USER9 0x100000L #define ACL_FULL 0x1FFFFFL #define ACL_READ_WRITE (ACL_SEEN|ACL_WRITE|ACL_INSERT|ACL_DELETEMSG|ACL_EXPUNGE) #define ACL_MODE_SET 0 #define ACL_MODE_ADD 1 #define ACL_MODE_REMOVE 2 typedef int cyrus_acl_canonproc_t(void *rock, const char *identifier, int rights); /* convert a string to an acl bit vector */ extern int cyrus_acl_strtomask(const char *str); /* cyrus_acl_masktostr(acl, dst) * convert an acl bit vector to a string * dst must have room for 32 characters (only 20 used currently) * returns dst */ extern char *cyrus_acl_masktostr(int acl, char *str); /* cyrus_acl_myrights(acl) * Calculate the set of rights the user in 'auth_state' has in the ACL 'acl'. * 'acl' must be writable, but is restored to its original condition. */ extern int cyrus_acl_myrights(struct auth_state *auth_state, char *acl); /* cyrus_acl_set(acl, identifier, mode, access, canonproc, canonrock) Modify the * ACL pointed to by 'acl' to modify the rights granted to * 'identifier' as specified by 'mode' and the set specified in the * mask 'access'. 'mode' is one of ACL_MODE_SET, ACL_MODE_ADD, or * ACL_MODE_REMOVE. The pointer pointed to by 'acl' must have been * obtained from malloc(). returns -1 on error, 0 on success */ extern int cyrus_acl_set(char **acl, const char *identifier, int mode, int access, cyrus_acl_canonproc_t *canonproc, void *canonrock); /* cyrus_acl_remove(acl, identifier, canonproc, canonrock) * Remove any entry for 'identifier' in the ACL pointed to by 'acl'. * The pointer pointed to by 'acl' must have been obtained from malloc(). * returns -1 on error, 0 on success */ extern int cyrus_acl_remove(char **acl, const char *identifier, cyrus_acl_canonproc_t *canonproc, void *canonrock); #endif /* INCLUDED_ACL_H */ 070701000a2e85000081a40000000000000000000000015126e87d00000908000000b500010002ffffffffffffffff0000002800000000root/usr/local/include/cyrus/xstrlcpy.h/* xmalloc.h -- Allocation package that calls fatal() when out of memory * * Copyright (c) 1994-2008 Carnegie Mellon University. All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in * the documentation and/or other materials provided with the * distribution. * * 3. The name "Carnegie Mellon University" must not be used to * endorse or promote products derived from this software without * prior written permission. For permission or any legal * details, please contact * Carnegie Mellon University * Center for Technology Transfer and Enterprise Creation * 4615 Forbes Avenue * Suite 302 * Pittsburgh, PA 15213 * (412) 268-7393, fax: (412) 268-7395 * innovation@andrew.cmu.edu * * 4. Redistributions of any form whatsoever must retain the following * acknowledgment: * "This product includes software developed by Computing Services * at Carnegie Mellon University (http://www.cmu.edu/computing/)." * * CARNEGIE MELLON UNIVERSITY DISCLAIMS ALL WARRANTIES WITH REGARD TO * THIS SOFTWARE, INCLUDING ALL IMPLIED WARRANTIES OF MERCHANTABILITY * AND FITNESS, IN NO EVENT SHALL CARNEGIE MELLON UNIVERSITY BE LIABLE * FOR ANY SPECIAL, INDIRECT OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES * WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN * AN ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING * OUT OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. * * $Id: xstrlcpy.h,v 1.4 2010/01/06 17:01:48 murch Exp $ */ #ifndef INCLUDED_XSTRLCPY_H #define INCLUDED_XSTRLCPY_H #include /* for size_t */ #include /* for free() */ #include /* for strlen() */ #include /* handy string manipulation functions */ #ifndef HAVE_STRLCPY extern size_t strlcpy(char *dst, const char *src, size_t len); #endif #endif /* INCLUDED_XSTRLCPY_H */ 070701000a2e6c000081a40000000000000000000000015126e87d00002514000000b500010002ffffffffffffffff0000002800000000root/usr/local/include/cyrus/imapopts.h/* auto-generated by config2header 1.17 */ #ifndef INCLUDED_IMAPOPTS_H #define INCLUDED_IMAPOPTS_H enum opttype { OPT_BITFIELD, OPT_STRINGLIST, OPT_ENUM, OPT_SWITCH, OPT_INT, OPT_STRING, OPT_NOTOPT }; enum imapopt { IMAPOPT_ZERO = 0, IMAPOPT_ADMINS, IMAPOPT_AFSPTS_LOCALREALMS, IMAPOPT_AFSPTS_MYCELL, IMAPOPT_ALLOWALLSUBSCRIBE, IMAPOPT_ALLOWANONYMOUSLOGIN, IMAPOPT_ALLOWAPOP, IMAPOPT_ALLOWNEWNEWS, IMAPOPT_ALLOWPLAINTEXT, IMAPOPT_ALLOWUSERMOVES, IMAPOPT_ALTNAMESPACE, IMAPOPT_ANNOTATION_DB, IMAPOPT_ANNOTATION_DB_PATH, IMAPOPT_ANYONEUSERACL, IMAPOPT_ANNOTATION_DEFINITIONS, IMAPOPT_AUDITLOG, IMAPOPT_AUTH_MECH, IMAPOPT_AUTOCREATEQUOTA, IMAPOPT_BERKELEY_CACHESIZE, IMAPOPT_BERKELEY_LOCKS_MAX, IMAPOPT_BERKELEY_TXNS_MAX, IMAPOPT_BOUNDARY_LIMIT, IMAPOPT_CLIENT_TIMEOUT, IMAPOPT_COMMANDMINTIMER, IMAPOPT_CONFIGDIRECTORY, IMAPOPT_DEBUG_COMMAND, IMAPOPT_DEFAULTACL, IMAPOPT_DEFAULTDOMAIN, IMAPOPT_DEFAULTPARTITION, IMAPOPT_DEFAULTSERVER, IMAPOPT_DELETEDPREFIX, IMAPOPT_DELETE_MODE, IMAPOPT_DELETERIGHT, IMAPOPT_DISABLE_USER_NAMESPACE, IMAPOPT_DISABLE_SHARED_NAMESPACE, IMAPOPT_DISCONNECT_ON_VANISHED_MAILBOX, IMAPOPT_DUPLICATE_DB, IMAPOPT_DUPLICATE_DB_PATH, IMAPOPT_DUPLICATESUPPRESSION, IMAPOPT_EXPUNGE_MODE, IMAPOPT_EXPUNGE_DAYS, IMAPOPT_FAILEDLOGINPAUSE, IMAPOPT_FLUSHSEENSTATE, IMAPOPT_FOOLSTUPIDCLIENTS, IMAPOPT_FORCE_SASL_CLIENT_MECH, IMAPOPT_FULLDIRHASH, IMAPOPT_HASHIMAPSPOOL, IMAPOPT_IDLESOCKET, IMAPOPT_IGNOREREFERENCE, IMAPOPT_IMAPIDLEPOLL, IMAPOPT_IMAPIDRESPONSE, IMAPOPT_IMAPMAGICPLUS, IMAPOPT_IMPLICIT_OWNER_RIGHTS, IMAPOPT_IMPROVED_MBOXLIST_SORT, IMAPOPT_INTERNALDATE_HEURISTIC, IMAPOPT_LDAP_AUTHZ, IMAPOPT_LDAP_BASE, IMAPOPT_LDAP_BIND_DN, IMAPOPT_LDAP_DEREF, IMAPOPT_LDAP_FILTER, IMAPOPT_LDAP_GROUP_BASE, IMAPOPT_LDAP_GROUP_FILTER, IMAPOPT_LDAP_GROUP_SCOPE, IMAPOPT_LDAP_ID, IMAPOPT_LDAP_MECH, IMAPOPT_LDAP_MEMBER_ATTRIBUTE, IMAPOPT_LDAP_MEMBER_BASE, IMAPOPT_LDAP_MEMBER_FILTER, IMAPOPT_LDAP_MEMBER_METHOD, IMAPOPT_LDAP_MEMBER_SCOPE, IMAPOPT_LDAP_PASSWORD, IMAPOPT_LDAP_REALM, IMAPOPT_LDAP_REFERRALS, IMAPOPT_LDAP_RESTART, IMAPOPT_LDAP_SASL, IMAPOPT_LDAP_SASL_AUTHC, IMAPOPT_LDAP_SASL_AUTHZ, IMAPOPT_LDAP_SASL_MECH, IMAPOPT_LDAP_SASL_PASSWORD, IMAPOPT_LDAP_SASL_REALM, IMAPOPT_LDAP_SCOPE, IMAPOPT_LDAP_SERVERS, IMAPOPT_LDAP_SIZE_LIMIT, IMAPOPT_LDAP_START_TLS, IMAPOPT_LDAP_TIME_LIMIT, IMAPOPT_LDAP_TIMEOUT, IMAPOPT_LDAP_TLS_CACERT_DIR, IMAPOPT_LDAP_TLS_CACERT_FILE, IMAPOPT_LDAP_TLS_CERT, IMAPOPT_LDAP_TLS_CHECK_PEER, IMAPOPT_LDAP_TLS_CIPHERS, IMAPOPT_LDAP_TLS_KEY, IMAPOPT_LDAP_URI, IMAPOPT_LDAP_VERSION, IMAPOPT_LMTP_DOWNCASE_RCPT, IMAPOPT_LMTP_FUZZY_MAILBOX_MATCH, IMAPOPT_LMTP_OVER_QUOTA_PERM_FAILURE, IMAPOPT_LMTP_STRICT_QUOTA, IMAPOPT_LMTP_STRICT_RFC2821, IMAPOPT_LMTPSOCKET, IMAPOPT_LMTPTXN_TIMEOUT, IMAPOPT_LOGINREALMS, IMAPOPT_LOGINUSEACL, IMAPOPT_LOGTIMESTAMPS, IMAPOPT_MAILBOX_DEFAULT_OPTIONS, IMAPOPT_MAILNOTIFIER, IMAPOPT_MAXHEADERLINES, IMAPOPT_MAXMESSAGESIZE, IMAPOPT_MAXQUOTED, IMAPOPT_MAXWORD, IMAPOPT_MBOXKEY_DB, IMAPOPT_MBOXLIST_DB, IMAPOPT_MBOXLIST_DB_PATH, IMAPOPT_MBOXNAME_LOCKPATH, IMAPOPT_METAPARTITION_FILES, IMAPOPT_MUPDATE_AUTHNAME, IMAPOPT_MUPDATE_CONFIG, IMAPOPT_MUNGE8BIT, IMAPOPT_MUPDATE_CONNECTIONS_MAX, IMAPOPT_MUPDATE_PASSWORD, IMAPOPT_MUPDATE_PORT, IMAPOPT_MUPDATE_REALM, IMAPOPT_MUPDATE_RETRY_DELAY, IMAPOPT_MUPDATE_SERVER, IMAPOPT_MUPDATE_USERNAME, IMAPOPT_MUPDATE_WORKERS_MAX, IMAPOPT_MUPDATE_WORKERS_MAXSPARE, IMAPOPT_MUPDATE_WORKERS_MINSPARE, IMAPOPT_MUPDATE_WORKERS_START, IMAPOPT_NETSCAPEURL, IMAPOPT_NEWSADDHEADERS, IMAPOPT_NEWSGROUPS, IMAPOPT_NEWSMASTER, IMAPOPT_NEWSPEER, IMAPOPT_NEWSPOSTUSER, IMAPOPT_NEWSPREFIX, IMAPOPT_NEWSRC_DB_PATH, IMAPOPT_NNTPTIMEOUT, IMAPOPT_NOTIFYSOCKET, IMAPOPT_NOTIFY_EXTERNAL, IMAPOPT_PLAINTEXTLOGINPAUSE, IMAPOPT_PLAINTEXTLOGINALERT, IMAPOPT_POPEXPIRETIME, IMAPOPT_POPMINPOLL, IMAPOPT_POPSUBFOLDERS, IMAPOPT_POPPOLLPADDING, IMAPOPT_POPTIMEOUT, IMAPOPT_POPUSEACL, IMAPOPT_POPUSEIMAPFLAGS, IMAPOPT_POSTMASTER, IMAPOPT_POSTSPEC, IMAPOPT_POSTUSER, IMAPOPT_PROC_PATH, IMAPOPT_PROXY_AUTHNAME, IMAPOPT_PROXY_COMPRESS, IMAPOPT_PROXY_PASSWORD, IMAPOPT_PROXY_REALM, IMAPOPT_PROXYD_ALLOW_STATUS_REFERRAL, IMAPOPT_PROXYD_DISABLE_MAILBOX_REFERRALS, IMAPOPT_PROXYSERVERS, IMAPOPT_PTS_MODULE, IMAPOPT_PTLOADER_SOCK, IMAPOPT_PTSCACHE_DB, IMAPOPT_PTSCACHE_DB_PATH, IMAPOPT_PTSCACHE_TIMEOUT, IMAPOPT_PTSKRB5_CONVERT524, IMAPOPT_PTSKRB5_STRIP_DEFAULT_REALM, IMAPOPT_QOSMARKING, IMAPOPT_QUOTA_DB, IMAPOPT_QUOTA_DB_PATH, IMAPOPT_QUOTAWARN, IMAPOPT_QUOTAWARNKB, IMAPOPT_REJECT8BIT, IMAPOPT_RFC2046_STRICT, IMAPOPT_RFC3028_STRICT, IMAPOPT_SASL_MAXIMUM_LAYER, IMAPOPT_SASL_MINIMUM_LAYER, IMAPOPT_SEENSTATE_DB, IMAPOPT_SENDMAIL, IMAPOPT_SERVERLIST, IMAPOPT_SERVERNAME, IMAPOPT_SERVERINFO, IMAPOPT_SHAREDPREFIX, IMAPOPT_SIEVE_ALLOWREFERRALS, IMAPOPT_SIEVE_EXTENSIONS, IMAPOPT_SIEVE_MAXSCRIPTSIZE, IMAPOPT_SIEVE_MAXSCRIPTS, IMAPOPT_SIEVE_UTF8FILEINTO, IMAPOPT_SIEVE_SASL_SEND_UNSOLICITED_CAPABILITY, IMAPOPT_SIEVEDIR, IMAPOPT_SIEVENOTIFIER, IMAPOPT_SIEVEUSEHOMEDIR, IMAPOPT_SINGLEINSTANCESTORE, IMAPOPT_SKIPLIST_ALWAYS_CHECKPOINT, IMAPOPT_SKIPLIST_UNSAFE, IMAPOPT_SOFT_NOAUTH, IMAPOPT_SPECIALUSEALWAYS, IMAPOPT_SQL_DATABASE, IMAPOPT_SQL_ENGINE, IMAPOPT_SQL_HOSTNAMES, IMAPOPT_SQL_PASSWD, IMAPOPT_SQL_USER, IMAPOPT_SQL_USESSL, IMAPOPT_SRVTAB, IMAPOPT_SUBMITSERVERS, IMAPOPT_SUBSCRIPTION_DB, IMAPOPT_SUPPRESS_CAPABILITIES, IMAPOPT_STATUSCACHE, IMAPOPT_STATUSCACHE_DB, IMAPOPT_STATUSCACHE_DB_PATH, IMAPOPT_SYNC_AUTHNAME, IMAPOPT_SYNC_COMPRESS, IMAPOPT_SYNC_HOST, IMAPOPT_SYNC_LOG, IMAPOPT_SYNC_LOG_CHAIN, IMAPOPT_SYNC_LOG_CHANNELS, IMAPOPT_SYNC_PASSWORD, IMAPOPT_SYNC_PORT, IMAPOPT_SYNC_REALM, IMAPOPT_SYNC_REPEAT_INTERVAL, IMAPOPT_SYNC_SHUTDOWN_FILE, IMAPOPT_SYSLOG_PREFIX, IMAPOPT_TCP_KEEPALIVE, IMAPOPT_TCP_KEEPALIVE_CNT, IMAPOPT_TCP_KEEPALIVE_IDLE, IMAPOPT_TCP_KEEPALIVE_INTVL, IMAPOPT_TEMP_PATH, IMAPOPT_TIMEOUT, IMAPOPT_TLS_CA_FILE, IMAPOPT_TLS_CA_PATH, IMAPOPT_TLSCACHE_DB, IMAPOPT_TLSCACHE_DB_PATH, IMAPOPT_TLS_CERT_FILE, IMAPOPT_TLS_CIPHER_LIST, IMAPOPT_TLS_KEY_FILE, IMAPOPT_TLS_REQUIRE_CERT, IMAPOPT_TLS_SESSION_TIMEOUT, IMAPOPT_UMASK, IMAPOPT_USERDENY_DB, IMAPOPT_USERDENY_DB_PATH, IMAPOPT_USER_FOLDER_LIMIT, IMAPOPT_USERNAME_TOLOWER, IMAPOPT_USERPREFIX, IMAPOPT_UNIX_GROUP_ENABLE, IMAPOPT_UNIXHIERARCHYSEP, IMAPOPT_VIRTDOMAINS, IMAPOPT_LAST }; enum enum_value { IMAP_ENUM_ZERO = 0, IMAP_ENUM_DELETE_MODE_IMMEDIATE = 0, IMAP_ENUM_DELETE_MODE_DELAYED, IMAP_ENUM_EXPUNGE_MODE_DEFAULT = 0, IMAP_ENUM_EXPUNGE_MODE_IMMEDIATE, IMAP_ENUM_EXPUNGE_MODE_DELAYED, IMAP_ENUM_INTERNALDATE_HEURISTIC_STANDARD = 0, IMAP_ENUM_INTERNALDATE_HEURISTIC_RECEIVEDHEADER, IMAP_ENUM_METAPARTITION_FILES_HEADER = (1<<0), IMAP_ENUM_METAPARTITION_FILES_INDEX = (1<<1), IMAP_ENUM_METAPARTITION_FILES_CACHE = (1<<2), IMAP_ENUM_METAPARTITION_FILES_EXPUNGE = (1<<3), IMAP_ENUM_METAPARTITION_FILES_SQUAT = (1<<4), IMAP_ENUM_MUPDATE_CONFIG_STANDARD = 0, IMAP_ENUM_MUPDATE_CONFIG_UNIFIED, IMAP_ENUM_MUPDATE_CONFIG_REPLICATED, IMAP_ENUM_NEWSADDHEADERS_TO = (1<<0), IMAP_ENUM_NEWSADDHEADERS_REPLYTO = (1<<1), IMAP_ENUM_QOSMARKING_CS0 = 0, IMAP_ENUM_QOSMARKING_CS1, IMAP_ENUM_QOSMARKING_CS2, IMAP_ENUM_QOSMARKING_CS3, IMAP_ENUM_QOSMARKING_CS4, IMAP_ENUM_QOSMARKING_CS5, IMAP_ENUM_QOSMARKING_CS6, IMAP_ENUM_QOSMARKING_CS7, IMAP_ENUM_QOSMARKING_AF11, IMAP_ENUM_QOSMARKING_AF12, IMAP_ENUM_QOSMARKING_AF13, IMAP_ENUM_QOSMARKING_AF21, IMAP_ENUM_QOSMARKING_AF22, IMAP_ENUM_QOSMARKING_AF23, IMAP_ENUM_QOSMARKING_AF31, IMAP_ENUM_QOSMARKING_AF32, IMAP_ENUM_QOSMARKING_AF33, IMAP_ENUM_QOSMARKING_AF41, IMAP_ENUM_QOSMARKING_AF42, IMAP_ENUM_QOSMARKING_AF43, IMAP_ENUM_QOSMARKING_EF, IMAP_ENUM_SERVERINFO_OFF = 0, IMAP_ENUM_SERVERINFO_MIN, IMAP_ENUM_SERVERINFO_ON, IMAP_ENUM_SIEVE_EXTENSIONS_FILEINTO = (1<<0), IMAP_ENUM_SIEVE_EXTENSIONS_REJECT = (1<<1), IMAP_ENUM_SIEVE_EXTENSIONS_VACATION = (1<<2), IMAP_ENUM_SIEVE_EXTENSIONS_IMAPFLAGS = (1<<3), IMAP_ENUM_SIEVE_EXTENSIONS_NOTIFY = (1<<4), IMAP_ENUM_SIEVE_EXTENSIONS_INCLUDE = (1<<5), IMAP_ENUM_SIEVE_EXTENSIONS_ENVELOPE = (1<<6), IMAP_ENUM_SIEVE_EXTENSIONS_BODY = (1<<7), IMAP_ENUM_SIEVE_EXTENSIONS_RELATIONAL = (1<<8), IMAP_ENUM_SIEVE_EXTENSIONS_REGEX = (1<<9), IMAP_ENUM_SIEVE_EXTENSIONS_SUBADDRESS = (1<<10), IMAP_ENUM_SIEVE_EXTENSIONS_COPY = (1<<11), IMAP_ENUM_VIRTDOMAINS_OFF = 0, IMAP_ENUM_VIRTDOMAINS_USERID, IMAP_ENUM_VIRTDOMAINS_ON }; union config_value { void *dummy; const char *s; /* OPT_STRING, OPT_STRINGLIST */ long i; /* OPT_INT */ long b; /* OPT_SWITCH */ enum enum_value e; /* OPT_ENUM */ unsigned long x; /* OPT_BITFIELD */ }; struct enum_option_s { const char *name; const enum enum_value val; }; #define MAX_ENUM_OPTS 21 struct imapopt_s { const enum imapopt opt; const char *optname; int seen; const enum opttype t; union config_value val; const struct enum_option_s enum_options[MAX_ENUM_OPTS+1]; }; extern struct imapopt_s imapopts[]; #endif /* INCLUDED_IMAPOPTIONS_H */ 070701000a2e62000081a40000000000000000000000015126e87d00000c34000000b500010002ffffffffffffffff0000002400000000root/usr/local/include/cyrus/auth.h/* auth.h -- Site authorization module * * Copyright (c) 1994-2008 Carnegie Mellon University. All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in * the documentation and/or other materials provided with the * distribution. * * 3. The name "Carnegie Mellon University" must not be used to * endorse or promote products derived from this software without * prior written permission. For permission or any legal * details, please contact * Carnegie Mellon University * Center for Technology Transfer and Enterprise Creation * 4615 Forbes Avenue * Suite 302 * Pittsburgh, PA 15213 * (412) 268-7393, fax: (412) 268-7395 * innovation@andrew.cmu.edu * * 4. Redistributions of any form whatsoever must retain the following * acknowledgment: * "This product includes software developed by Computing Services * at Carnegie Mellon University (http://www.cmu.edu/computing/)." * * CARNEGIE MELLON UNIVERSITY DISCLAIMS ALL WARRANTIES WITH REGARD TO * THIS SOFTWARE, INCLUDING ALL IMPLIED WARRANTIES OF MERCHANTABILITY * AND FITNESS, IN NO EVENT SHALL CARNEGIE MELLON UNIVERSITY BE LIABLE * FOR ANY SPECIAL, INDIRECT OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES * WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN * AN ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING * OUT OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. * * $Id: auth.h,v 1.19 2010/01/06 17:01:43 murch Exp $ */ #ifndef INCLUDED_AUTH_H #define INCLUDED_AUTH_H struct auth_state; struct auth_mech { const char *name; char *(*canonifyid)(const char *identifier, size_t len); int (*memberof)(struct auth_state *auth_state, const char *identifier); struct auth_state *(*newstate)(const char *identifier); void (*freestate)(struct auth_state *auth_state); }; extern struct auth_mech *auth_mechs[]; /* Note that some of these may be undefined symbols * if libcyrus was not built with support for them */ extern struct auth_mech auth_unix; extern struct auth_mech auth_pts; extern struct auth_mech auth_krb; extern struct auth_mech auth_krb5; /* auth_canonifyid: canonify the given identifier and return a pointer * to a static buffer with the canonified ID, or NULL on * failure */ /* identifier: id to canonify */ /* len: length of id, or 0 to do strlen(identifier) */ char *auth_canonifyid(const char *identifier, size_t len); int auth_memberof(struct auth_state *auth_state, const char *identifier); struct auth_state *auth_newstate(const char *identifier); void auth_freestate(struct auth_state *auth_state); #endif /* INCLUDED_AUTH_H */ 070701000a2e61000081a40000000000000000000000015126e87d000008d9000000b500010002ffffffffffffffff0000002600000000root/usr/local/include/cyrus/assert.h/* assert.h -- assert() macro that can exit cleanly * * Copyright (c) 1994-2008 Carnegie Mellon University. All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in * the documentation and/or other materials provided with the * distribution. * * 3. The name "Carnegie Mellon University" must not be used to * endorse or promote products derived from this software without * prior written permission. For permission or any legal * details, please contact * Carnegie Mellon University * Center for Technology Transfer and Enterprise Creation * 4615 Forbes Avenue * Suite 302 * Pittsburgh, PA 15213 * (412) 268-7393, fax: (412) 268-7395 * innovation@andrew.cmu.edu * * 4. Redistributions of any form whatsoever must retain the following * acknowledgment: * "This product includes software developed by Computing Services * at Carnegie Mellon University (http://www.cmu.edu/computing/)." * * CARNEGIE MELLON UNIVERSITY DISCLAIMS ALL WARRANTIES WITH REGARD TO * THIS SOFTWARE, INCLUDING ALL IMPLIED WARRANTIES OF MERCHANTABILITY * AND FITNESS, IN NO EVENT SHALL CARNEGIE MELLON UNIVERSITY BE LIABLE * FOR ANY SPECIAL, INDIRECT OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES * WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN * AN ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING * OUT OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. * * $Id: assert.h,v 1.12 2010/01/06 17:01:43 murch Exp $ */ #ifndef INCLUDED_ASSERT_H #define INCLUDED_ASSERT_H #ifdef __STDC__ #define assert(ex) {if (!(ex))assertionfailed(__FILE__, __LINE__, #ex);} void assertionfailed(const char *file, int line, const char *expr); #else #define assert(ex) {if (!(ex))assertionfailed(__FILE__, __LINE__, (char*)0);} #endif #endif /* INCLUDED_ASSERT_H */ 070701000a2e6f000081a40000000000000000000000015126e87d000008d2000000b500010002ffffffffffffffff0000002700000000root/usr/local/include/cyrus/imparse.h/* imparse.h -- IMxP client-side parsing routines * * Copyright (c) 1994-2008 Carnegie Mellon University. All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in * the documentation and/or other materials provided with the * distribution. * * 3. The name "Carnegie Mellon University" must not be used to * endorse or promote products derived from this software without * prior written permission. For permission or any legal * details, please contact * Carnegie Mellon University * Center for Technology Transfer and Enterprise Creation * 4615 Forbes Avenue * Suite 302 * Pittsburgh, PA 15213 * (412) 268-7393, fax: (412) 268-7395 * innovation@andrew.cmu.edu * * 4. Redistributions of any form whatsoever must retain the following * acknowledgment: * "This product includes software developed by Computing Services * at Carnegie Mellon University (http://www.cmu.edu/computing/)." * * CARNEGIE MELLON UNIVERSITY DISCLAIMS ALL WARRANTIES WITH REGARD TO * THIS SOFTWARE, INCLUDING ALL IMPLIED WARRANTIES OF MERCHANTABILITY * AND FITNESS, IN NO EVENT SHALL CARNEGIE MELLON UNIVERSITY BE LIABLE * FOR ANY SPECIAL, INDIRECT OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES * WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN * AN ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING * OUT OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. * * $Id: imparse.h,v 1.9 2010/01/06 17:01:45 murch Exp $ */ #ifndef INCLUDED_IMPARSE_H #define INCLUDED_IMPARSE_H extern int imparse_word (char **s, char **retval); extern int imparse_astring (char **s, char **retval); extern int imparse_isatom (const char *s); extern int imparse_issequence (const char *s); extern int imparse_isnumber (const char *s); #endif /* INCLUDED_IMPARSE_H */ 070701000a2e78000081a40000000000000000000000015126e87d00000893000000b500010002ffffffffffffffff0000002800000000root/usr/local/include/cyrus/nonblock.h/* nonblock.h -- Set nonbolocking mode on file descriptor * * Copyright (c) 1994-2008 Carnegie Mellon University. All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in * the documentation and/or other materials provided with the * distribution. * * 3. The name "Carnegie Mellon University" must not be used to * endorse or promote products derived from this software without * prior written permission. For permission or any legal * details, please contact * Carnegie Mellon University * Center for Technology Transfer and Enterprise Creation * 4615 Forbes Avenue * Suite 302 * Pittsburgh, PA 15213 * (412) 268-7393, fax: (412) 268-7395 * innovation@andrew.cmu.edu * * 4. Redistributions of any form whatsoever must retain the following * acknowledgment: * "This product includes software developed by Computing Services * at Carnegie Mellon University (http://www.cmu.edu/computing/)." * * CARNEGIE MELLON UNIVERSITY DISCLAIMS ALL WARRANTIES WITH REGARD TO * THIS SOFTWARE, INCLUDING ALL IMPLIED WARRANTIES OF MERCHANTABILITY * AND FITNESS, IN NO EVENT SHALL CARNEGIE MELLON UNIVERSITY BE LIABLE * FOR ANY SPECIAL, INDIRECT OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES * WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN * AN ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING * OUT OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. * * $Id: nonblock.h,v 1.10 2010/01/06 17:01:46 murch Exp $ */ #ifndef INCLUDED_NONBLOCK_H #define INCLUDED_NONBLOCK_H #ifndef P #ifdef __STDC__ #define P(x) x #else #define P(x) () #endif #endif extern const char *nonblock_method_desc; extern void nonblock P((int fd, int mode)); #endif /* INCLUDED_NONBLOCK_H */ 070701000a2e69000081a40000000000000000000000015126e87d00000f60000000b500010002ffffffffffffffff0000002400000000root/usr/local/include/cyrus/glob.h/* glob.h -- fast globbing routine using '*', '%', and '?' * * Copyright (c) 1994-2008 Carnegie Mellon University. All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in * the documentation and/or other materials provided with the * distribution. * * 3. The name "Carnegie Mellon University" must not be used to * endorse or promote products derived from this software without * prior written permission. For permission or any legal * details, please contact * Carnegie Mellon University * Center for Technology Transfer and Enterprise Creation * 4615 Forbes Avenue * Suite 302 * Pittsburgh, PA 15213 * (412) 268-7393, fax: (412) 268-7395 * innovation@andrew.cmu.edu * * 4. Redistributions of any form whatsoever must retain the following * acknowledgment: * "This product includes software developed by Computing Services * at Carnegie Mellon University (http://www.cmu.edu/computing/)." * * CARNEGIE MELLON UNIVERSITY DISCLAIMS ALL WARRANTIES WITH REGARD TO * THIS SOFTWARE, INCLUDING ALL IMPLIED WARRANTIES OF MERCHANTABILITY * AND FITNESS, IN NO EVENT SHALL CARNEGIE MELLON UNIVERSITY BE LIABLE * FOR ANY SPECIAL, INDIRECT OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES * WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN * AN ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING * OUT OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. * * $Id: glob.h,v 1.14 2010/01/06 17:01:45 murch Exp $ * * Author: Chris Newman * Start Date: 4/5/93 */ #ifndef INCLUDED_GLOB_H #define INCLUDED_GLOB_H #ifndef P #ifdef __STDC__ #define P(x) x #else #define P(x) () #endif #endif /* "compiled" glob structure: may change */ typedef struct glob { int flags; /* glob flags, see below */ int slen; /* suppress string length */ char *suppress; /* suppress string pointer */ const char *gstar, *ghier, *gptr; /* INBOX prefix comparison state */ char sep_char; /* separator character */ char inbox[6]; /* INBOX in the correct case */ char str[3]; /* glob string & suppress string */ } glob; /* glob_init flags: */ #define GLOB_ICASE 0x01 /* case insensitive */ #define GLOB_SUBSTRING 0x02 /* match a substring */ #define GLOB_HIERARCHY 0x04 /* use '%' as hierarchy matching and no '?' */ #define GLOB_INBOXCASE 0x08 /* match "inbox" prefix case insensitive */ /* initialize globbing structure * str -- globbing string * flags -- see flag values above * suppress -- prefix to suppress */ extern glob *glob_init_suppress P((const char *str, int flags, const char *suppress)); /* free a glob structure */ extern void glob_free P((glob **g)); /* returns -1 if no match, otherwise length of match or partial-match * g pre-processed glob string * ptr string to perform glob on * len length of ptr string (if 0, strlen() is used) * min pointer to minimum length of a valid partial-match. * Set to -1 if no more matches. Set to return value + 1 * if another match is possible. If NULL, no partial-matches * are returned. */ extern int glob_test P((glob *g, const char *str, long len, long *min)); /* macros */ #define glob_init(str, flags) glob_init_suppress((str), (flags), NULL) #define glob_inboxcase(g) ((g)->inbox) #define GLOB_TEST(g, str) glob_test((g), (str), 0, NULL) #define GLOB_SET_SEPARATOR(g, c) ((g)->sep_char = (c)) #endif /* INCLUDED_GLOB_H */ 070701000a2e67000081a40000000000000000000000015126e87d0000095c000000b500010002ffffffffffffffff0000002800000000root/usr/local/include/cyrus/cyr_lock.h/* cyr_lock.h -- file locking primitives * * Copyright (c) 1994-2008 Carnegie Mellon University. All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in * the documentation and/or other materials provided with the * distribution. * * 3. The name "Carnegie Mellon University" must not be used to * endorse or promote products derived from this software without * prior written permission. For permission or any legal * details, please contact * Carnegie Mellon University * Center for Technology Transfer and Enterprise Creation * 4615 Forbes Avenue * Suite 302 * Pittsburgh, PA 15213 * (412) 268-7393, fax: (412) 268-7395 * innovation@andrew.cmu.edu * * 4. Redistributions of any form whatsoever must retain the following * acknowledgment: * "This product includes software developed by Computing Services * at Carnegie Mellon University (http://www.cmu.edu/computing/)." * * CARNEGIE MELLON UNIVERSITY DISCLAIMS ALL WARRANTIES WITH REGARD TO * THIS SOFTWARE, INCLUDING ALL IMPLIED WARRANTIES OF MERCHANTABILITY * AND FITNESS, IN NO EVENT SHALL CARNEGIE MELLON UNIVERSITY BE LIABLE * FOR ANY SPECIAL, INDIRECT OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES * WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN * AN ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING * OUT OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. * * $Id: lock.h,v 1.9 2010/01/06 17:01:46 murch Exp $ */ #ifndef INCLUDED_LOCK_H #define INCLUDED_LOCK_H #ifndef P #ifdef __STDC__ #define P(x) x #else #define P(x) () #endif #endif #include extern const char *lock_method_desc; extern int lock_reopen P((int fd, const char *filename, struct stat *sbuf, const char **failaction)); extern int lock_blocking P((int fd)); extern int lock_shared P((int fd)); extern int lock_nonblocking P((int fd)); extern int lock_unlock P((int fd)); #endif /* INCLUDED_LOCK_H */ 070701000a2e74000081a40000000000000000000000015126e87d00000c17000000b500010002ffffffffffffffff0000002300000000root/usr/local/include/cyrus/map.h/* map.h -- memory mapping functions * * Copyright (c) 1994-2008 Carnegie Mellon University. All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in * the documentation and/or other materials provided with the * distribution. * * 3. The name "Carnegie Mellon University" must not be used to * endorse or promote products derived from this software without * prior written permission. For permission or any legal * details, please contact * Carnegie Mellon University * Center for Technology Transfer and Enterprise Creation * 4615 Forbes Avenue * Suite 302 * Pittsburgh, PA 15213 * (412) 268-7393, fax: (412) 268-7395 * innovation@andrew.cmu.edu * * 4. Redistributions of any form whatsoever must retain the following * acknowledgment: * "This product includes software developed by Computing Services * at Carnegie Mellon University (http://www.cmu.edu/computing/)." * * CARNEGIE MELLON UNIVERSITY DISCLAIMS ALL WARRANTIES WITH REGARD TO * THIS SOFTWARE, INCLUDING ALL IMPLIED WARRANTIES OF MERCHANTABILITY * AND FITNESS, IN NO EVENT SHALL CARNEGIE MELLON UNIVERSITY BE LIABLE * FOR ANY SPECIAL, INDIRECT OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES * WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN * AN ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING * OUT OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. * * $Id: map.h,v 1.14 2010/01/06 17:01:46 murch Exp $ */ #ifndef INCLUDED_MAP_H #define INCLUDED_MAP_H #define MAP_UNKNOWN_LEN ((unsigned long)-1) extern const char *map_method_desc; /* Create a memory map * * fd is the file descriptor which is to be mapped * onceonly is set to be nonzero if you do not intend to ever refresh the map * base and len are output parameters that receive the address and length * of the map once it is created. NOTE: *len should be zero the first * time map_refresh() is called to force the initial mapping * newlen is set to the size of the file, or MAP_UNKNOWN_LEN to have the * mapping facility compute it for you. * name and mboxname are used for logging purposes, name is the name * of the file, and shouldn't be NULL, while mboxname is the name * of the applicable mailbox (if any), and may be NULL */ extern void map_refresh(int fd, int onceonly, const char **base, unsigned long *len, unsigned long newlen, const char *name, const char *mboxname); /* map_free will free a memory map allocated by map_refresh * * base and len are the same values that were passed to map_refresh */ extern void map_free(const char **base, unsigned long *len); #endif /* INCLUDED_MAP_H */ 070701000a2e7a000081a40000000000000000000000015126e87d0000271c000000b500010002ffffffffffffffff0000002400000000root/usr/local/include/cyrus/prot.h/* prot.h -- stdio-like module that handles buffering, SASL, and TLS * details for I/O over sockets * * Copyright (c) 1994-2008 Carnegie Mellon University. All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in * the documentation and/or other materials provided with the * distribution. * * 3. The name "Carnegie Mellon University" must not be used to * endorse or promote products derived from this software without * prior written permission. For permission or any legal * details, please contact * Carnegie Mellon University * Center for Technology Transfer and Enterprise Creation * 4615 Forbes Avenue * Suite 302 * Pittsburgh, PA 15213 * (412) 268-7393, fax: (412) 268-7395 * innovation@andrew.cmu.edu * * 4. Redistributions of any form whatsoever must retain the following * acknowledgment: * "This product includes software developed by Computing Services * at Carnegie Mellon University (http://www.cmu.edu/computing/)." * * CARNEGIE MELLON UNIVERSITY DISCLAIMS ALL WARRANTIES WITH REGARD TO * THIS SOFTWARE, INCLUDING ALL IMPLIED WARRANTIES OF MERCHANTABILITY * AND FITNESS, IN NO EVENT SHALL CARNEGIE MELLON UNIVERSITY BE LIABLE * FOR ANY SPECIAL, INDIRECT OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES * WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN * AN ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING * OUT OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. * * $Id: prot.h,v 1.48 2010/01/06 17:01:47 murch Exp $ */ #ifndef INCLUDED_PROT_H #define INCLUDED_PROT_H #include #include #include #include #ifdef HAVE_SSL #include #endif /* HAVE_SSL */ #ifdef HAVE_ZLIB #include #endif /* HAVE_ZLIB */ #include "util.h" #define PROT_BUFSIZE 4096 /* #define PROT_BUFSIZE 8192 */ #define PROT_NO_FD -1 struct protstream; struct prot_waitevent; typedef void prot_readcallback_t(struct protstream *s, void *rock); struct protstream { /* The Buffer */ unsigned char *buf; unsigned buf_size; unsigned char *ptr; /* The end of data in the buffer */ unsigned cnt; /* Space Remaining in buffer */ /* File Descriptors */ int fd; /* The Socket */ int logfd; /* The Telemetry Log (or PROT_NO_FD) */ int big_buffer; /* The Big Buffer (or PROT_NO_FD) */ /* SASL / TLS */ sasl_conn_t *conn; int saslssf; int maxplain; #ifdef HAVE_SSL SSL *tls_conn; #endif /* HAVE_SSL */ #ifdef HAVE_ZLIB /* (De)compress stream */ z_stream *zstrm; /* (De)compress buffer */ unsigned char *zbuf; unsigned int zbuf_size; /* Compress parameters */ int zlevel; int zflush; #endif /* HAVE_ZLIB */ /* Big Buffer Information */ const char *bigbuf_base; /* Base Pointer */ unsigned long bigbuf_siz; /* Overall Size of Buffer */ unsigned long bigbuf_len; /* Length of mapped file */ unsigned long bigbuf_pos; /* Current Position */ /* Status Flags */ int eof; int boundary; /* Type of data is about to change */ int fixedsize; char *error; /* Parameters */ int write; int dontblock; /* Application requested nonblocking */ int dontblock_isset; /* write only, we've fcntl(O_NONBLOCK)'d */ int read_timeout; time_t timeout_mark; struct protstream *flushonread; int can_unget; int bytes_in; int bytes_out; int isclient; /* Events */ prot_readcallback_t *readcallback_proc; void *readcallback_rock; struct prot_waitevent *waitevent; /* For use by applications */ void *userdata; }; typedef struct prot_waitevent *prot_waiteventcallback_t(struct protstream *s, struct prot_waitevent *ev, void *rock); struct prot_waitevent { time_t mark; prot_waiteventcallback_t *proc; void *rock; struct prot_waitevent *next; }; /* Not for use by applications directly, but needed by the macros. */ int prot_flush_internal(struct protstream *s, int force); #define PROT_EOF_STRING "end of file reached" #define PROTGROUP_SIZE_DEFAULT 32 struct protgroup; /* Opaque protgroup structure */ extern int prot_getc(struct protstream *s); extern int prot_ungetc(int c, struct protstream *s); extern int prot_putc(int c, struct protstream *s); /* The following two macros control the blocking nature of * the protstream. * * For a read stream, the non-blocking behavior is that for the * reading functions (prot_read, prot_getc, etc) we will return EOF and * set errno = EAGAIN if no data was pending. * * For a write stream, it's a bit more complicated. When a nonblocking * write stream is flushed, a nonblocking write to the network is attempted. * if it cannot write all of its data, the remaining data is flushed to a * "bigbuffer" temporary file. (When the next flush occurs, this temporary * buffer is flushed first, and additional data is appended to it if necessary) * Note that this means that in the telemetry logs, only the time of the * first prot_flush_internal() call is logged, not the call for when the data * actually is flushed to the network successfully. */ #define prot_BLOCK(s) ((s)->dontblock = 0) #define prot_NONBLOCK(s) ((s)->dontblock = 1) #define prot_IS_BLOCKING(s) ((s)->dontblock == 0) /* Allocate/free the protstream structure */ extern struct protstream *prot_new(int fd, int write); extern struct protstream *prot_readmap(const char *buf, uint32_t len); extern int prot_free(struct protstream *s); /* Set the telemetry logfile for a given protstream */ extern int prot_setlog(struct protstream *s, int fd); /* Get traffic counts */ extern int prot_bytes_in(struct protstream *s); extern int prot_bytes_out(struct protstream *s); #define prot_bytes_in(s) ((s)->bytes_in) #define prot_bytes_out(s) ((s)->bytes_out) /* Set the SASL options for a protstream (requires authentication to * be complete for the given sasl_conn_t */ extern int prot_setsasl(struct protstream *s, sasl_conn_t *conn); extern void prot_unsetsasl(struct protstream *s); #ifdef HAVE_SSL /* Set TLS options for a given protstream (requires a completed tls * negotiation */ extern int prot_settls(struct protstream *s, SSL *tlsconn); #endif /* HAVE_SSL */ /* Mark this protstream as a "client" for the purpose of generating * or consuming literals (thanks LITERAL+) */ int prot_setisclient(struct protstream *s, int val); #ifdef HAVE_ZLIB /* Enable (de)compression for a given protstream */ int prot_setcompress(struct protstream *s); #endif /* HAVE_ZLIB */ /* Tell the protstream that the type of data is about to change. */ int prot_data_boundary(struct protstream *s); /* Set a timeout for the connection (in seconds) */ extern int prot_settimeout(struct protstream *s, int timeout); /* Reset the timeout timer for the connection (in seconds) */ extern int prot_resettimeout(struct protstream *s); /* Connect two streams so that when you block on reading s, the layer * will automaticly flush flushs */ extern int prot_setflushonread(struct protstream *s, struct protstream *flushs); extern int prot_setreadcallback(struct protstream *s, prot_readcallback_t *proc, void *rock); extern struct prot_waitevent *prot_addwaitevent(struct protstream *s, time_t mark, prot_waiteventcallback_t *proc, void *rock); extern void prot_removewaitevent(struct protstream *s, struct prot_waitevent *event); extern const char *prot_error(struct protstream *s); extern int prot_rewind(struct protstream *s); /* Fill the buffer for a read stream with waiting data (may block) */ extern int prot_fill(struct protstream *s); /* Force a flush of an output stream */ extern int prot_flush(struct protstream *s); /* These are protlayer versions of the specified functions */ extern int prot_write(struct protstream *s, const char *buf, unsigned len); extern int prot_putbuf(struct protstream *s, struct buf *buf); extern int prot_printf(struct protstream *, const char *, ...) #ifdef __GNUC__ __attribute__ ((format (printf, 2, 3))); #else ; #endif extern int prot_printliteral(struct protstream *out, const char *s, size_t size); extern int prot_printstring(struct protstream *out, const char *s); extern int prot_printastring(struct protstream *out, const char *s); extern int prot_read(struct protstream *s, char *buf, unsigned size); extern char *prot_fgets(char *buf, unsigned size, struct protstream *s); /* select() for protstreams */ extern int prot_select(struct protgroup *readstreams, int extra_read_fd, struct protgroup **out, int *extra_read_flag, struct timeval *timeout); /* Protgroup manipulations */ /* Create a new protgroup of a certain size or as a copy of another * protgroup */ struct protgroup *protgroup_new(size_t size); struct protgroup *protgroup_copy(struct protgroup *src); /* Cleanup a protgroup but don't release the allocated memory (so it can * be reused) */ void protgroup_reset(struct protgroup *group); /* Release memory for a protgroup */ void protgroup_free(struct protgroup *group); /* Insert an element into a protgroup */ void protgroup_insert(struct protgroup *group, struct protstream *item); /* Delete an element from a protgroup */ void protgroup_delete(struct protgroup *group, struct protstream *item); /* Returns the protstream at that position in the protgroup, or NULL if * an invalid element is requested */ struct protstream *protgroup_getelement(struct protgroup *group, size_t element); #endif /* INCLUDED_PROT_H */ 070701000a2e84000081a40000000000000000000000015126e87d000008de000000b500010002ffffffffffffffff0000002800000000root/usr/local/include/cyrus/xstrlcat.h/* xmalloc.h -- Allocation package that calls fatal() when out of memory * * Copyright (c) 1994-2008 Carnegie Mellon University. All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in * the documentation and/or other materials provided with the * distribution. * * 3. The name "Carnegie Mellon University" must not be used to * endorse or promote products derived from this software without * prior written permission. For permission or any legal * details, please contact * Carnegie Mellon University * Center for Technology Transfer and Enterprise Creation * 4615 Forbes Avenue * Suite 302 * Pittsburgh, PA 15213 * (412) 268-7393, fax: (412) 268-7395 * innovation@andrew.cmu.edu * * 4. Redistributions of any form whatsoever must retain the following * acknowledgment: * "This product includes software developed by Computing Services * at Carnegie Mellon University (http://www.cmu.edu/computing/)." * * CARNEGIE MELLON UNIVERSITY DISCLAIMS ALL WARRANTIES WITH REGARD TO * THIS SOFTWARE, INCLUDING ALL IMPLIED WARRANTIES OF MERCHANTABILITY * AND FITNESS, IN NO EVENT SHALL CARNEGIE MELLON UNIVERSITY BE LIABLE * FOR ANY SPECIAL, INDIRECT OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES * WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN * AN ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING * OUT OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. * * $Id: xstrlcat.h,v 1.4 2010/01/06 17:01:48 murch Exp $ */ #ifndef INCLUDED_XSTRLCAT_H #define INCLUDED_XSTRLCAT_H #include /* for size_t */ #include /* for free() */ #include /* for strlen() */ #include #ifndef HAVE_STRLCAT extern size_t strlcat(char *dst, const char *src, size_t len); #endif #endif /* INCLUDED_XSTRLCAT_H */ 070701000a2e68000081a40000000000000000000000015126e87d00001d4d000000b500010002ffffffffffffffff0000002700000000root/usr/local/include/cyrus/cyrusdb.h/* * Copyright (c) 1994-2008 Carnegie Mellon University. All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in * the documentation and/or other materials provided with the * distribution. * * 3. The name "Carnegie Mellon University" must not be used to * endorse or promote products derived from this software without * prior written permission. For permission or any legal * details, please contact * Carnegie Mellon University * Center for Technology Transfer and Enterprise Creation * 4615 Forbes Avenue * Suite 302 * Pittsburgh, PA 15213 * (412) 268-7393, fax: (412) 268-7395 * innovation@andrew.cmu.edu * * 4. Redistributions of any form whatsoever must retain the following * acknowledgment: * "This product includes software developed by Computing Services * at Carnegie Mellon University (http://www.cmu.edu/computing/)." * * CARNEGIE MELLON UNIVERSITY DISCLAIMS ALL WARRANTIES WITH REGARD TO * THIS SOFTWARE, INCLUDING ALL IMPLIED WARRANTIES OF MERCHANTABILITY * AND FITNESS, IN NO EVENT SHALL CARNEGIE MELLON UNIVERSITY BE LIABLE * FOR ANY SPECIAL, INDIRECT OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES * WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN * AN ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING * OUT OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. * * $Id: cyrusdb.h,v 1.34 2010/01/06 17:01:44 murch Exp $ */ #ifndef INCLUDED_CYRUSDB_H #define INCLUDED_CYRUSDB_H struct db; struct txn; enum cyrusdb_ret { CYRUSDB_OK = 0, CYRUSDB_DONE = 1, CYRUSDB_IOERROR = -1, CYRUSDB_AGAIN = -2, CYRUSDB_EXISTS = -3, CYRUSDB_INTERNAL = -4, CYRUSDB_NOTFOUND = -5 }; #define cyrusdb_strerror(c) ("cyrusdb error") enum cyrusdb_initflags { CYRUSDB_RECOVER = 0x01 }; enum cyrusdb_dbflags { CYRUSDB_NOSYNC = 0x01 /* durability not a concern */ }; enum cyrusdb_openflags { CYRUSDB_CREATE = 0x01, /* Create the database if not existant */ CYRUSDB_MBOXSORT = 0x02 /* Use mailbox sort order ('.' sorts 1st) */ }; typedef int foreach_p(void *rock, const char *key, int keylen, const char *data, int datalen); typedef int foreach_cb(void *rock, const char *key, int keylen, const char *data, int datalen); struct cyrusdb_backend { const char *name; /* init() should be called once per process; no calls are legal * until init() returns */ int (*init)(const char *dbdir, int myflags); /* done() should be called once per process; no calls are legal * once done() starts. it is legal to call init() after done() returns * to reset state */ int (*done)(void); /* checkpoints this database environment */ int (*sync)(void); /* archives this database environment, and specified databases * into the specified directory */ int (*archive)(const char **fnames, const char *dirname); /* open the specified database in the global environment */ int (*open)(const char *fname, int flags, struct db **ret); /* close the specified database */ int (*close)(struct db *db); /* what are the overall specifications? */ /* 'mydb': the database to act on 'key': the key to fetch. cyrusdb currently requires this to not have any of [\t\n\0] in keys 'keylen': length of the key 'data': where to put the data (generally won't have [\n\0]) 'datalen': how big is the data? 'mytid': may be NULL, in which case the fetch is not txn protected. if mytid != NULL && *mytid == NULL, begins a new txn if mytid != NULL && *mytid != NULL, continues an old txn transactions may lock the entire database on some backends. beware fetchlock() is identical to fetch() except gives a hint to the underlying database that the key/data being fetched will be modified soon. it is useless to use fetchlock() without a non-NULL mytid */ int (*fetch)(struct db *mydb, const char *key, int keylen, const char **data, int *datalen, struct txn **mytid); int (*fetchlock)(struct db *mydb, const char *key, int keylen, const char **data, int *datalen, struct txn **mytid); /* foreach: iterate through entries that start with 'prefix' if 'p' is NULL (always true) or returns true, call 'cb' if 'cb' changes the database, these changes will only be visible if they are after the current database cursor. If other processes change the database (i.e. outside of a transaction) these changes may or may not be visible to the foreach() 'p' should be fast and should avoid blocking it should be safe to call other db routines inside of 'cb'. however, the "flat" backend is currently are not reentrant in this way unless you're using transactions and pass the same transaction to all db calls during the life of foreach() */ int (*foreach)(struct db *mydb, char *prefix, int prefixlen, foreach_p *p, foreach_cb *cb, void *rock, struct txn **tid); /* Place entries in database create will not overwrite existing * entries */ int (*create)(struct db *db, const char *key, int keylen, const char *data, int datalen, struct txn **tid); int (*store)(struct db *db, const char *key, int keylen, const char *data, int datalen, struct txn **tid); /* Remove entrys from the database */ int (*delete)(struct db *db, const char *key, int keylen, struct txn **tid, int force); /* 1 = ignore not found errors */ /* Commit the transaction. When commit() returns, the tid will no longer * be valid, regardless of if the commit succeeded or failed */ int (*commit)(struct db *db, struct txn *tid); /* Abort the transaction and invalidate the tid */ int (*abort)(struct db *db, struct txn *tid); int (*dump)(struct db *db, int detail); int (*consistent)(struct db *db); }; extern struct cyrusdb_backend *cyrusdb_backends[]; /* Note that some of these may be undefined symbols * if libcyrus was not built with support for them */ extern struct cyrusdb_backend cyrusdb_berkeley; extern struct cyrusdb_backend cyrusdb_berkeley_nosync; extern struct cyrusdb_backend cyrusdb_berkeley_hash; extern struct cyrusdb_backend cyrusdb_berkeley_hash_nosync; extern struct cyrusdb_backend cyrusdb_flat; extern struct cyrusdb_backend cyrusdb_skiplist; extern struct cyrusdb_backend cyrusdb_quotalegacy; extern struct cyrusdb_backend cyrusdb_sql; extern int cyrusdb_copyfile(const char *srcname, const char *dstname); extern void cyrusdb_convert(const char *fromfname, const char *tofname, struct cyrusdb_backend *frombackend, struct cyrusdb_backend *tobackend); extern const char *cyrusdb_detect(const char *fname); /* Start/Stop the backends */ void cyrusdb_init(); void cyrusdb_done(); /* Configuration */ struct cyrusdb_backend *cyrusdb_fromname(const char *name); #endif /* INCLUDED_CYRUSDB_H */ 070701000a2e6d000081a40000000000000000000000015126e87d00000c8d000000b500010002ffffffffffffffff0000002700000000root/usr/local/include/cyrus/imapurl.h/* * Copyright (c) 1994-2008 Carnegie Mellon University. All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in * the documentation and/or other materials provided with the * distribution. * * 3. The name "Carnegie Mellon University" must not be used to * endorse or promote products derived from this software without * prior written permission. For permission or any legal * details, please contact * Carnegie Mellon University * Center for Technology Transfer and Enterprise Creation * 4615 Forbes Avenue * Suite 302 * Pittsburgh, PA 15213 * (412) 268-7393, fax: (412) 268-7395 * innovation@andrew.cmu.edu * * 4. Redistributions of any form whatsoever must retain the following * acknowledgment: * "This product includes software developed by Computing Services * at Carnegie Mellon University (http://www.cmu.edu/computing/)." * * CARNEGIE MELLON UNIVERSITY DISCLAIMS ALL WARRANTIES WITH REGARD TO * THIS SOFTWARE, INCLUDING ALL IMPLIED WARRANTIES OF MERCHANTABILITY * AND FITNESS, IN NO EVENT SHALL CARNEGIE MELLON UNIVERSITY BE LIABLE * FOR ANY SPECIAL, INDIRECT OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES * WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN * AN ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING * OUT OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. * * $Id: imapurl.h,v 1.9 2010/01/06 17:01:45 murch Exp $ */ #ifndef IMAPURL_H #define IMAPURL_H struct imapurl { char *freeme; /* copy of original URL + decoded mailbox; caller must free() */ /* RFC 2192 */ const char *user; const char *auth; const char *server; const char *mailbox; unsigned long uidvalidity; unsigned long uid; const char *section; /* RFC 2192bis */ unsigned long start_octet; unsigned long octet_count; /* URLAUTH */ struct { const char *access; const char *mech; const char *token; time_t expire; size_t rump_len; } urlauth; }; /* Convert hex coded UTF-8 URL path to modified UTF-7 IMAP mailbox * mailbox should be about twice the length of src to deal with non-hex * coded URLs; server should be as large as src. */ int imapurl_fromURL(struct imapurl *url, const char *src); int URLtoMailbox(char *dst, const char *src); #define UTF8_to_mUTF7(dst, src) URLtoMailbox(dst, src) /* Convert an IMAP mailbox to a URL path * dst needs to have roughly 4 times the storage space of mailbox * Hex encoding can triple the size of the input * UTF-7 can be slightly denser than UTF-8 * (worst case: 8 octets UTF-7 becomes 9 octets UTF-8) * * it is valid for mechname to be NULL (implies anonymous mech) */ void imapurl_toURL(char *dst, struct imapurl *url); #endif /* IMAPURL_H */ 070701000a2e7f000081a40000000000000000000000015126e87d00000898000000b500010002ffffffffffffffff0000002700000000root/usr/local/include/cyrus/strhash.h/* strhash.h string hashing * * Copyright (c) 1994-2008 Carnegie Mellon University. All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in * the documentation and/or other materials provided with the * distribution. * * 3. The name "Carnegie Mellon University" must not be used to * endorse or promote products derived from this software without * prior written permission. For permission or any legal * details, please contact * Carnegie Mellon University * Center for Technology Transfer and Enterprise Creation * 4615 Forbes Avenue * Suite 302 * Pittsburgh, PA 15213 * (412) 268-7393, fax: (412) 268-7395 * innovation@andrew.cmu.edu * * 4. Redistributions of any form whatsoever must retain the following * acknowledgment: * "This product includes software developed by Computing Services * at Carnegie Mellon University (http://www.cmu.edu/computing/)." * * CARNEGIE MELLON UNIVERSITY DISCLAIMS ALL WARRANTIES WITH REGARD TO * THIS SOFTWARE, INCLUDING ALL IMPLIED WARRANTIES OF MERCHANTABILITY * AND FITNESS, IN NO EVENT SHALL CARNEGIE MELLON UNIVERSITY BE LIABLE * FOR ANY SPECIAL, INDIRECT OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES * WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN * AN ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING * OUT OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. * * $Id: strhash.h,v 1.4 2010/01/06 17:01:47 murch Exp $ */ #ifndef _STRHASH_H_ #ifdef HAVE_UNISTD_H #include #endif #include #include #include #include #include #include #include #include unsigned strhash(const char *string); #endif /* _STRHASH_H_ */ 070701000a2e7e000081a40000000000000000000000015126e87d00000f66000000b500010002ffffffffffffffff0000002800000000root/usr/local/include/cyrus/strarray.h/* strarray.h -- an expanding array of strings * * Copyright (c) 1994-2011 Carnegie Mellon University. All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in * the documentation and/or other materials provided with the * distribution. * * 3. The name "Carnegie Mellon University" must not be used to * endorse or promote products derived from this software without * prior written permission. For permission or any legal * details, please contact * Carnegie Mellon University * Center for Technology Transfer and Enterprise Creation * 4615 Forbes Avenue * Suite 302 * Pittsburgh, PA 15213 * (412) 268-7393, fax: (412) 268-7395 * innovation@andrew.cmu.edu * * 4. Redistributions of any form whatsoever must retain the following * acknowledgment: * "This product includes software developed by Computing Services * at Carnegie Mellon University (http://www.cmu.edu/computing/)." * * CARNEGIE MELLON UNIVERSITY DISCLAIMS ALL WARRANTIES WITH REGARD TO * THIS SOFTWARE, INCLUDING ALL IMPLIED WARRANTIES OF MERCHANTABILITY * AND FITNESS, IN NO EVENT SHALL CARNEGIE MELLON UNIVERSITY BE LIABLE * FOR ANY SPECIAL, INDIRECT OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES * WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN * AN ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING * OUT OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. * * Author: Greg Banks * Start Date: 2011/01/11 */ #ifndef __CYRUS_STRARRAY_H__ #define __CYRUS_STRARRAY_H__ #include #include typedef struct { int count; int alloc; char **data; } strarray_t; #define STRARRAY_INITIALIZER { 0, 0, NULL } #define strarray_init(sa) (memset((sa), 0, sizeof(strarray_t))) void strarray_fini(strarray_t *); strarray_t *strarray_new(void); void strarray_free(strarray_t *); int strarray_append(strarray_t *, const char *); int strarray_add(strarray_t *, const char *); int strarray_add_case(strarray_t *, const char *); int strarray_appendm(strarray_t *, char *); void strarray_set(strarray_t *, int idx, const char *); void strarray_setm(strarray_t *, int idx, char *); void strarray_insert(strarray_t *, int idx, const char *); void strarray_insertm(strarray_t *, int idx, char *); char *strarray_remove(strarray_t *, int idx); void strarray_remove_all(strarray_t *sa, const char *s); void strarray_remove_all_case(strarray_t *sa, const char *s); const char *strarray_nth(const strarray_t *sa, int idx); void strarray_truncate(strarray_t *sa, int newlen); strarray_t *strarray_dup(const strarray_t *); #define strarray_shift(sa) strarray_remove((sa), 0) #define strarray_unshift(sa, s) strarray_insert((sa), 0, (s)) #define strarray_unshiftm(sa, s) strarray_insertm((sa), 0, (s)) #define strarray_pop(sa) strarray_remove((sa), -1) #define strarray_push(sa, s) strarray_append((sa), (s)) #define strarray_pushm(sa, s) strarray_appendm((sa), (s)) char *strarray_join(const strarray_t *, const char *sep); strarray_t *strarray_splitm(char *buf, const char *sep); strarray_t *strarray_split(const char *buf, const char *sep); strarray_t *strarray_nsplit(const char *buf, size_t len, const char *sep); void strarray_sort(strarray_t *); char **strarray_takevf(strarray_t *sa); int strarray_find(const strarray_t *sa, const char *match, int starting); int strarray_find_case(const strarray_t *sa, const char *match, int starting); #endif /* __CYRUS_STRARRAY_H__ */ 070701000a2e7c000081a40000000000000000000000015126e87d0000083c000000b500010002ffffffffffffffff0000002a00000000root/usr/local/include/cyrus/rfc822date.h/* rfc822date.h -- Generate an 822 date * * Copyright (c) 1994-2008 Carnegie Mellon University. All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in * the documentation and/or other materials provided with the * distribution. * * 3. The name "Carnegie Mellon University" must not be used to * endorse or promote products derived from this software without * prior written permission. For permission or any legal * details, please contact * Carnegie Mellon University * Center for Technology Transfer and Enterprise Creation * 4615 Forbes Avenue * Suite 302 * Pittsburgh, PA 15213 * (412) 268-7393, fax: (412) 268-7395 * innovation@andrew.cmu.edu * * 4. Redistributions of any form whatsoever must retain the following * acknowledgment: * "This product includes software developed by Computing Services * at Carnegie Mellon University (http://www.cmu.edu/computing/)." * * CARNEGIE MELLON UNIVERSITY DISCLAIMS ALL WARRANTIES WITH REGARD TO * THIS SOFTWARE, INCLUDING ALL IMPLIED WARRANTIES OF MERCHANTABILITY * AND FITNESS, IN NO EVENT SHALL CARNEGIE MELLON UNIVERSITY BE LIABLE * FOR ANY SPECIAL, INDIRECT OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES * WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN * AN ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING * OUT OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. * * $Id: rfc822date.h,v 1.5 2010/01/06 17:01:47 murch Exp $ */ #ifndef INCLUDED_RFC822DATE_H #define INCLUDED_RFC822DATE_H #include /* 'buf' must be at least 80 characters */ void rfc822date_gen(char *buf, size_t len, time_t t); #endif 070701000a2e66000081a40000000000000000000000015126e87d00000165000000b500010002ffffffffffffffff0000002500000000root/usr/local/include/cyrus/crc32.h/* crc32.h */ #ifndef CRC32_H #define CRC32_H #include "util.h" #include #ifdef HAVE_STDINT_H # include #else # include #endif uint32_t crc32_map(const char *base, unsigned len); uint32_t crc32_buf(struct buf *buf); uint32_t crc32_cstring(const char *buf); uint32_t crc32_iovec(struct iovec *iov, int iovcnt); #endif 070701000a2e77000081a40000000000000000000000015126e87d00000a67000000b500010002ffffffffffffffff0000002500000000root/usr/local/include/cyrus/mpool.h/* mpool.h memory pool management * * Copyright (c) 1994-2008 Carnegie Mellon University. All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in * the documentation and/or other materials provided with the * distribution. * * 3. The name "Carnegie Mellon University" must not be used to * endorse or promote products derived from this software without * prior written permission. For permission or any legal * details, please contact * Carnegie Mellon University * Center for Technology Transfer and Enterprise Creation * 4615 Forbes Avenue * Suite 302 * Pittsburgh, PA 15213 * (412) 268-7393, fax: (412) 268-7395 * innovation@andrew.cmu.edu * * 4. Redistributions of any form whatsoever must retain the following * acknowledgment: * "This product includes software developed by Computing Services * at Carnegie Mellon University (http://www.cmu.edu/computing/)." * * CARNEGIE MELLON UNIVERSITY DISCLAIMS ALL WARRANTIES WITH REGARD TO * THIS SOFTWARE, INCLUDING ALL IMPLIED WARRANTIES OF MERCHANTABILITY * AND FITNESS, IN NO EVENT SHALL CARNEGIE MELLON UNIVERSITY BE LIABLE * FOR ANY SPECIAL, INDIRECT OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES * WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN * AN ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING * OUT OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. * * $Id: mpool.h,v 1.14 2010/01/06 17:01:46 murch Exp $ */ #ifndef _MPOOL_H_ #ifdef HAVE_UNISTD_H #include #endif #include #include #include #include #include #include #include #include /* Opaque mpool handle */ struct mpool; #define DEFAULT_MPOOL_SIZE 32768 /* Create a new pool -- pass zero for default */ /* 'size' is the size of the first blob of memory that will be allocated */ struct mpool *new_mpool(size_t size); /* Free a pool */ void free_mpool(struct mpool *pool); /* Allocate from a pool */ void *mpool_malloc(struct mpool *pool, size_t size); char *mpool_strdup(struct mpool *pool, const char *str); char *mpool_strndup(struct mpool *pool, const char *str, size_t n); #endif /* _MPOOL_H_ */ 070701000a2e65000081a40000000000000000000000015126e87d00001628000000b500010002ffffffffffffffff0000002700000000root/usr/local/include/cyrus/charset.h/* * Copyright (c) 1994-2008 Carnegie Mellon University. All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in * the documentation and/or other materials provided with the * distribution. * * 3. The name "Carnegie Mellon University" must not be used to * endorse or promote products derived from this software without * prior written permission. For permission or any legal * details, please contact * Carnegie Mellon University * Center for Technology Transfer and Enterprise Creation * 4615 Forbes Avenue * Suite 302 * Pittsburgh, PA 15213 * (412) 268-7393, fax: (412) 268-7395 * innovation@andrew.cmu.edu * * 4. Redistributions of any form whatsoever must retain the following * acknowledgment: * "This product includes software developed by Computing Services * at Carnegie Mellon University (http://www.cmu.edu/computing/)." * * CARNEGIE MELLON UNIVERSITY DISCLAIMS ALL WARRANTIES WITH REGARD TO * THIS SOFTWARE, INCLUDING ALL IMPLIED WARRANTIES OF MERCHANTABILITY * AND FITNESS, IN NO EVENT SHALL CARNEGIE MELLON UNIVERSITY BE LIABLE * FOR ANY SPECIAL, INDIRECT OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES * WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN * AN ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING * OUT OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. * * $Id: charset.h,v 1.24 2010/01/06 17:01:44 murch Exp $ */ #ifndef INCLUDED_CHARSET_H #define INCLUDED_CHARSET_H #define ENCODING_NONE 0 #define ENCODING_QP 1 #define ENCODING_BASE64 2 #define ENCODING_UNKNOWN 255 #define CHARSET_UNKNOWN_CHARSET (-1) typedef int comp_pat; typedef int charset_index; /* ensure up to MAXTRANSLATION times expansion into buf */ extern char *charset_convert(const char *s, charset_index charset, char *buf, size_t bufsz); extern char *charset_decode_mimeheader(const char *s, char *buf, size_t bufsz); extern char *charset_parse_mimeheader(const char *s); extern charset_index charset_lookupname(const char *name); extern comp_pat *charset_compilepat(const char *s); extern void charset_freepat(comp_pat *pat); extern int charset_searchstring(const char *substr, comp_pat *pat, const char *s, size_t len); extern int charset_searchfile(const char *substr, comp_pat *pat, const char *msg_base, size_t len, charset_index charset, int encoding); extern char *charset_decode_mimebody(const char *msg_base, size_t len, int encoding, char **retval, size_t alloced, size_t *outlen); extern char *charset_encode_mimebody(const char *msg_base, size_t len, char *retval, size_t *outlen, int *outlines); extern char *charset_to_utf8(const char *msg_base, size_t len, charset_index charset, int encoding); extern int charset_search_mimeheader(const char *substr, comp_pat *pat, const char *s, int searchform); /* Definitions for charset_extractfile */ /* These constants are passed into the index_search_text_receiver_t callback to tell it which part of the message is being sent down */ #define SEARCHINDEX_PART_FROM 1 #define SEARCHINDEX_PART_TO 2 #define SEARCHINDEX_PART_CC 3 #define SEARCHINDEX_PART_BCC 4 #define SEARCHINDEX_PART_SUBJECT 5 #define SEARCHINDEX_PART_HEADERS 6 /* headers OTHER than the above headers */ #define SEARCHINDEX_PART_BODY 7 /* These constants tell the index_search_text_receiver_t callback what is happening. */ #define SEARCHINDEX_CMD_BEGINPART 0x01 /* starting a new part */ #define SEARCHINDEX_CMD_APPENDPART 0x02 /* recording some text that belongs to the part */ #define SEARCHINDEX_CMD_ENDPART 0x04 /* done with the part */ #define SEARCHINDEX_CMD_STUFFPART 0x07 /* All of the above in one invocation */ /* This function gets called at least once for each part of every message. The invocations form a sequence: CMD_BEGINPART CMD_APPENDPART (1 or more times) CMD_ENDPART ... CMD_BEGINPART CMD_APPENDPART (1 or more times) CMD_ENDPART BEGIN, APPEND and/or END operations on the same part may be combined into one call by ORing the 'cmds' flags. The parts need not arrive in any particular order, but each part can only participate in one BEGIN ... APPEND ... END sequence, and the sequences for different parts cannot be interleaved. */ typedef void index_search_text_receiver_t(int UID, int part, int cmds, char const* text, int text_len, void* rock); /* Extract the body text for the message denoted by 'uid', convert its text to the canonical form for searching, and pass the converted text down in a series of invocations to the callback function with part=SEARCHINDEX_PART_BODY and cmds=CMD_APPENDPART. This is called by index_getsearchtextmsg to extract the MIME body parts. */ extern int charset_extractfile(index_search_text_receiver_t receiver, void* rock, int uid, const char *msg_base, size_t len, charset_index charset, int encoding); #endif /* INCLUDED_CHARSET_H */ 070701000a2e7b000081a40000000000000000000000015126e87d00000a7c000000b500010002ffffffffffffffff0000002500000000root/usr/local/include/cyrus/retry.h/* retry.h -- Keep retrying write system calls * * Copyright (c) 1994-2008 Carnegie Mellon University. All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in * the documentation and/or other materials provided with the * distribution. * * 3. The name "Carnegie Mellon University" must not be used to * endorse or promote products derived from this software without * prior written permission. For permission or any legal * details, please contact * Carnegie Mellon University * Center for Technology Transfer and Enterprise Creation * 4615 Forbes Avenue * Suite 302 * Pittsburgh, PA 15213 * (412) 268-7393, fax: (412) 268-7395 * innovation@andrew.cmu.edu * * 4. Redistributions of any form whatsoever must retain the following * acknowledgment: * "This product includes software developed by Computing Services * at Carnegie Mellon University (http://www.cmu.edu/computing/)." * * CARNEGIE MELLON UNIVERSITY DISCLAIMS ALL WARRANTIES WITH REGARD TO * THIS SOFTWARE, INCLUDING ALL IMPLIED WARRANTIES OF MERCHANTABILITY * AND FITNESS, IN NO EVENT SHALL CARNEGIE MELLON UNIVERSITY BE LIABLE * FOR ANY SPECIAL, INDIRECT OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES * WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN * AN ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING * OUT OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. * * $Id: retry.h,v 1.15 2010/01/06 17:01:47 murch Exp $ */ #ifndef INCLUDED_RETRY_H #define INCLUDED_RETRY_H #ifndef P #ifdef __STDC__ #define P(x) x #else #define P(x) () #endif #endif #include #include "xmalloc.h" extern int retry_read P((int fd, void *buf, size_t nbyte)); extern int retry_write P((int fd, const void *buf, size_t nbyte)); extern int retry_writev P((int fd, struct iovec *iov, int iovcnt)); /* add a buffer 's' of length 'len' to iovec 'iov' */ #define WRITEV_ADD_TO_IOVEC(iov, num_iov, s, len) \ do { (iov)[(num_iov)].iov_base = (s); \ (iov)[(num_iov)++].iov_len = (len); } while (0) /* add a string 's' to iovec 'iov' */ #define WRITEV_ADDSTR_TO_IOVEC(iov, num_iov, s) WRITEV_ADD_TO_IOVEC(iov, num_iov, s, strlen(s)) #endif /* INCLUDED_RETRY_H */ 070701000a2e79000081a40000000000000000000000015126e87d0000094d000000b500010002ffffffffffffffff0000002900000000root/usr/local/include/cyrus/parseaddr.h/* parseaddr.h -- RFC 822 address parser * * Copyright (c) 1994-2008 Carnegie Mellon University. All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in * the documentation and/or other materials provided with the * distribution. * * 3. The name "Carnegie Mellon University" must not be used to * endorse or promote products derived from this software without * prior written permission. For permission or any legal * details, please contact * Carnegie Mellon University * Center for Technology Transfer and Enterprise Creation * 4615 Forbes Avenue * Suite 302 * Pittsburgh, PA 15213 * (412) 268-7393, fax: (412) 268-7395 * innovation@andrew.cmu.edu * * 4. Redistributions of any form whatsoever must retain the following * acknowledgment: * "This product includes software developed by Computing Services * at Carnegie Mellon University (http://www.cmu.edu/computing/)." * * CARNEGIE MELLON UNIVERSITY DISCLAIMS ALL WARRANTIES WITH REGARD TO * THIS SOFTWARE, INCLUDING ALL IMPLIED WARRANTIES OF MERCHANTABILITY * AND FITNESS, IN NO EVENT SHALL CARNEGIE MELLON UNIVERSITY BE LIABLE * FOR ANY SPECIAL, INDIRECT OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES * WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN * AN ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING * OUT OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. * * $Id: parseaddr.h,v 1.10 2010/01/06 17:01:47 murch Exp $ */ #ifndef INCLUDED_PARSEADDR_H #define INCLUDED_PARSEADDR_H #ifndef P #ifdef __STDC__ #define P(x) x #else #define P(x) () #endif #endif struct address { char *name; char *route; char *mailbox; char *domain; struct address *next; char *freeme; /* If non-nil, free */ }; extern void parseaddr_list P((const char *s, struct address **addrp)); extern void parseaddr_free P((struct address *addr)); #endif /* INCLUDED_PARSEADDR_H */ 070701000a2e71000081a40000000000000000000000015126e87d00000e10000000b500010002ffffffffffffffff0000002900000000root/usr/local/include/cyrus/libconfig.h/* libconfig.h -- Header for imapd.conf processing * * Copyright (c) 1994-2008 Carnegie Mellon University. All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in * the documentation and/or other materials provided with the * distribution. * * 3. The name "Carnegie Mellon University" must not be used to * endorse or promote products derived from this software without * prior written permission. For permission or any legal * details, please contact * Carnegie Mellon University * Center for Technology Transfer and Enterprise Creation * 4615 Forbes Avenue * Suite 302 * Pittsburgh, PA 15213 * (412) 268-7393, fax: (412) 268-7395 * innovation@andrew.cmu.edu * * 4. Redistributions of any form whatsoever must retain the following * acknowledgment: * "This product includes software developed by Computing Services * at Carnegie Mellon University (http://www.cmu.edu/computing/)." * * CARNEGIE MELLON UNIVERSITY DISCLAIMS ALL WARRANTIES WITH REGARD TO * THIS SOFTWARE, INCLUDING ALL IMPLIED WARRANTIES OF MERCHANTABILITY * AND FITNESS, IN NO EVENT SHALL CARNEGIE MELLON UNIVERSITY BE LIABLE * FOR ANY SPECIAL, INDIRECT OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES * WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN * AN ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING * OUT OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. * * $Id: libconfig.h,v 1.11 2010/04/19 19:54:26 murch Exp $ */ #ifndef INCLUDED_LIBCONFIG_H #define INCLUDED_LIBCONFIG_H #include "exitcodes.h" #include "imapopts.h" /* these will assert() if they're called on the wrong type of option (imapopts.c) */ extern void config_read(const char *alt_config); extern const char *config_getstring(enum imapopt opt); extern int config_getint(enum imapopt opt); extern int config_getswitch(enum imapopt opt); extern enum enum_value config_getenum(enum imapopt opt); extern unsigned long config_getbitfield(enum imapopt opt); /* these work on additional strings that are not defined in the * imapoptions table */ extern const char *config_getoverflowstring(const char *key, const char *def); extern void config_foreachoverflowstring( void (*func)(const char *, const char *, void *), void *rock); extern const char *config_partitiondir(const char *partition); extern const char *config_metapartitiondir(const char *partition); /* cached configuration variables accessable to external world */ extern const char *config_filename; extern const char *config_dir; extern const char *config_defpartition; extern const char *config_servername; extern enum enum_value config_serverinfo; extern const char *config_mupdate_server; extern const char *config_defdomain; extern const char *config_ident; extern int config_hashimapspool; extern int config_implicitrights; extern enum enum_value config_virtdomains; extern enum enum_value config_mupdate_config; extern int config_auditlog; extern unsigned config_maxquoted; extern unsigned config_maxword; extern int config_qosmarking; /* config requirement flags */ #define CONFIG_NEED_PARTITION_DATA (1<<0) #endif /* INCLUDED_LIBCONFIG_H */ 070701000a2e70000081a40000000000000000000000015126e87d00000874000000b500010002ffffffffffffffff0000002a00000000root/usr/local/include/cyrus/iptostring.h/* * Copyright (c) 1994-2008 Carnegie Mellon University. All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in * the documentation and/or other materials provided with the * distribution. * * 3. The name "Carnegie Mellon University" must not be used to * endorse or promote products derived from this software without * prior written permission. For permission or any legal * details, please contact * Carnegie Mellon University * Center for Technology Transfer and Enterprise Creation * 4615 Forbes Avenue * Suite 302 * Pittsburgh, PA 15213 * (412) 268-7393, fax: (412) 268-7395 * innovation@andrew.cmu.edu * * 4. Redistributions of any form whatsoever must retain the following * acknowledgment: * "This product includes software developed by Computing Services * at Carnegie Mellon University (http://www.cmu.edu/computing/)." * * CARNEGIE MELLON UNIVERSITY DISCLAIMS ALL WARRANTIES WITH REGARD TO * THIS SOFTWARE, INCLUDING ALL IMPLIED WARRANTIES OF MERCHANTABILITY * AND FITNESS, IN NO EVENT SHALL CARNEGIE MELLON UNIVERSITY BE LIABLE * FOR ANY SPECIAL, INDIRECT OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES * WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN * AN ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING * OUT OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. * * $Id: iptostring.h,v 1.5 2010/01/06 17:01:45 murch Exp $ */ #ifndef IPTOSTRING_H #define IPTOSTRING_H #include #include #include #include #include int iptostring(const struct sockaddr *addr, socklen_t addrlen, char *out, unsigned outlen); #endif /* IPTOSTRING_H */ 070701000a2e7d000081a40000000000000000000000015126e87d00000879000000b500010002ffffffffffffffff0000002700000000root/usr/local/include/cyrus/signals.h/* signals.h -- signal handling functions to allow clean shutdown * * Copyright (c) 1994-2008 Carnegie Mellon University. All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in * the documentation and/or other materials provided with the * distribution. * * 3. The name "Carnegie Mellon University" must not be used to * endorse or promote products derived from this software without * prior written permission. For permission or any legal * details, please contact * Carnegie Mellon University * Center for Technology Transfer and Enterprise Creation * 4615 Forbes Avenue * Suite 302 * Pittsburgh, PA 15213 * (412) 268-7393, fax: (412) 268-7395 * innovation@andrew.cmu.edu * * 4. Redistributions of any form whatsoever must retain the following * acknowledgment: * "This product includes software developed by Computing Services * at Carnegie Mellon University (http://www.cmu.edu/computing/)." * * CARNEGIE MELLON UNIVERSITY DISCLAIMS ALL WARRANTIES WITH REGARD TO * THIS SOFTWARE, INCLUDING ALL IMPLIED WARRANTIES OF MERCHANTABILITY * AND FITNESS, IN NO EVENT SHALL CARNEGIE MELLON UNIVERSITY BE LIABLE * FOR ANY SPECIAL, INDIRECT OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES * WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN * AN ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING * OUT OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. * * $Id: signals.h,v 1.3 2008/03/24 17:09:19 murch Exp $ */ #ifndef INCLUDED_SIGNALS_H #define INCLUDED_SIGNALS_H typedef void shutdownfn(int); void signals_add_handlers(int alarm); void signals_set_shutdown(shutdownfn *s); int signals_poll(void); #endif /* INCLUDED_SIGNALS_H */ 070701000a2e72000081a40000000000000000000000015126e87d000012eb000000b500010002ffffffffffffffff0000002a00000000root/usr/local/include/cyrus/libcyr_cfg.h/* libcyr_cfg.h -- configuration interface to libcyrus * * Copyright (c) 1994-2008 Carnegie Mellon University. All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in * the documentation and/or other materials provided with the * distribution. * * 3. The name "Carnegie Mellon University" must not be used to * endorse or promote products derived from this software without * prior written permission. For permission or any legal * details, please contact * Carnegie Mellon University * Center for Technology Transfer and Enterprise Creation * 4615 Forbes Avenue * Suite 302 * Pittsburgh, PA 15213 * (412) 268-7393, fax: (412) 268-7395 * innovation@andrew.cmu.edu * * 4. Redistributions of any form whatsoever must retain the following * acknowledgment: * "This product includes software developed by Computing Services * at Carnegie Mellon University (http://www.cmu.edu/computing/)." * * CARNEGIE MELLON UNIVERSITY DISCLAIMS ALL WARRANTIES WITH REGARD TO * THIS SOFTWARE, INCLUDING ALL IMPLIED WARRANTIES OF MERCHANTABILITY * AND FITNESS, IN NO EVENT SHALL CARNEGIE MELLON UNIVERSITY BE LIABLE * FOR ANY SPECIAL, INDIRECT OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES * WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN * AN ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING * OUT OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. * * $Id: libcyr_cfg.h,v 1.14 2010/01/06 17:01:46 murch Exp $ */ #ifndef INCLUDED_LIBCYR_CFG_H #define INCLUDED_LIBCYR_CFG_H #include #include #include #include #include #include #include /* This is basically a simplified version of the configuration system * that is used for the application level of Cyrus IMAPd */ enum cyrus_opttype { CYRUS_OPT_NOTOPT, CYRUS_OPT_STRING, CYRUS_OPT_INT, CYRUS_OPT_SWITCH }; enum cyrus_opt { CYRUSOPT_ZERO = 0, /* Use unix groups with auth_unix? (ON) */ CYRUSOPT_AUTH_UNIX_GROUP_ENABLE, /* Lowercase usernames? (OFF) */ CYRUSOPT_USERNAME_TOLOWER, /* Don't fsync() the skiplist backend (OFF) */ CYRUSOPT_SKIPLIST_UNSAFE, /* Temporary Storage Directory ("/tmp") */ CYRUSOPT_TEMP_PATH, /* PTS Cache Timeout */ CYRUSOPT_PTS_CACHE_TIMEOUT, /* IMAPd config directory */ CYRUSOPT_CONFIG_DIR, /* CyrusDB INIT flags */ CYRUSOPT_DB_INIT_FLAGS, /* Full directory hashing (OFF) */ CYRUSOPT_FULLDIRHASH, /* Database for use by AUTH_PTS */ CYRUSOPT_PTSCACHE_DB, /* Path to database for use by AUTH_PTS */ CYRUSOPT_PTSCACHE_DB_PATH, /* ptloader socket for use by AUTH_PTS */ CYRUSOPT_PTLOADER_SOCK, /* Virtual Domains (OFF) */ CYRUSOPT_VIRTDOMAINS, /* BDB cache size (512KB) */ CYRUSOPT_BERKELEY_CACHESIZE, /* authorization mechanism (unix) */ CYRUSOPT_AUTH_MECH, /* BDB max locks (50000) */ CYRUSOPT_BERKELEY_LOCKS_MAX, /* BDB max txns (100) */ CYRUSOPT_BERKELEY_TXNS_MAX, /* RFC 2086 right which allows DELETE ("c") */ CYRUSOPT_DELETERIGHT, /* SQL database */ CYRUSOPT_SQL_DATABASE, /* SQL engine ("mysql") */ CYRUSOPT_SQL_ENGINE, /* SQL hostname(s) ("") */ CYRUSOPT_SQL_HOSTNAMES, /* SQL username */ CYRUSOPT_SQL_USER, /* SQL password */ CYRUSOPT_SQL_PASSWD, /* Secure SQL connection (OFF) */ CYRUSOPT_SQL_USESSL, /* Checkpoint after every recovery (OFF) */ CYRUSOPT_SKIPLIST_ALWAYS_CHECKPOINT, CYRUSOPT_LAST }; union cyrus_config_value { const char *s; /* string */ long i; /* int */ long b; /* switch */ }; struct cyrusopt_s { const enum cyrus_opt opt; union cyrus_config_value val; const enum cyrus_opttype t; }; /* these will assert() if they're called on the wrong type of option (imapopt.c) */ extern const char *libcyrus_config_getstring(enum cyrus_opt opt); extern int libcyrus_config_getint(enum cyrus_opt opt); extern int libcyrus_config_getswitch(enum cyrus_opt opt); void libcyrus_config_setstring(enum cyrus_opt opt, const char *val); void libcyrus_config_setint(enum cyrus_opt opt, int val); void libcyrus_config_setswitch(enum cyrus_opt opt, int val); /* Start/Stop the Library */ /* Should be done AFTER setting configuration options */ void libcyrus_init(); void libcyrus_done(); #endif 070701000a2e86000041ed0000000000000000000000035126e8a100000000000000b500010002ffffffffffffffff0000001300000000root/usr/local/lib070701000a2e88000081a40000000000000000000000015126e87d0003558c000000b500010002ffffffffffffffff0000002200000000root/usr/local/lib/libcyrus_min.a! / 1361504347 0 0 0 2272 ` n $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $lDDDDDD%,%,%,%,%,It.<.<.<.<.<.U u"UjPtUDŽUDŽ4jP؋UEuUjPP t@tEUjjEPPhPjKPUd@0t<@nt-@ou@ft@fu!UDŽ@1t<@yt-@ou@nt@tuUDŽEUjjEPPh PjKPEUjjP U h0PtKh4Pt2h8Pth<PuDrhHPtKhLPt2hPPthTPu \*U u @@tT@u8@@t@tȋ@tB@U@tYPBPt;@tPBPuŋ@uJUjEPPPh`PjKPU u$UQzU u$UQ:UH JH@tT@t8@@t@uȋ@Q+$U w$}jPhPP ;t7jEPPhhPjKPM+EPRQ jEPjEPØx @`(08HPXhpxopt > IMAPOPT_ZERO && opt < IMAPOPT_LASTlibconfig.c(imapopts[opt].t == OPT_STRING) || (imapopts[opt].t == OPT_STRINGLIST)imapopts[opt].t == OPT_INTimapopts[opt].t == OPT_SWITCHimapopts[opt].t == OPT_ENUMimapopts[opt].t == OPT_BITFIELD%s_%skey too long in config_getoverflowstringpartition-metapartition-/etc/imapd.confcould not construct configuration hash tablecould not construct include file hash tableconfigdirectory option not specified in configuration file{configdirectory}defaultpartition option contains non-alphanumeric characterpartition-%s option not specified in configuration fileCYRUS_PREFIXrcan't open configuration file %s: %sconfiguration file %s included twiceinvalid option name on line %d of configuration file %sempty option value on line %d of configuration file@includeinvalid directive on line %d of configuration file %soption '%s' was specified twice in config file (second occurance on line %d)non-integer value for %s in line %dnon-switch value for %s in line %d1yesttrueon0noffalseoffinvalid value '%s' for %s in line %d@(#)time.h 2.77 09/06/02 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.16 09/07/02 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)syslog.h 1.11 96/05/17 SMI@(#)syslog.h 1.11 03/06/10 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)sysexits.h 1.7 00/05/01 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11as: Sun Compiler Common 12.2 SunOS_i386 2010/08/139libconfig.c /var/tmp/cyrus-imapd-2.4.17/lib /opt/solstudio12.2/prod/bin/cc -c -I.. -I/usr/local/include -I/usr/local/include -I/usr/local/mysql/include -I/usr/local/include -I/usr/local/include -I/usr/include/gssapi -I/usr/local/include -I/include -I/usr/local/include -I/usr/local/lib/include -DHAVE_CONFIG_H -g libconfig.c -W0,-xp.XAKgoyLahuJREc2.Xa;g;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;G=.XAKgoyLahuJREc2.;backend;raw;cd;DBG_GEN 5.3.0statx U&_pathr~_bufr intchar!unsigned long+dev_tlongH a H+ino_t+mode_t+nlink_tHuid_tHgid_tH HHoff_tHtime_t timespec tv_sec# tv_nsecH#timestruc_tHblksize_tHblkcnt_t< HH M H stat~ st_dev<# st_pad1P# st_inoa# st_modem# st_nlinkz# st_uid# st_gid# st_rdev<#$ st_pad2#( st_size#0 st_pad3H#4 st_atim#8 st_mtim#@ st_ctim#H st_blksize #P st_blocks#T st_fstype+#X st_pad4<#hMlstat@U_path~_buf fstat`U_fd~_buf mknodUUZ_pathm_mode <_devU_ config_filenamedH config_dirI config_defpartitionJ config_servernameK config_mupdate_server M3 config_defdomain8N] config_identbO config_getstringaVUopt`imapoptIMAPOPT_ZEROIMAPOPT_ADMINSIMAPOPT_AFSPTS_LOCALREALMSIMAPOPT_AFSPTS_MYCELLIMAPOPT_ALLOWALLSUBSCRIBEIMAPOPT_ALLOWANONYMOUSLOGINIMAPOPT_ALLOWAPOPIMAPOPT_ALLOWNEWNEWSIMAPOPT_ALLOWPLAINTEXTIMAPOPT_ALLOWUSERMOVES IMAPOPT_ALTNAMESPACE IMAPOPT_ANNOTATION_DB IMAPOPT_ANNOTATION_DB_PATH IMAPOPT_ANYONEUSERACL IMAPOPT_ANNOTATION_DEFINITIONSIMAPOPT_AUDITLOGIMAPOPT_AUTH_MECHIMAPOPT_AUTOCREATEQUOTAIMAPOPT_BERKELEY_CACHESIZEIMAPOPT_BERKELEY_LOCKS_MAXIMAPOPT_BERKELEY_TXNS_MAXIMAPOPT_BOUNDARY_LIMITIMAPOPT_CLIENT_TIMEOUTIMAPOPT_COMMANDMINTIMERIMAPOPT_CONFIGDIRECTORYIMAPOPT_DEBUG_COMMANDIMAPOPT_DEFAULTACLIMAPOPT_DEFAULTDOMAINIMAPOPT_DEFAULTPARTITIONIMAPOPT_DEFAULTSERVERIMAPOPT_DELETEDPREFIXIMAPOPT_DELETE_MODEIMAPOPT_DELETERIGHT IMAPOPT_DISABLE_USER_NAMESPACE!IMAPOPT_DISABLE_SHARED_NAMESPACE"IMAPOPT_DISCONNECT_ON_VANISHED_MAILBOX#IMAPOPT_DUPLICATE_DB$IMAPOPT_DUPLICATE_DB_PATH%IMAPOPT_DUPLICATESUPPRESSION&IMAPOPT_EXPUNGE_MODE'IMAPOPT_EXPUNGE_DAYS(IMAPOPT_FAILEDLOGINPAUSE)IMAPOPT_FLUSHSEENSTATE*IMAPOPT_FOOLSTUPIDCLIENTS+IMAPOPT_FORCE_SASL_CLIENT_MECH,IMAPOPT_FULLDIRHASH-IMAPOPT_HASHIMAPSPOOL.IMAPOPT_IDLESOCKET/IMAPOPT_IGNOREREFERENCE0IMAPOPT_IMAPIDLEPOLL1IMAPOPT_IMAPIDRESPONSE2IMAPOPT_IMAPMAGICPLUS3IMAPOPT_IMPLICIT_OWNER_RIGHTS4IMAPOPT_IMPROVED_MBOXLIST_SORT5IMAPOPT_INTERNALDATE_HEURISTIC6IMAPOPT_LDAP_AUTHZ7IMAPOPT_LDAP_BASE8IMAPOPT_LDAP_BIND_DN9IMAPOPT_LDAP_DEREF:IMAPOPT_LDAP_FILTER;IMAPOPT_LDAP_GROUP_BASE<IMAPOPT_LDAP_GROUP_FILTER=IMAPOPT_LDAP_GROUP_SCOPE>IMAPOPT_LDAP_ID?IMAPOPT_LDAP_MECHIMAPOPT_LDAP_MEMBER_ATTRIBUTEIMAPOPT_LDAP_MEMBER_BASEIMAPOPT_LDAP_MEMBER_FILTERIMAPOPT_LDAP_MEMBER_METHODIMAPOPT_LDAP_MEMBER_SCOPEIMAPOPT_LDAP_PASSWORDIMAPOPT_LDAP_REALMIMAPOPT_LDAP_REFERRALSIMAPOPT_LDAP_RESTARTIMAPOPT_LDAP_SASLIMAPOPT_LDAP_SASL_AUTHCIMAPOPT_LDAP_SASL_AUTHZIMAPOPT_LDAP_SASL_MECHIMAPOPT_LDAP_SASL_PASSWORDIMAPOPT_LDAP_SASL_REALMIMAPOPT_LDAP_SCOPEIMAPOPT_LDAP_SERVERSIMAPOPT_LDAP_SIZE_LIMITIMAPOPT_LDAP_START_TLSIMAPOPT_LDAP_TIME_LIMITIMAPOPT_LDAP_TIMEOUTIMAPOPT_LDAP_TLS_CACERT_DIRIMAPOPT_LDAP_TLS_CACERT_FILEIMAPOPT_LDAP_TLS_CERTIMAPOPT_LDAP_TLS_CHECK_PEERIMAPOPT_LDAP_TLS_CIPHERSIMAPOPT_LDAP_TLS_KEYIMAPOPT_LDAP_URIIMAPOPT_LDAP_VERSIONIMAPOPT_LMTP_DOWNCASE_RCPTIMAPOPT_LMTP_FUZZY_MAILBOX_MATCHIMAPOPT_LMTP_OVER_QUOTA_PERM_FAILUREIMAPOPT_LMTP_STRICT_QUOTAIMAPOPT_LMTP_STRICT_RFC2821IMAPOPT_LMTPSOCKETIMAPOPT_LMTPTXN_TIMEOUTIMAPOPT_LOGINREALMSIMAPOPT_LOGINUSEACLIMAPOPT_LOGTIMESTAMPSIMAPOPT_MAILBOX_DEFAULT_OPTIONSIMAPOPT_MAILNOTIFIERIMAPOPT_MAXHEADERLINESIMAPOPT_MAXMESSAGESIZEIMAPOPT_MAXQUOTEDIMAPOPT_MAXWORDIMAPOPT_MBOXKEY_DBIMAPOPT_MBOXLIST_DBIMAPOPT_MBOXLIST_DB_PATHIMAPOPT_MBOXNAME_LOCKPATHIMAPOPT_METAPARTITION_FILESIMAPOPT_MUPDATE_AUTHNAMEIMAPOPT_MUPDATE_CONFIGIMAPOPT_MUNGE8BITIMAPOPT_MUPDATE_CONNECTIONS_MAXIMAPOPT_MUPDATE_PASSWORDIMAPOPT_MUPDATE_PORTIMAPOPT_MUPDATE_REALMIMAPOPT_MUPDATE_RETRY_DELAYIMAPOPT_MUPDATE_SERVERIMAPOPT_MUPDATE_USERNAMEIMAPOPT_MUPDATE_WORKERS_MAXIMAPOPT_MUPDATE_WORKERS_MAXSPAREIMAPOPT_MUPDATE_WORKERS_MINSPAREIMAPOPT_MUPDATE_WORKERS_STARTIMAPOPT_NETSCAPEURLIMAPOPT_NEWSADDHEADERSIMAPOPT_NEWSGROUPSIMAPOPT_NEWSMASTERIMAPOPT_NEWSPEERIMAPOPT_NEWSPOSTUSERIMAPOPT_NEWSPREFIXIMAPOPT_NEWSRC_DB_PATHIMAPOPT_NNTPTIMEOUTIMAPOPT_NOTIFYSOCKETIMAPOPT_NOTIFY_EXTERNALIMAPOPT_PLAINTEXTLOGINPAUSEIMAPOPT_PLAINTEXTLOGINALERTIMAPOPT_POPEXPIRETIMEIMAPOPT_POPMINPOLLIMAPOPT_POPSUBFOLDERSIMAPOPT_POPPOLLPADDINGIMAPOPT_POPTIMEOUTIMAPOPT_POPUSEACLIMAPOPT_POPUSEIMAPFLAGSIMAPOPT_POSTMASTERIMAPOPT_POSTSPECIMAPOPT_POSTUSERIMAPOPT_PROC_PATHIMAPOPT_PROXY_AUTHNAMEIMAPOPT_PROXY_COMPRESSIMAPOPT_PROXY_PASSWORDIMAPOPT_PROXY_REALMIMAPOPT_PROXYD_ALLOW_STATUS_REFERRALIMAPOPT_PROXYD_DISABLE_MAILBOX_REFERRALSIMAPOPT_PROXYSERVERSIMAPOPT_PTS_MODULEIMAPOPT_PTLOADER_SOCKIMAPOPT_PTSCACHE_DBIMAPOPT_PTSCACHE_DB_PATHIMAPOPT_PTSCACHE_TIMEOUTIMAPOPT_PTSKRB5_CONVERT524IMAPOPT_PTSKRB5_STRIP_DEFAULT_REALMIMAPOPT_QOSMARKINGIMAPOPT_QUOTA_DBIMAPOPT_QUOTA_DB_PATHIMAPOPT_QUOTAWARNIMAPOPT_QUOTAWARNKBIMAPOPT_REJECT8BITIMAPOPT_RFC2046_STRICTIMAPOPT_RFC3028_STRICTIMAPOPT_SASL_MAXIMUM_LAYERIMAPOPT_SASL_MINIMUM_LAYERIMAPOPT_SEENSTATE_DBIMAPOPT_SENDMAILIMAPOPT_SERVERLISTIMAPOPT_SERVERNAMEIMAPOPT_SERVERINFOIMAPOPT_SHAREDPREFIXIMAPOPT_SIEVE_ALLOWREFERRALSIMAPOPT_SIEVE_EXTENSIONSIMAPOPT_SIEVE_MAXSCRIPTSIZEIMAPOPT_SIEVE_MAXSCRIPTSIMAPOPT_SIEVE_UTF8FILEINTOIMAPOPT_SIEVE_SASL_SEND_UNSOLICITED_CAPABILITYIMAPOPT_SIEVEDIRIMAPOPT_SIEVENOTIFIERIMAPOPT_SIEVEUSEHOMEDIRIMAPOPT_SINGLEINSTANCESTOREIMAPOPT_SKIPLIST_ALWAYS_CHECKPOINTIMAPOPT_SKIPLIST_UNSAFEIMAPOPT_SOFT_NOAUTHIMAPOPT_SPECIALUSEALWAYSIMAPOPT_SQL_DATABASEIMAPOPT_SQL_ENGINEIMAPOPT_SQL_HOSTNAMESIMAPOPT_SQL_PASSWDIMAPOPT_SQL_USERIMAPOPT_SQL_USESSLIMAPOPT_SRVTABIMAPOPT_SUBMITSERVERSIMAPOPT_SUBSCRIPTION_DBIMAPOPT_SUPPRESS_CAPABILITIESIMAPOPT_STATUSCACHEIMAPOPT_STATUSCACHE_DBIMAPOPT_STATUSCACHE_DB_PATHIMAPOPT_SYNC_AUTHNAMEIMAPOPT_SYNC_COMPRESSIMAPOPT_SYNC_HOSTIMAPOPT_SYNC_LOGIMAPOPT_SYNC_LOG_CHAINIMAPOPT_SYNC_LOG_CHANNELSIMAPOPT_SYNC_PASSWORDIMAPOPT_SYNC_PORTIMAPOPT_SYNC_REALMIMAPOPT_SYNC_REPEAT_INTERVALIMAPOPT_SYNC_SHUTDOWN_FILEIMAPOPT_SYSLOG_PREFIXIMAPOPT_TCP_KEEPALIVEIMAPOPT_TCP_KEEPALIVE_CNTIMAPOPT_TCP_KEEPALIVE_IDLEIMAPOPT_TCP_KEEPALIVE_INTVLIMAPOPT_TEMP_PATHIMAPOPT_TIMEOUTIMAPOPT_TLS_CA_FILEIMAPOPT_TLS_CA_PATHIMAPOPT_TLSCACHE_DBIMAPOPT_TLSCACHE_DB_PATHIMAPOPT_TLS_CERT_FILEIMAPOPT_TLS_CIPHER_LISTIMAPOPT_TLS_KEY_FILEIMAPOPT_TLS_REQUIRE_CERTIMAPOPT_TLS_SESSION_TIMEOUTIMAPOPT_UMASKIMAPOPT_USERDENY_DBIMAPOPT_USERDENY_DB_PATHIMAPOPT_USER_FOLDER_LIMITIMAPOPT_USERNAME_TOLOWERIMAPOPT_USERPREFIXIMAPOPT_UNIX_GROUP_ENABLEIMAPOPT_UNIXHIERARCHYSEPIMAPOPT_VIRTDOMAINSIMAPOPT_LAST config_getintj U opti config_getswitchxUY optw config_getenumnU  optenum_value'IMAP_ENUM_ZEROIMAP_ENUM_DELETE_MODE_IMMEDIATEIMAP_ENUM_DELETE_MODE_DELAYEDIMAP_ENUM_EXPUNGE_MODE_DEFAULTIMAP_ENUM_EXPUNGE_MODE_IMMEDIATEIMAP_ENUM_EXPUNGE_MODE_DELAYEDIMAP_ENUM_INTERNALDATE_HEURISTIC_STANDARDIMAP_ENUM_INTERNALDATE_HEURISTIC_RECEIVEDHEADERIMAP_ENUM_METAPARTITION_FILES_HEADERIMAP_ENUM_METAPARTITION_FILES_INDEXIMAP_ENUM_METAPARTITION_FILES_CACHEIMAP_ENUM_METAPARTITION_FILES_EXPUNGEIMAP_ENUM_METAPARTITION_FILES_SQUATIMAP_ENUM_MUPDATE_CONFIG_STANDARDIMAP_ENUM_MUPDATE_CONFIG_UNIFIEDIMAP_ENUM_MUPDATE_CONFIG_REPLICATEDIMAP_ENUM_NEWSADDHEADERS_TOIMAP_ENUM_NEWSADDHEADERS_REPLYTOIMAP_ENUM_QOSMARKING_CS0IMAP_ENUM_QOSMARKING_CS1IMAP_ENUM_QOSMARKING_CS2IMAP_ENUM_QOSMARKING_CS3IMAP_ENUM_QOSMARKING_CS4IMAP_ENUM_QOSMARKING_CS5IMAP_ENUM_QOSMARKING_CS6IMAP_ENUM_QOSMARKING_CS7IMAP_ENUM_QOSMARKING_AF11IMAP_ENUM_QOSMARKING_AF12 IMAP_ENUM_QOSMARKING_AF13 IMAP_ENUM_QOSMARKING_AF21 IMAP_ENUM_QOSMARKING_AF22 IMAP_ENUM_QOSMARKING_AF23 IMAP_ENUM_QOSMARKING_AF31IMAP_ENUM_QOSMARKING_AF32IMAP_ENUM_QOSMARKING_AF33IMAP_ENUM_QOSMARKING_AF41IMAP_ENUM_QOSMARKING_AF42IMAP_ENUM_QOSMARKING_AF43IMAP_ENUM_QOSMARKING_EFIMAP_ENUM_SERVERINFO_OFFIMAP_ENUM_SERVERINFO_MINIMAP_ENUM_SERVERINFO_ONIMAP_ENUM_SIEVE_EXTENSIONS_FILEINTOIMAP_ENUM_SIEVE_EXTENSIONS_REJECTIMAP_ENUM_SIEVE_EXTENSIONS_VACATIONIMAP_ENUM_SIEVE_EXTENSIONS_IMAPFLAGSIMAP_ENUM_SIEVE_EXTENSIONS_NOTIFYIMAP_ENUM_SIEVE_EXTENSIONS_INCLUDE IMAP_ENUM_SIEVE_EXTENSIONS_ENVELOPEIMAP_ENUM_SIEVE_EXTENSIONS_BODYIMAP_ENUM_SIEVE_EXTENSIONS_RELATIONALIMAP_ENUM_SIEVE_EXTENSIONS_REGEXIMAP_ENUM_SIEVE_EXTENSIONS_SUBADDRESSIMAP_ENUM_SIEVE_EXTENSIONS_COPYIMAP_ENUM_VIRTDOMAINS_OFFIMAP_ENUM_VIRTDOMAINS_USERIDIMAP_ENUM_VIRTDOMAINS_ON config_getbitfieldU+(opt config_getoverflowstringU(((key(def buf(ret(((((Hconfig_foreachoverflowstring7U ) )func)rock  )void) config_partitiondirUy)t))partitionbuf)t)~)P) HO config_metapartitiondirU))*partitionbuf*))P* HOconfig_ispartition0U**key*val )rockfound***unsigned char***Hqos*** Hqos*config_readb U),.,alt_configoptbuf3,p(ivalrrTrrrstrK,newstring(freeme( q  q  q found3),F,HF,config_read_filegU..filenamefinfile/hoptilinenojbuf(kerrbuf/kcyrus_path/lbufsize.mlen.mp(nq(nkey(nfullkey(nsrvkey(nval(nnewval(nservice_specificoidlenp B ]B ]!]//xvalH(ptr()e0L.*unsigned __FILE/ _cnt# _ptr.# _base.# _flag*# _file*# __orientation.# __ionolock.#  __seekable.#  __extendedfd.#  __xf_nocheck.#  __filler.#  .FILE //H// enum_option_s0 name/# val/#/0.size_t bucket _0 key(# data)# next_0#*0*0bucket d0q0mpool{0 hash_table 0 size0# tablev0# pool0#includehash0Econfighash0Elcase(1(1 fatal31131xstrdup(X181xrealloc)y1).xmalloc)1. config_qosmarkingV config_maxword.T config_maxquoted.U config_auditlogS config_mupdate_config R config_virtdomains Q config_hashimapspoolP config_serverinfo L02 free_hash_table2222 hash_enumerate222)2hash_lookup)-332-3hash_insert)`323)20hash_table `3construct_hash_tableq33q3.33 __assert333.3 H! 4 __sigbits3#3 4__posix_sigwait;44*__posix_ttyname_rj4(.__posix_getlogin_r4(gethostname4(tolower44strlcat054405strlcpy0754 5075A5strncasecmpt5<5F5.t5~5strcasecmp5y5555strncmp555.5strlen065strerror($6$6strcpy(M6()6M6W6strcmp6R6\66strcat(6(6memset)6).6(strtolH7667getenv($77 free87)"abortC7snprintft7(.H7#.fgets(7(t77sprintf7(7#7printf77#77fopen/877fclose88t7=8_xmknodq888B8++v8_lxstat8q8{8~8_xstat888~_fxstat98~H9__posix_ctime_r(499( tm$ 9 tm_sec# tm_min# tm_hour# tm_mday# tm_mon# tm_year# tm_wday# tm_yday# tm_isdst# 499$__posix_asctime_r(9(  /var/tmp/cyrus-imapd-2.4.17/lib/usr/include/sys/usr/include/usr/include/isolibconfig.cstat_impl.hstat.htypes.htime_impl.htime.himapopts.hstdio_impl.hstdio_iso.hhash.hselect.htime_iso.h &; F[ f  7 Q f  S   O i v   )3 LV         5 F^ h           . ?Fd x     OT       9 V ra$    - |X i s          ` q          " 3 H Z          & = Q Y m u        B X l           $. 5 ?   U  ~" 3 N   APq     @ S^ o    |     ~! / }    : E d     D Ur x / L   @ P     b   W h       h  &L ]}   DD%. : ; @ ' ID I: ;  $> &III: I  !I/  :  I8 4I?  : ;  .?  : ; @ ' ID  : ( 4I : ;  I !I/.?  : ; @ ' D ' D . : ; @ ' D I!I 4I : ; .?  : ;@ ' D I: ;  I8 < .? < ' ID I .? < ' D ! : ".? < ' D #$.? < ' ID N9iconfig_filenameconfig_dirconfig_defpartitionconfig_servernameconfig_mupdate_server=config_defdomaingconfig_identconfig_getstringconfig_getint config_getswitchY config_getenum'config_getbitfield(config_getoverflowstring(config_foreachoverflowstring)config_partitiondir)config_metapartitiondir*config_readP,config_read_file1config_qosmarking1config_maxword1config_maxquoted1config_auditlog2config_mupdate_config72config_virtdomainsY2config_hashimapspool}2config_serverinfoL9statlstatfstatmknod*config_ispartition/9<dev_taino_tmmode_tznlink_tuid_tgid_toff_ttime_ttimespectimestruc_t blksize_tblkcnt_tMstatimapopt enum_value.__FILE/FILE/enum_option_s0size_t*0bucketd0bucket0hash_table`3hash_table349tm=9*qos*qos0includehash0confighash  @ `(0      !):CL`Zkzp  ',@^@HP^hp02| p =  $,4J`q 18>DMY_hs{1QyJ{+05frw|).3b4#M$]$ct%&'()()#)(.+IR-s."-."0U2]#gl2t#}(3&43&#5467&">gnt8799: 7;2<Rk=>>?& ? @] e Aj Ax  B C > > , B   * >" >2 H Y %j &v ~ D  E  F  G  H H : H H I  J  K' / L;  Q MV N $ $ 9 :  O -6 .> G PZ c Px Q~ R  % & 4 )  % & 4 S2 T_ 9Ug??'?e?@? %,&m??9?5?Yj%{&V5%&$$8VVBiW&-3=Xw27X+1=WN&nBgmyW&YZZZ(4ZBQ]ZjvZZZ?V?ZZ7DPWa&{K??[2( S4E%V&yT\=#7>H/AYF$ 6 : m  q '!',("0((*(8),<))/).*2**M*M+1+t+x+}+++++++++++++,, ,g,5k, . .....$.(.-.1.6.:.?.C.H.L.Q.U.Z.^...040(1N1L1K2G32BU2Ey2D2J +2@MTbov% ,8@HU!\hpx"*,".6>FN[/bnv~1 &.8BLV^fnx &.8BLT^hpz5"*2:DLT\dnv~ *2:BJR\fpx"*2:BLV^fnx    ( 2 : D L V ^ h p x                    $ , 6 > H R \ g r z       4 P!!8!"P!+% 409@j Lu ZwRjyP{Az3t{A{ X   ȍ  P  X  `  h imapopts.o/ 1361504346 0 0 100644 72860 ` ELF,4(.strtab.text.bss.data.rodata.rodata1.comment.debug_info.debug_line.debug_abbrev.debug_pubnames.debug_funcnames.debug_typenames.symtabimapopts.cstatlstatfstatmknodBbss.bssDdata.dataDrodata.rodata_xstat_lxstat_fxstat_xmknodimapopts.rel.text.rel.data.rel.debug_info.rel.debug_line.rel.debug_pubnames.rel.debug_funcnames.rel.debug_typenamesUE PEPj EEUE PEPj EEUE PEPj EEUjjEPE PEPjEE $4H\hx     (44<@DL\pPd $4DLXd lx!|"#$% & '8HXd(P)`*t+,-./01<23(48P5X6p789:;<$=(<>DXX\`?h@pA|BCDEXX\`FGH$I4JDKPL`MpNOPXX\`QRSTUVW(X@YPZd[x\]^_`abc(dH,eXdfhgthijklmnop q r( < D L T \ sd tx   u v w x Ay z { | , }0 2~D  ` |            $ 4 T d x             $ 4 < L \ h        0* 0 L X \ ` d h l p t x           Z(8H\p_(0<HP X@dlx  0D`p|(@L\p(8H\p$8@DPdxadminsafspts_localrealmsafspts_mycellallowallsubscribeallowanonymousloginallowapopallownewnewsallowplaintextallowusermovesaltnamespaceannotation_dbskiplistberkeleyberkeley-hashannotation_db_pathanyoneuseraclannotation_definitionsauditlogauth_mechunixptskrbkrb5autocreatequotaberkeley_cachesizeberkeley_locks_maxberkeley_txns_maxboundary_limitclient_timeoutcommandmintimerconfigdirectorydebug_commanddefaultaclanyone lrsdefaultdomaindefaultpartitiondefaultserverdeletedprefixDELETEDdelete_modeimmediatedelayeddeleterightcdisable_user_namespacedisable_shared_namespacedisconnect_on_vanished_mailboxduplicate_dbberkeley-nosyncberkeley-hash-nosyncsqlduplicate_db_pathduplicatesuppressionexpunge_modedefaultexpunge_daysfailedloginpauseflushseenstatefoolstupidclientsforce_sasl_client_mechfulldirhashhashimapspoolidlesocket{configdirectory}/socket/idleignorereferenceimapidlepollimapidresponseimapmagicplusimplicit_owner_rightslkxaimproved_mboxlist_sortinternaldate_heuristicstandardreceivedheaderldap_authzldap_baseldap_bind_dnldap_derefneversearchfindalwaysldap_filter(uid=%u)ldap_group_baseldap_group_filter(cn=%u)ldap_group_scopesubonebaseldap_idldap_mechldap_member_attributeldap_member_baseldap_member_filter(member=%D)ldap_member_methodattributefilterldap_member_scopeldap_passwordldap_realmldap_referralsldap_restartldap_saslldap_sasl_authcldap_sasl_authzldap_sasl_mechldap_sasl_passwordldap_sasl_realmldap_scopeldap_serversldap://localhost/ldap_size_limitldap_start_tlsldap_time_limitldap_timeoutldap_tls_cacert_dirldap_tls_cacert_fileldap_tls_certldap_tls_check_peerldap_tls_ciphersldap_tls_keyldap_urildap_versionlmtp_downcase_rcptlmtp_fuzzy_mailbox_matchlmtp_over_quota_perm_failurelmtp_strict_quotalmtp_strict_rfc2821lmtpsocket{configdirectory}/socket/lmtplmtptxn_timeoutloginrealmsloginuseacllogtimestampsmailbox_default_optionsmailnotifiermaxheaderlinesmaxmessagesizemaxquotedmaxwordmboxkey_dbmboxlist_dbflatmboxlist_db_pathmboxname_lockpathmetapartition_filesheaderindexcacheexpungesquatmupdate_authnamemupdate_configunifiedreplicatedmunge8bitmupdate_connections_maxmupdate_passwordmupdate_portmupdate_realmmupdate_retry_delaymupdate_servermupdate_usernamemupdate_workers_maxmupdate_workers_maxsparemupdate_workers_minsparemupdate_workers_startnetscapeurlnewsaddheaderstoreplytonewsgroups*newsmasternewsnewspeernewspostusernewsprefixnewsrc_db_pathnntptimeoutnotifysocket{configdirectory}/socket/notifynotify_externalplaintextloginpauseplaintextloginalertpopexpiretimepopminpollpopsubfolderspoppollpaddingpoptimeoutpopuseaclpopuseimapflagspostmasterpostspecpostuserproc_pathproxy_authnameproxyproxy_compressproxy_passwordproxy_realmproxyd_allow_status_referralproxyd_disable_mailbox_referralsproxyserverspts_moduleafskrbldapptloader_sockptscache_dbptscache_db_pathptscache_timeoutptskrb5_convert524ptskrb5_strip_default_realmqosmarkingcs0cs1cs2cs3cs4cs5cs6cs7af11af12af13af21af22af23af31af32af33af41af42af43efquota_dbquotalegacyquota_db_pathquotawarnquotawarnkbreject8bitrfc2046_strictrfc3028_strictsasl_maximum_layersasl_minimum_layerseenstate_dbsendmail/usr/lib/sendmailserverlistservernameserverinfooffminonsharedprefixShared Folderssieve_allowreferralssieve_extensionsfileintorejectvacationimapflagsnotifyincludeenvelopebodyrelationalregexsubaddresscopysieve_maxscriptsizesieve_maxscriptssieve_utf8fileintosieve_sasl_send_unsolicited_capabilitysievedir/usr/sievesievenotifiersieveusehomedirsingleinstancestoreskiplist_always_checkpointskiplist_unsafesoft_noauthspecialusealwayssql_databasesql_enginemysqlpgsqlsqlitesql_hostnamessql_passwdsql_usersql_usesslsrvtabsubmitserverssubscription_dbsuppress_capabilitiesstatuscachestatuscache_dbstatuscache_db_pathsync_authnamesync_compresssync_hostsync_logsync_log_chainsync_log_channelssync_passwordsync_portcsyncsync_realmsync_repeat_intervalsync_shutdown_filesyslog_prefixtcp_keepalivetcp_keepalive_cnttcp_keepalive_idletcp_keepalive_intvltemp_path/tmptimeouttls_ca_filetls_ca_pathtlscache_dbtlscache_db_pathtls_cert_filetls_cipher_listDEFAULTtls_key_filetls_require_certtls_session_timeoutumask077userdeny_dbuserdeny_db_pathuser_folder_limitusername_toloweruserprefixOther Usersunix_group_enableunixhierarchysepvirtdomainsuserid@(#)time.h 2.77 09/06/02 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)syslog.h 1.11 96/05/17 SMI@(#)syslog.h 1.11 03/06/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.16 09/07/02 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13)imapopts.c /var/tmp/cyrus-imapd-2.4.17/lib /opt/solstudio12.2/prod/bin/cc -c -I.. -I/usr/local/include -I/usr/local/include -I/usr/local/mysql/include -I/usr/local/include -I/usr/local/include -I/usr/include/gssapi -I/usr/local/include -I/include -I/usr/local/include -I/usr/local/lib/include -DHAVE_CONFIG_H -g imapopts.c -W0,-xp.XAKgoyLahuJR0c2.Xa;g;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;G=.XAKgoyLahuJR0c2.;backend;raw;cd;DBG_GEN 5.3.0statx U$_pathr|_bufr intcharunsigned long)dev_tlongF _ F)ino_t)mode_t)nlink_tFuid_tFgid_tF FFoff_tFtime_t timespec tv_sec# tv_nsecF#timestruc_tFblksize_tFblkcnt_t: FF K F stat| st_dev:# st_pad1N# st_ino_# st_modek# st_nlinkx# st_uid# st_gid# st_rdev:#$ st_pad2#( st_size#0 st_pad3F#4 st_atim#8 st_mtim#@ st_ctim#H st_blksize #P st_blocks#T st_fstype)#X st_pad4:#hKlstat@U_path|_buf fstat`U_fd|_buf mknodUSX_pathk_mode :_devS imapopt IMAPOPT_ZERO IMAPOPT_ADMINS IMAPOPT_AFSPTS_LOCALREALMS IMAPOPT_AFSPTS_MYCELL IMAPOPT_ALLOWALLSUBSCRIBE IMAPOPT_ALLOWANONYMOUSLOGIN IMAPOPT_ALLOWAPOP IMAPOPT_ALLOWNEWNEWS IMAPOPT_ALLOWPLAINTEXT IMAPOPT_ALLOWUSERMOVES IMAPOPT_ALTNAMESPACE IMAPOPT_ANNOTATION_DB IMAPOPT_ANNOTATION_DB_PATH IMAPOPT_ANYONEUSERACL IMAPOPT_ANNOTATION_DEFINITIONS IMAPOPT_AUDITLOG IMAPOPT_AUTH_MECH IMAPOPT_AUTOCREATEQUOTA IMAPOPT_BERKELEY_CACHESIZE IMAPOPT_BERKELEY_LOCKS_MAX IMAPOPT_BERKELEY_TXNS_MAX IMAPOPT_BOUNDARY_LIMIT IMAPOPT_CLIENT_TIMEOUT IMAPOPT_COMMANDMINTIMER IMAPOPT_CONFIGDIRECTORY IMAPOPT_DEBUG_COMMAND IMAPOPT_DEFAULTACL IMAPOPT_DEFAULTDOMAIN IMAPOPT_DEFAULTPARTITION IMAPOPT_DEFAULTSERVER IMAPOPT_DELETEDPREFIX IMAPOPT_DELETE_MODE IMAPOPT_DELETERIGHT IMAPOPT_DISABLE_USER_NAMESPACE! IMAPOPT_DISABLE_SHARED_NAMESPACE" IMAPOPT_DISCONNECT_ON_VANISHED_MAILBOX# IMAPOPT_DUPLICATE_DB$ IMAPOPT_DUPLICATE_DB_PATH% IMAPOPT_DUPLICATESUPPRESSION& IMAPOPT_EXPUNGE_MODE' IMAPOPT_EXPUNGE_DAYS( IMAPOPT_FAILEDLOGINPAUSE) IMAPOPT_FLUSHSEENSTATE* IMAPOPT_FOOLSTUPIDCLIENTS+ IMAPOPT_FORCE_SASL_CLIENT_MECH, IMAPOPT_FULLDIRHASH- IMAPOPT_HASHIMAPSPOOL. IMAPOPT_IDLESOCKET/ IMAPOPT_IGNOREREFERENCE0 IMAPOPT_IMAPIDLEPOLL1 IMAPOPT_IMAPIDRESPONSE2 IMAPOPT_IMAPMAGICPLUS3 IMAPOPT_IMPLICIT_OWNER_RIGHTS4 IMAPOPT_IMPROVED_MBOXLIST_SORT5 IMAPOPT_INTERNALDATE_HEURISTIC6 IMAPOPT_LDAP_AUTHZ7 IMAPOPT_LDAP_BASE8 IMAPOPT_LDAP_BIND_DN9 IMAPOPT_LDAP_DEREF: IMAPOPT_LDAP_FILTER; IMAPOPT_LDAP_GROUP_BASE< IMAPOPT_LDAP_GROUP_FILTER= IMAPOPT_LDAP_GROUP_SCOPE> IMAPOPT_LDAP_ID? IMAPOPT_LDAP_MECH IMAPOPT_LDAP_MEMBER_ATTRIBUTE IMAPOPT_LDAP_MEMBER_BASE IMAPOPT_LDAP_MEMBER_FILTER IMAPOPT_LDAP_MEMBER_METHOD IMAPOPT_LDAP_MEMBER_SCOPE IMAPOPT_LDAP_PASSWORD IMAPOPT_LDAP_REALM IMAPOPT_LDAP_REFERRALS IMAPOPT_LDAP_RESTART IMAPOPT_LDAP_SASL IMAPOPT_LDAP_SASL_AUTHC IMAPOPT_LDAP_SASL_AUTHZ IMAPOPT_LDAP_SASL_MECH IMAPOPT_LDAP_SASL_PASSWORD IMAPOPT_LDAP_SASL_REALM IMAPOPT_LDAP_SCOPE IMAPOPT_LDAP_SERVERS IMAPOPT_LDAP_SIZE_LIMIT IMAPOPT_LDAP_START_TLS IMAPOPT_LDAP_TIME_LIMIT IMAPOPT_LDAP_TIMEOUT IMAPOPT_LDAP_TLS_CACERT_DIR IMAPOPT_LDAP_TLS_CACERT_FILE IMAPOPT_LDAP_TLS_CERT IMAPOPT_LDAP_TLS_CHECK_PEER IMAPOPT_LDAP_TLS_CIPHERS IMAPOPT_LDAP_TLS_KEY IMAPOPT_LDAP_URI IMAPOPT_LDAP_VERSION IMAPOPT_LMTP_DOWNCASE_RCPT IMAPOPT_LMTP_FUZZY_MAILBOX_MATCH IMAPOPT_LMTP_OVER_QUOTA_PERM_FAILURE IMAPOPT_LMTP_STRICT_QUOTA IMAPOPT_LMTP_STRICT_RFC2821 IMAPOPT_LMTPSOCKET IMAPOPT_LMTPTXN_TIMEOUT IMAPOPT_LOGINREALMS IMAPOPT_LOGINUSEACL IMAPOPT_LOGTIMESTAMPS IMAPOPT_MAILBOX_DEFAULT_OPTIONS IMAPOPT_MAILNOTIFIER IMAPOPT_MAXHEADERLINES IMAPOPT_MAXMESSAGESIZE IMAPOPT_MAXQUOTED IMAPOPT_MAXWORD IMAPOPT_MBOXKEY_DB IMAPOPT_MBOXLIST_DB IMAPOPT_MBOXLIST_DB_PATH IMAPOPT_MBOXNAME_LOCKPATH IMAPOPT_METAPARTITION_FILES IMAPOPT_MUPDATE_AUTHNAME IMAPOPT_MUPDATE_CONFIG IMAPOPT_MUNGE8BIT IMAPOPT_MUPDATE_CONNECTIONS_MAX IMAPOPT_MUPDATE_PASSWORD IMAPOPT_MUPDATE_PORT IMAPOPT_MUPDATE_REALM IMAPOPT_MUPDATE_RETRY_DELAY IMAPOPT_MUPDATE_SERVER IMAPOPT_MUPDATE_USERNAME IMAPOPT_MUPDATE_WORKERS_MAX IMAPOPT_MUPDATE_WORKERS_MAXSPARE IMAPOPT_MUPDATE_WORKERS_MINSPARE IMAPOPT_MUPDATE_WORKERS_START IMAPOPT_NETSCAPEURL IMAPOPT_NEWSADDHEADERS IMAPOPT_NEWSGROUPS IMAPOPT_NEWSMASTER IMAPOPT_NEWSPEER IMAPOPT_NEWSPOSTUSER IMAPOPT_NEWSPREFIX IMAPOPT_NEWSRC_DB_PATH IMAPOPT_NNTPTIMEOUT IMAPOPT_NOTIFYSOCKET IMAPOPT_NOTIFY_EXTERNAL IMAPOPT_PLAINTEXTLOGINPAUSE IMAPOPT_PLAINTEXTLOGINALERT IMAPOPT_POPEXPIRETIME IMAPOPT_POPMINPOLL IMAPOPT_POPSUBFOLDERS IMAPOPT_POPPOLLPADDING IMAPOPT_POPTIMEOUT IMAPOPT_POPUSEACL IMAPOPT_POPUSEIMAPFLAGS IMAPOPT_POSTMASTER IMAPOPT_POSTSPEC IMAPOPT_POSTUSER IMAPOPT_PROC_PATH IMAPOPT_PROXY_AUTHNAME IMAPOPT_PROXY_COMPRESS IMAPOPT_PROXY_PASSWORD IMAPOPT_PROXY_REALM IMAPOPT_PROXYD_ALLOW_STATUS_REFERRAL IMAPOPT_PROXYD_DISABLE_MAILBOX_REFERRALS IMAPOPT_PROXYSERVERS IMAPOPT_PTS_MODULE IMAPOPT_PTLOADER_SOCK IMAPOPT_PTSCACHE_DB IMAPOPT_PTSCACHE_DB_PATH IMAPOPT_PTSCACHE_TIMEOUT IMAPOPT_PTSKRB5_CONVERT524 IMAPOPT_PTSKRB5_STRIP_DEFAULT_REALM IMAPOPT_QOSMARKING IMAPOPT_QUOTA_DB IMAPOPT_QUOTA_DB_PATH IMAPOPT_QUOTAWARN IMAPOPT_QUOTAWARNKB IMAPOPT_REJECT8BIT IMAPOPT_RFC2046_STRICT IMAPOPT_RFC3028_STRICT IMAPOPT_SASL_MAXIMUM_LAYER IMAPOPT_SASL_MINIMUM_LAYER IMAPOPT_SEENSTATE_DB IMAPOPT_SENDMAIL IMAPOPT_SERVERLIST IMAPOPT_SERVERNAME IMAPOPT_SERVERINFO IMAPOPT_SHAREDPREFIX IMAPOPT_SIEVE_ALLOWREFERRALS IMAPOPT_SIEVE_EXTENSIONS IMAPOPT_SIEVE_MAXSCRIPTSIZE IMAPOPT_SIEVE_MAXSCRIPTS IMAPOPT_SIEVE_UTF8FILEINTO IMAPOPT_SIEVE_SASL_SEND_UNSOLICITED_CAPABILITY IMAPOPT_SIEVEDIR IMAPOPT_SIEVENOTIFIER IMAPOPT_SIEVEUSEHOMEDIR IMAPOPT_SINGLEINSTANCESTORE IMAPOPT_SKIPLIST_ALWAYS_CHECKPOINT IMAPOPT_SKIPLIST_UNSAFE IMAPOPT_SOFT_NOAUTH IMAPOPT_SPECIALUSEALWAYS IMAPOPT_SQL_DATABASE IMAPOPT_SQL_ENGINE IMAPOPT_SQL_HOSTNAMES IMAPOPT_SQL_PASSWD IMAPOPT_SQL_USER IMAPOPT_SQL_USESSL IMAPOPT_SRVTAB IMAPOPT_SUBMITSERVERS IMAPOPT_SUBSCRIPTION_DB IMAPOPT_SUPPRESS_CAPABILITIES IMAPOPT_STATUSCACHE IMAPOPT_STATUSCACHE_DB IMAPOPT_STATUSCACHE_DB_PATH IMAPOPT_SYNC_AUTHNAME IMAPOPT_SYNC_COMPRESS IMAPOPT_SYNC_HOST IMAPOPT_SYNC_LOG IMAPOPT_SYNC_LOG_CHAIN IMAPOPT_SYNC_LOG_CHANNELS IMAPOPT_SYNC_PASSWORD IMAPOPT_SYNC_PORT IMAPOPT_SYNC_REALM IMAPOPT_SYNC_REPEAT_INTERVAL IMAPOPT_SYNC_SHUTDOWN_FILE IMAPOPT_SYSLOG_PREFIX IMAPOPT_TCP_KEEPALIVE IMAPOPT_TCP_KEEPALIVE_CNT IMAPOPT_TCP_KEEPALIVE_IDLE IMAPOPT_TCP_KEEPALIVE_INTVL IMAPOPT_TEMP_PATH IMAPOPT_TIMEOUT IMAPOPT_TLS_CA_FILE IMAPOPT_TLS_CA_PATH IMAPOPT_TLSCACHE_DB IMAPOPT_TLSCACHE_DB_PATH IMAPOPT_TLS_CERT_FILE IMAPOPT_TLS_CIPHER_LIST IMAPOPT_TLS_KEY_FILE IMAPOPT_TLS_REQUIRE_CERT IMAPOPT_TLS_SESSION_TIMEOUT IMAPOPT_UMASK IMAPOPT_USERDENY_DB IMAPOPT_USERDENY_DB_PATH IMAPOPT_USER_FOLDER_LIMIT IMAPOPT_USERNAME_TOLOWER IMAPOPT_USERPREFIX IMAPOPT_UNIX_GROUP_ENABLE IMAPOPT_UNIXHIERARCHYSEP IMAPOPT_VIRTDOMAINS IMAPOPT_LAST] opttype OPT_BITFIELD OPT_STRINGLIST OPT_ENUM OPT_SWITCH OPT_INT OPT_STRING OPT_NOTOPTvoid enum_value[& IMAP_ENUM_ZERO IMAP_ENUM_DELETE_MODE_IMMEDIATE IMAP_ENUM_DELETE_MODE_DELAYED IMAP_ENUM_EXPUNGE_MODE_DEFAULT IMAP_ENUM_EXPUNGE_MODE_IMMEDIATE IMAP_ENUM_EXPUNGE_MODE_DELAYED IMAP_ENUM_INTERNALDATE_HEURISTIC_STANDARD IMAP_ENUM_INTERNALDATE_HEURISTIC_RECEIVEDHEADER IMAP_ENUM_METAPARTITION_FILES_HEADER IMAP_ENUM_METAPARTITION_FILES_INDEX IMAP_ENUM_METAPARTITION_FILES_CACHE IMAP_ENUM_METAPARTITION_FILES_EXPUNGE IMAP_ENUM_METAPARTITION_FILES_SQUAT IMAP_ENUM_MUPDATE_CONFIG_STANDARD IMAP_ENUM_MUPDATE_CONFIG_UNIFIED IMAP_ENUM_MUPDATE_CONFIG_REPLICATED IMAP_ENUM_NEWSADDHEADERS_TO IMAP_ENUM_NEWSADDHEADERS_REPLYTO IMAP_ENUM_QOSMARKING_CS0 IMAP_ENUM_QOSMARKING_CS1 IMAP_ENUM_QOSMARKING_CS2 IMAP_ENUM_QOSMARKING_CS3 IMAP_ENUM_QOSMARKING_CS4 IMAP_ENUM_QOSMARKING_CS5 IMAP_ENUM_QOSMARKING_CS6 IMAP_ENUM_QOSMARKING_CS7 IMAP_ENUM_QOSMARKING_AF11 IMAP_ENUM_QOSMARKING_AF12 IMAP_ENUM_QOSMARKING_AF13 IMAP_ENUM_QOSMARKING_AF21 IMAP_ENUM_QOSMARKING_AF22 IMAP_ENUM_QOSMARKING_AF23 IMAP_ENUM_QOSMARKING_AF31 IMAP_ENUM_QOSMARKING_AF32 IMAP_ENUM_QOSMARKING_AF33 IMAP_ENUM_QOSMARKING_AF41 IMAP_ENUM_QOSMARKING_AF42 IMAP_ENUM_QOSMARKING_AF43 IMAP_ENUM_QOSMARKING_EF IMAP_ENUM_SERVERINFO_OFF IMAP_ENUM_SERVERINFO_MIN IMAP_ENUM_SERVERINFO_ON IMAP_ENUM_SIEVE_EXTENSIONS_FILEINTO IMAP_ENUM_SIEVE_EXTENSIONS_REJECT IMAP_ENUM_SIEVE_EXTENSIONS_VACATION IMAP_ENUM_SIEVE_EXTENSIONS_IMAPFLAGS IMAP_ENUM_SIEVE_EXTENSIONS_NOTIFY IMAP_ENUM_SIEVE_EXTENSIONS_INCLUDE IMAP_ENUM_SIEVE_EXTENSIONS_ENVELOPE IMAP_ENUM_SIEVE_EXTENSIONS_BODY IMAP_ENUM_SIEVE_EXTENSIONS_RELATIONAL IMAP_ENUM_SIEVE_EXTENSIONS_REGEX IMAP_ENUM_SIEVE_EXTENSIONS_SUBADDRESS IMAP_ENUM_SIEVE_EXTENSIONS_COPY IMAP_ENUM_VIRTDOMAINS_OFF IMAP_ENUM_VIRTDOMAINS_USERID IMAP_ENUM_VIRTDOMAINS_ONconfig_value& dummy # s# iF# bF# e# x)#& enum_option_s& name&# val&#&&' F imapopt_sj' opt# optname# seen# t# val[&# enum_options&#'}'Fimapoptsj'unsigned__posix_ttyname_r'''__posix_getlogin_r('(_xmknod9(( ())>(_lxstatm(9(C(|r(_xstat(m(w(|_fxstat((|F(__posix_ctime_r'((' tm$) tm_sec# tm_min# tm_hour# tm_mday# tm_mon# tm_year# tm_wday# tm_yday# tm_isdst# ()__posix_asctime_r')'G /var/tmp/cyrus-imapd-2.4.17/lib/usr/include/sys/usr/include/isoimapopts.cstat_impl.hstat.htypes.htime_impl.htime.himapopts.htime_iso.h &; F[ f  DD%. : ; @ ' ID I: ;  $> &III: I  !I/  :  I8  :  (  : I !I/4I?  : ;  .? < ' ID I.? < ' ID )}'imapopts5)statlstatfstatmknod):dev_t_ino_tkmode_txnlink_tuid_tgid_toff_ttime_ttimespectimestruc_t blksize_tblkcnt_tKstat]imapoptopttypeenum_value[&config_value&enum_option_s'imapopt_s(tm  @ `(     1Qy    P    ` $   p |    4     D  P  T  \  d  l      T    d (    t 8        H           X       h ,   ! x" <# $ $ $ % L& ' ' ' ( \) l) t) * * * + l, x, |, , , , 0- <- - . . . |/ / / / / @0 1 1 2 2 P3 \3 4 4 $4 ,4 4 4 4 4 4 5 `6 $7 7 8 p9 4: : ; < D= P= T= \= d= > > > ? T@ A A B dC (D D E tF 8G G H I HJ K K K L XM dM N N O hP ,Q Q R xS  W >!ino_t!mode_t!nlink_t>uid_t>gid_t> >>off_t>time_t timespec tv_sec# tv_nsec>#timestruc_t>blksize_t>blkcnt_t2 >> C > statt st_dev2# st_pad1F# st_inoW# st_modec# st_nlinkp# st_uid~# st_gid# st_rdev2#$ st_pad2#( st_size#0 st_pad3>#4 st_atim#8 st_mtim#@ st_ctim#H st_blksize#P st_blocks#T st_fstype!#X st_pad42#hClstat@U_patht_buf fstat`U_fdt_buf mknodUKP_pathc_mode 2_devK construct_hash_table+jUtable*size* use_mpool*unsignedsize_tvoid bucket  key# data# next#bucket) mpool3 hash_table { size# table.# pool;#@hash_table{ hash_insertNUkeyMdataM tableMvalOptr)Pnewptr)Pprev.Qpllcmpresultnlold_dataq hash_lookupULQkeytable valptr)\uucmpresultL hash_delMU keytable valdataptr)last)(AL$L$cmpresultfree_hash_table[U table func iptr)temp) hash_enumerate-U? table+B func+ rock,i.temp)/temp_next)/? G fatalk L k xstrdup p xmalloc  mpool_strdup ; mpool_malloc ;free_mpool ;new_mpool;6 6 strhash[ ; l > __sigbits[ #l  __posix_sigwait   __posix_ttyname_r __posix_getlogin_r free+ + 5 strcmp^ 0 : memset  _xmknod   !! _lxstat   t _xstat"   t_fxstatL " t>L __posix_ctime_r~ Q  tm$  tm_sec# tm_min# tm_hour# tm_mday# tm_mon# tm_year# tm_wday# tm_yday# tm_isdst# ~ __posix_asctime_r /var/tmp/cyrus-imapd-2.4.17/lib/usr/include/sys/usr/include/isohash.cstat_impl.hstat.htypes.htime_impl.htime.hhash.hselect.htime_iso.h &; F[ f +      & C_ e v      1 D V p          / E N W ` lj~           &AR \ u     z    ( > Lb n v              $\3 A-H Vm          x}  & 4 E O Y fx    } {  DD%. : ; @ ' ID I: ;  $> &III: I  !I/  :  I8 .?  : ; @ ' ID  < 4I : ;   .?  : ;@ ' D I: ; 4I : ; ' D .? < ' D I.? < ' ID  : .? < ' ID {IUconstruct_hash_tablehash_inserthash_lookupVhash_del free_hash_table hash_enumerate5IstatylstatfstatmknodI2dev_tWino_tcmode_tpnlink_t~uid_tgid_toff_ttime_ttimespectimestruc_tblksize_tblkcnt_tCstatsize_tbucketbucket@hash_table{hash_tablel ~ tm  @ `(     %2:ApMUbjq }mP `1Qy  4X} !"#!%6"!"- # X#&&&&&&(>& os48=AFJhlquz~$"'+d%h2 '6  ) #07ERYdlt| $,6>FNX`hpz#$*6@HPX`hpx% *2:BJRZblt~' $,4A)HT\dlv~4 `I I I "L c+ 4PI@#L?)bZ*j +9{Y+L, .0 0p 1X  5  5  5 mpool.o/ 1361504347 0 0 100644 11052 ` ELF'4(.strtab.text.bss.data.rodata.rodata1.comment.debug_info.debug_line.debug_abbrev.debug_pubnames.debug_funcnames.debug_typenames.symtabmpool.cstatlstatfstatmknodnew_mpool_blobBbss.bssDdata.dataDrodata.rodata_xstat_lxstat_fxstat_xmknodxmallocnew_mpoolfree_mpoolfatalfreempool_mallocmpool_strndupstrncpympool_strdupstrlen.rel.text.rel.debug_info.rel.debug_line.rel.debug_pubnames.rel.debug_funcnames.rel.debug_typenamesUE PEPj EEUE PEPj EEUE PEPj EEUjjEPE PEPjEEÐU jjEEuEjEPEEUPEUPEUPE@ EEEÐUjjEjEPpЋEPEEEÐUEuqE@ujKhUE@EEt6E@ EEj@PjEPEEEujEPÐUEEt E@ujKhE uE E@EMEU@+BQ+ЉUE;E rMEU@BQ;vSEU ;Pv E E E@EEEEjEPEEUP EUPEEE@EMEU@+BU DQM‰AEEEÐUE u E=E@PEPEEPE PEP UUBEEEÐUE u E)jE PEEPE PEP EEmemory pool without a blobmpool_malloc called without a valid pool@(#)time.h 2.77 09/06/02 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.16 09/07/02 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)syslog.h 1.11 96/05/17 SMI@(#)syslog.h 1.11 03/06/10 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)sysexits.h 1.7 00/05/01 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13 mpool.c /var/tmp/cyrus-imapd-2.4.17/lib /opt/solstudio12.2/prod/bin/cc -c -I.. -I/usr/local/include -I/usr/local/include -I/usr/local/mysql/include -I/usr/local/include -I/usr/local/include -I/usr/include/gssapi -I/usr/local/include -I/include -I/usr/local/include -I/usr/local/lib/include -DHAVE_CONFIG_H -g mpool.c -W0,-xp.XAKgoyLahuJRUe2.Xa;g;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;G=.XAKgoyLahuJRUe2.;backend;raw;cd;DBG_GEN 5.3.0statx U  _pathrv_bufr intcharunsigned long#dev_tlong@ Y @#ino_t#mode_t#nlink_t@uid_t@gid_t@ @@off_t@time_t timespec tv_sec# tv_nsec@#timestruc_t@blksize_t@blkcnt_t4 @@ E @ statv st_dev4# st_pad1H# st_inoY# st_modee# st_nlinkr# st_uid# st_gid# st_rdev4#$ st_pad2#( st_size#0 st_pad3@#4 st_atim#8 st_mtim#@ st_ctim#H st_blksize#P st_blocks#T st_fstype##X st_pad44#hElstat@U _pathv_buf fstat`U  _fdv_buf mknodU MR_pathe_mode 4_devMnew_mpool_blobNUsizeM blobOunsignedsize_tunsigned char mpool_blob size# base# ptr# next# new_mpool\6U{asize[ ret{] mpool{ blob#afree_mpoolfU{poole pg p_nextgmpool_mallocU{poolsize ret p remain.LL new_pool new_pool_sizevoidmpool_strndup9U{pool$str n retmpool_strdupU{poolstr lenfatal xmallocfree @ __sigbits#  __posix_sigwait ?   ? strncpyn D n strlen s __posix_ttyname_r   __posix_getlogin_r     _xmknod %   ## * _lxstat Y % / v ^ _xstat  Y c v _fxstat    v@ __posix_ctime_r   tm$ tm_sec # tm_min # tm_hour # tm_mday # tm_mon # tm_year # tm_wday # tm_yday # tm_isdst #   __posix_asctime_r F /var/tmp/cyrus-imapd-2.4.17/lib/usr/include/sys/usr/include/isompool.cstat_impl.hstat.htypes.htime_impl.htime.hselect.htime_iso.h &; F[ f        + 1 FP [ j lu }    |    .Lv          . 4 FX i   DD%. : ; @ ' ID I: ;  $> &III: I  !I/  :  I8 4I : ;   .?  : ; @ ' ID .?  : ; @ ' D  .? < ' D I.? < ' ID  : .? < ' ID _ new_mpoolfree_mpoolmpool_mallocmpool_strndup)mpool_strdupH stat{lstatfstatmknodWnew_mpool_blob 4dev_tYino_temode_trnlink_tuid_tgid_toff_ttime_ttimespectimestruc_tblksize_tblkcnt_tEstatsize_tmpool_blobampool tm  @ `(e     6"@-38EYS[@Eh1Qy ^c!_#v   jn*.VZ_chl ;"? '.<IP\dlt|(2?FR\dlt~ "$08@4 "E+` 4= @JL::Zt cj L{#!!@o <$y $ %   '  '  ' xmalloc.o/ 1361504347 0 0 100644 9228 ` ELF 4(.strtab.text.bss.data.rodata.rodata1.comment.debug_info.debug_line.debug_abbrev.debug_pubnames.debug_funcnames.debug_typenames.symtabxmalloc.cstatlstatfstatmknodBbss.bssDdata.dataDrodata.rodata_xstat_lxstat_fxstat_xmknodxmallocmallocfatalxzmallocmemsetxreallocreallocxstrdupstrlenstrcpyxstrndupstrncpy.rel.text.rel.debug_info.rel.debug_line.rel.debug_pubnames.rel.debug_funcnames.rel.debug_typenamesUE PEPj EEUE PEPj EEUE PEPj EEUjjEPE PEPjEEÐUjEPEEt EEjKhEEÐUjEPEEtEPjEP EEjKhEEÐU EujE PEE PEPEEEEt EEjKhEEÐUjEPj@PEEPEPEEEÐUE j@PEE PEPEP UU BEEEVirtual memory exhausted@(#)time.h 2.77 09/06/02 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.16 09/07/02 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)sysexits.h 1.7 00/05/01 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13 xmalloc.c /var/tmp/cyrus-imapd-2.4.17/lib /opt/solstudio12.2/prod/bin/cc -c -I.. -I/usr/local/include -I/usr/local/include -I/usr/local/mysql/include -I/usr/local/include -I/usr/local/include -I/usr/include/gssapi -I/usr/local/include -I/include -I/usr/local/include -I/usr/local/lib/include -DHAVE_CONFIG_H -g xmalloc.c -W0,-xp.XAKgoyLbhuJREf2.Xa;g;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;G=.XAKgoyLbhuJREf2.;backend;raw;cd;DBG_GEN 5.3.0statx U"_pathrz_bufr intcharunsigned long'dev_tlongD ] D'ino_t'mode_t'nlink_tDuid_tDgid_tD DDoff_tDtime_t timespec tv_sec# tv_nsecD#timestruc_tDblksize_tDblkcnt_t8 DD I D statz st_dev8# st_pad1L# st_ino]# st_modei# st_nlinkv# st_uid# st_gid# st_rdev8#$ st_pad2#( st_size#0 st_pad3D#4 st_atim#8 st_mtim#@ st_ctim#H st_blksize#P st_blocks#T st_fstype'#X st_pad48#hIlstat@U_pathz_buf fstat`U_fdz_buf mknodUQV_pathi_mode 8_devQ xmalloc6Usize5 ret7voidunsigned xzmallocA7Usize@ retB xreallocOUPptrNsizeN retP xstrdup[UstrZ p\ xstrndupb5Ustralena pcfatalstrncpyM#Msize_tstrlenW~R~strcpymemsetreallocmalloc _xmknod>''C_lxstatr>Hzw_xstatr|z_fxstatzD__posix_ctime_r  tm$ tm_sec# tm_min# tm_hour# tm_mday# tm_mon# tm_year# tm_wday# tm_yday# tm_isdst#   __posix_asctime_r Y /var/tmp/cyrus-imapd-2.4.17/lib/usr/include/sys/usr/include/isoxmalloc.cstat_impl.hstat.htypes.htime_impl.htime.htime_iso.h &; F[ f 8       + 2 F}         * 0  DD%. : ; @ ' ID I: ;  $> &III: I  !I/  :  I8 .?  : ; @ ' ID  4I : ;  .? < ' D I.? < ' ID .? < ' ID M [xmallocxzmallocxreallocPxstrdupxstrndup5 statlstatfstatmknod 8dev_t]ino_timode_tvnlink_tuid_tgid_toff_ttime_ttimespectimestruc_tblksize_tblkcnt_tIstatWsize_t tm  @ `(     C W!(@k19>AHOEX1Qy   $Um !"$ hl ] a#$2?FQYaiv}  (#/;CKS4 5555"8+Q 4X @$]LZQj9{ P` j z TX       strhash.o/ 1361504347 0 0 100644 3612 ` ELF 4(.strtab.text.bss.data.rodata.comment.debug_info.debug_line.debug_abbrev.debug_pubnames.symtabstrhash.cBbss.bssDdata.dataDrodata.rodatastrhash.rel.debug_info.rel.debug_line.rel.debug_pubnamesU EE@t3E@EE3EEEEEE@EE@u͋EEE@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.16 09/07/02 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)syslog.h 1.11 96/05/17 SMI@(#)syslog.h 1.11 03/06/10 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)assert.h 1.10 04/05/18 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13Ostrhash.c /var/tmp/cyrus-imapd-2.4.17/lib /opt/solstudio12.2/prod/bin/cc -c -I.. -I/usr/local/include -I/usr/local/include -I/usr/local/mysql/include -I/usr/local/include -I/usr/local/include -I/usr/include/gssapi -I/usr/local/include -I/include -I/usr/local/include -I/usr/local/lib/include -DHAVE_CONFIG_H -g strhash.c -W0,-xp.XAKgoyLbhuJR0f2.Xa;g;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;G=.XAKgoyLbhuJR0f2.;backend;raw;cd;DBG_GEN 5.3.0strhash=WU,,Estring<ret_val,>iJ?unsignedchar8@int= /var/tmp/cyrus-imapd-2.4.17/libstrhash.c=  # , 9 @{LR  DD%.?  : ; @ ' ID I: ;  4I : ;  $> &IISstrhashistu~  W  JQ\fnv~ 4 Wggg"gn+S7( C mQ9 aX  H  h P    xstrlcat.o/ 1361504347 0 0 100644 6684 ` ELFL4(.strtab.text.bss.data.rodata.comment.debug_info.debug_line.debug_abbrev.debug_funcnames.debug_typenames.symtabxstrlcat.cstatlstatfstatmknodBbss.bssDdata.dataDrodata.rodata_xstat_lxstat_fxstat_xmknod.rel.text.rel.debug_info.rel.debug_line.rel.debug_funcnames.rel.debug_typenamesUE PEPj EEUE PEPj EEUE PEPj EEUjjEPE PEPjEE@(#)time.h 2.77 09/06/02 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.16 09/07/02 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13%xstrlcat.c /var/tmp/cyrus-imapd-2.4.17/lib /opt/solstudio12.2/prod/bin/cc -c -I.. -I/usr/local/include -I/usr/local/include -I/usr/local/mysql/include -I/usr/local/include -I/usr/local/include -I/usr/include/gssapi -I/usr/local/include -I/include -I/usr/local/include -I/usr/local/lib/include -DHAVE_CONFIG_H -g xstrlcat.c -W0,-xp.XAKgoyLbhuJRkg2.Xa;g;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;G=.XAKgoyLbhuJRkg2.;backend;raw;cd;DBG_GEN 5.3.0statx U$_pathr|_bufr intcharunsigned long)dev_tlongF _ F)ino_t)mode_t)nlink_tFuid_tFgid_tF FFoff_tFtime_t timespec tv_sec# tv_nsecF#timestruc_tFblksize_tFblkcnt_t: FF K F stat| st_dev:# st_pad1N# st_ino_# st_modek# st_nlinkx# st_uid# st_gid# st_rdev:#$ st_pad2#( st_size#0 st_pad3F#4 st_atim#8 st_mtim#@ st_ctim#H st_blksize #P st_blocks#T st_fstype)#X st_pad4:#hKlstat@U_path|_buf fstat`U_fd|_buf mknodUSX_pathk_mode :_devSb _xmknod ] g ) ) _lxstat   | _xstat   | _fxstat'   |F' __posix_ctime_r1^ , 1 tm$ tm_sec# tm_min# tm_hour# tm_mday# tm_mon# tm_year# tm_wday# tm_yday# tm_isdst# ^__posix_asctime_r1  19 /var/tmp/cyrus-imapd-2.4.17/lib/usr/include/sys/usr/include/isoxstrlcat.cstat_impl.hstat.htypes.htime_impl.htime.htime_iso.h &; F[ f  DD%. : ; @ ' ID I: ;  $> &III: I  !I/  :  I8 .? < ' ID  I.? < ' ID 5)statlstatfstatmknod):dev_t_ino_tkmode_txnlink_tuid_tgid_toff_ttime_ttimespectimestruc_t blksize_tblkcnt_tKstat^tm{  @ `(   1Qy%34= "+ )7=CUQ9bLsp l  P  `  < ( D xstrlcpy.o/ 1361504347 0 0 100644 6716 ` ELFl4(.strtab.text.bss.data.rodata.comment.debug_info.debug_line.debug_abbrev.debug_funcnames.debug_typenames.symtabxstrlcpy.cstatlstatfstatmknodBbss.bssDdata.dataDrodata.rodata_xstat_lxstat_fxstat_xmknod.rel.text.rel.debug_info.rel.debug_line.rel.debug_funcnames.rel.debug_typenamesUE PEPj EEUE PEPj EEUE PEPj EEUjjEPE PEPjEE@(#)time.h 2.77 09/06/02 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.16 09/07/02 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)sysexits.h 1.7 00/05/01 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13%xstrlcpy.c /var/tmp/cyrus-imapd-2.4.17/lib /opt/solstudio12.2/prod/bin/cc -c -I.. -I/usr/local/include -I/usr/local/include -I/usr/local/mysql/include -I/usr/local/include -I/usr/local/include -I/usr/include/gssapi -I/usr/local/include -I/include -I/usr/local/include -I/usr/local/lib/include -DHAVE_CONFIG_H -g xstrlcpy.c -W0,-xp.XAKgoyLbhuJRUh2.Xa;g;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;G=.XAKgoyLbhuJRUh2.;backend;raw;cd;DBG_GEN 5.3.0statx U$_pathr|_bufr intcharunsigned long)dev_tlongF _ F)ino_t)mode_t)nlink_tFuid_tFgid_tF FFoff_tFtime_t timespec tv_sec# tv_nsecF#timestruc_tFblksize_tFblkcnt_t: FF K F stat| st_dev:# st_pad1N# st_ino_# st_modek# st_nlinkx# st_uid# st_gid# st_rdev:#$ st_pad2#( st_size#0 st_pad3F#4 st_atim#8 st_mtim#@ st_ctim#H st_blksize #P st_blocks#T st_fstype)#X st_pad4:#hKlstat@U_path|_buf fstat`U_fd|_buf mknodUSX_pathk_mode :_devSb _xmknod ] g ) ) _lxstat   | _xstat   | _fxstat'   |F' __posix_ctime_r1^ , 1 tm$ tm_sec# tm_min# tm_hour# tm_mday# tm_mon# tm_year# tm_wday# tm_yday# tm_isdst# ^__posix_asctime_r1  19 /var/tmp/cyrus-imapd-2.4.17/lib/usr/include/sys/usr/include/isoxstrlcpy.cstat_impl.hstat.htypes.htime_impl.htime.htime_iso.h &; F[ f  DD%. : ; @ ' ID I: ;  $> &III: I  !I/  :  I8 .? < ' ID  I.? < ' ID 5)statlstatfstatmknod):dev_t_ino_tkmode_txnlink_tuid_tgid_toff_ttime_ttimespectimestruc_t blksize_tblkcnt_tKstat^tm{  @ `(   1Qy%34= " + )78=CuQ39blsp   P  `  \ ( d assert.o/ 1361504347 0 0 100644 7628 ` ELF4(.strtab.text.bss.data.rodata.rodata1.comment.debug_info.debug_line.debug_abbrev.debug_pubnames.debug_funcnames.debug_typenames.symtabassert.cstatlstatfstatmknodBbss.bssDdata.dataDrodata.rodata_xstat_lxstat_fxstat_xmknodassertionfailedsnprintffatal.rel.text.rel.debug_info.rel.debug_line.rel.debug_pubnames.rel.debug_funcnames.rel.debug_typenamesUE PEPj EEUE PEPj EEUE PEPj EEUjjEPE PEPjEEÐUEt0 4Et E 8PPE PEPhhPjKPInternal error: assertion failed: %s: %d%s%s: @(#)time.h 2.77 09/06/02 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.16 09/07/02 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)sysexits.h 1.7 00/05/01 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13assert.c /var/tmp/cyrus-imapd-2.4.17/lib /opt/solstudio12.2/prod/bin/cc -c -I.. -I/usr/local/include -I/usr/local/include -I/usr/local/mysql/include -I/usr/local/include -I/usr/local/include -I/usr/include/gssapi -I/usr/local/include -I/include -I/usr/local/include -I/usr/local/lib/include -DHAVE_CONFIG_H -g assert.c -W0,-xp.XAKgoyLbhuJREi2.Xa;g;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;G=.XAKgoyLbhuJREi2.;backend;raw;cd;DBG_GEN 5.3.0statx U   _pathrx_bufr intcharunsigned long%dev_tlongB [ B%ino_t%mode_t%nlink_tBuid_tBgid_tB BBoff_tBtime_t timespec tv_sec# tv_nsecB#timestruc_tBblksize_tBblkcnt_t6 BB G B statx st_dev6# st_pad1J# st_ino[# st_modeg# st_nlinkt# st_uid# st_gid# st_rdev6#$ st_pad2#( st_size#0 st_pad3B#4 st_atim#8 st_mtim#@ st_ctim#H st_blksize#P st_blocks#T st_fstype%#X st_pad46#hGlstat@U _pathx_buf fstat`U  _fdx_buf mknodU OT_pathg_mode 6_devO assertionfailed9Ufile5 line5 expr5 buf:Bfatal  unsignedsnprintf L   Q_xmknod LV%% _lxstat x _xstat x _fxstat  xB__posix_ctime_r H  tm$ tm_sec # tm_min # tm_hour # tm_mday # tm_mon # tm_year # tm_wday # tm_yday # tm_isdst # H__posix_asctime_r  ^ /var/tmp/cyrus-imapd-2.4.17/lib/usr/include/sys/usr/include/isoassert.cstat_impl.hstat.htypes.htime_impl.htime.htime_iso.h &; F[ f <    DD%. : ; @ ' ID I: ;  $> &III: I  !I/  :  I8 .?  : ; @ ' D  4I : ;  I !I/.? < ' D I.? < ' ID .? < ' ID "Yassertionfailed5stat}lstatfstatmknod6dev_t[ino_tgmode_ttnlink_tuid_tgid_toff_ttime_ttimespectimestruc_tblksize_tblkcnt_tGstatHtm  @ `(     1Qy     nr#1>EPX4 "9+4 @bLTZj&j9{x! 8P+ `;  K h _ p t x  util.o/ 1361504347 0 0 100644 33628 ` ELF4(.strtab.text.bss.data.rodata.rodata1.comment.debug_info.debug_line.debug_abbrev.debug_pubnames.debug_funcnames.debug_typenames.debug_varnames.SUNW_cap.symtabutil.cstatlstatfstatmknodBbss.bssDdata.dataDrodata.rodata_xstat_lxstat_fxstat_xmknodlcaseconvert_to_lowercaseucaseconvert_to_uppercasebeautify_copy__ctypebeautify_stringstrlen.XBKgoyLbhuJR0i2.beautify_string.beautysizexmalloc.XBKgoyLbhuJR0i2.beautify_string.beautybufxreallocstrcmpsafestrcmpstrcasecmpsafestrcasecmpkv_bsearchdir_hash_ctolowercyrus_close_sockshutdownclosecyrus_reset_stdioopenfataldup2create_tempfilesnprintfmkstempunlinkcyrus_mkdirstrchrmkdirerrnosyslogbecome_cyrus.XBKgoyLbhuJR0i2.become_cyrus.uidsetuidgetpwnamgeteuidgetuidgetegidgetgidinitgroupsstrerrorsetgidtimesubcmdtime_settimer.XAKgoyLbhuJR0i2.cmdtime_enabledcmdtime_starttimer.XAKgoyLbhuJR0i2.cmdtime_startgettimeofday.XAKgoyLbhuJR0i2.nettime.XAKgoyLbhuJR0i2.cmdtime.XAKgoyLbhuJR0i2.totaltimecmdtime_endtimer.XAKgoyLbhuJR0i2.cmdtime_endcmdtime_netstart.XAKgoyLbhuJR0i2.nettime_startcmdtime_netend.XAKgoyLbhuJR0i2.nettime_endparseint32parseuint32buf_ensurememcpybuf_cstringbuf_getmapbuf_lenbuf_resetbuf_truncatememsetbuf_setcstrbuf_setmapbuf_copybuf_appendbuf_appendmapbuf_appendcstrbuf_appendbit32htonlbuf_putcbuf_printfvsnprintfbuf_replace_allstrstrmemmovebuf_cmpmemcmpbuf_initbuf_init_robuf_freefreebuf_movestrconcatstrcpy.rel.text.rel.debug_info.rel.debug_line.rel.debug_pubnames.rel.debug_funcnames.rel.debug_typenames.rel.debug_varnamesUE PEPj EEUE PEPj EEUE PEPj EEUjjEPE PEPjEEÐUEEE@t*E@UBE@EE@u֋EEEÐUEEE@t*E@UBE@EE@u֋EEEÐUE @tuE @EE @E EWu1^UBE@EE ~ ?E E@EEUBE@EE @uUBEEEÐU jEPEE;Eu:E=~EEEEjP?EE;~EPPuEEPPEEÐU EuE EEE uE E EEPEPEEÐU Eu E EEE uE E EEPEPEEÐUEEEEEHEE;E|zEEEUE PEPEЃEEtNE} EHE E@EE;E|,EEEUE PEPEЃEEuEt E UE ЉEEEEÐUE EEEE@tRE@.tFUE3ЋE@3ЉUEEE@EE@t E@.uE+ƒAE?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~.A/dev/nullopen() on /dev/null failed%s/cyrus_tmpfile_XXXXXXtemporary file pathname is too long in prot_flushIOERROR: creating directory %s: %mcyrusno entry in /etc/passwd for user %sunable to initialize groups for user %s: %sunable to set group id to %d for user %s: %snum too big@(#)time.h 2.77 09/06/02 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)grp.h 1.22 04/09/28 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)pwd.h 1.22 04/09/28 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.16 09/07/02 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)syslog.h 1.11 96/05/17 SMI@(#)syslog.h 1.11 03/06/10 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)sysexits.h 1.7 00/05/01 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13!util.c /var/tmp/cyrus-imapd-2.4.17/lib /opt/solstudio12.2/prod/bin/cc -c -I.. -I/usr/local/include -I/usr/local/include -I/usr/local/mysql/include -I/usr/local/include -I/usr/local/include -I/usr/include/gssapi -I/usr/local/include -I/include -I/usr/local/include -I/usr/local/lib/include -DHAVE_CONFIG_H -g util.c -W0,-xp.XAKgoyLbhuJR0i2.Xa;g;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;G=.XAKgoyLbhuJR0i2.;backend;raw;cd;DBG_GEN 5.3.0statx U_pathrt_bufr intcharunsigned long!dev_tlong> W >!ino_t!mode_t!nlink_t>uid_t>gid_t> >>off_t>time_t timespec tv_sec# tv_nsec>#timestruc_t>blksize_t>blkcnt_t2 >> C > statt st_dev2# st_pad1F# st_inoW# st_modec# st_nlinkp# st_uid~# st_gid# st_rdev2#$ st_pad2#( st_size#0 st_pad3>#4 st_atim#8 st_mtim#@ st_ctim#H st_blksize#P st_blocks#T st_fstype!#X st_pad42#hClstat@U_patht_buf fstat`U_fdt_buf mknodUKP_pathc_mode 2_devKunsigned charU f~ >convert_to_lowercasekJU  >convert_to_uppercasemlcaseU   strscan ucase-U g strscan beautify_copyU  dstsrc cUbeautify_stringU BGsrcbeautybuf beautysizelenBstrcmpsafeUab strcasecmpsafevUab kv_bsearchSUkeykv nelemcmpftopmidbotcmp keyvalue key # value #keyvaluedir_hash_c:U  name full  cf/rrpt n DIR_XDIR_YDIR_PDIR_A Uunsignedcyrus_close_sock-jU fd,cyrus_reset_stdio3UF devnull4create_tempfileQU  pathPfdRpattern S  >cyrus_mkdirjUR W pathicmodei p ksave_errnolsbufCmR become_cyrus U p newuidnewgidresultuid passwd$ pw_name # pw_passwd # pw_uid~# pw_gid# pw_age # pw_comment # pw_gecos # pw_dir # pw_shell #  cmdtime_enabledtimesub\ U  B startB end double>suseconds_t timevalB tv_sec# tv_usec # cmdtime_settimerm U enablecmdtime_starttimer Ucmdtime_endtimerL U  pcmdtime pnettime  cmdtime_netstartq Ucmdtime_netend Uparseint32 Upptr resresultgotcharint32_t parseuint32 Uinp}ptr resresultgotcharisx uint32_t buf_ensuren UYbufn newlen  c $ c $ c s  bufY s # len # alloc # flags# buf_cstring UYbufbuf_getmap' UYbuf&base& len&buf_len-U 49buf,4buf_reset2.UnYbuf1buf_truncate8UYbuf7 len7 6xAxAxmore ;buf_setcstrDU$YbufC)strC $buf_setmapIU~YbufHbaseH lenH~buf_copyS?UYdstRsrcR buf_appendX_UYdstWsrcW buf_appendcstr]U^Ybuf\cstr\ ^buf_appendbit32bUYbufanuma nbit32c bit32buf_appendmaphU#Ybufg(baseg leng#buf_putcrqUiYbufqcq buf_printfyDUYbufxfmtx ...xargs zroom{n|voidva_list buf_replace_allU Ybuf$match .replacen matchlenreplacelenp dp)buf_cmpLUab len rbuf_init}UYbufbuf_init_roU*Ybuf/base len*buf_freeUcYbufbuf_moveMUYdstYsrc CstrconcatU KPs1... szsZbuf p args KUnettime cmdtime totaltime nettime_end nettime_start cmdtime_end cmdtime_start fatal:xrealloc[ xmallocv __posix_ttyname_r  __posix_getlogin_r unlinksetuid>setgid(> getuid~ getgid geteuid~ getegidclosesyslogdup2mkstemp freestrcasecmp,,6strstr _1;_strchr d size_tstrlenstrerror strcpy  strcmp1 memsetU UmemmoveZ memcpy memcmp  __posix_getpwnam_r3  __posix_getpwuid_rm>  mgetpwnam r  group  gr_name # gr_passwd # gr_gid# gr_mem# __posix_getgrnam_r4 __posix_getgrgid_rn> ninitgroupss>tolowervsnprintf  snprintf  printfB"shutdownchtonl||open_xmknod!!_lxstat t _xstatD   t_fxstatn D tn mkdir s !> __posix_ctime_r     tm$ a! tm_sec# tm_min# tm_hour# tm_mday# tm_mon# tm_year# tm_wday# tm_yday# tm_isdst#  a!__posix_asctime_r !f! !gettimeofdayB  /var/tmp/cyrus-imapd-2.4.17/lib/usr/include/sys/usr/include/usr/include/isoutil.cstat_impl.hstat.htypes.htime_impl.htime.hutil.hpwd.hint_types.hstdarg_iso.hgrp.htime_iso.h &; F[ f    ~    ~"( 6B V i {   v      ' @ Q d }      &q        |+N fr y     }  /5 FT e v       A Pd l x         8 @ S \gv        F N \r       & V c k s        # 7 J S ` o          0 ? a h |          0 ? a h |          $ 5 @ Z c l v            , 6A M ] x         #= C] c        &4 ` o         $ $3B \c t         @ T \ p w q       ! , : AG S] g q {             = K V]e t       / 5 [ k ~   DD%. : ; @ ' ID I: ;  $> &III: I  !I/  :  I8 I  !I/4I?  : ;  .?  : ; @ ' ID 4I : ;  ' ID .?  : ;@ ' ID I: ; 4I : ;   ( .?  : ;@ D .?  : ;@ ' D .?  : ;@ D D D .? < ' D I.? < ' ID  .? < ' ID !.? < ' ID !~convert_to_lowercaseconvert_to_uppercaselcase%ucasegbeautify_copybeautify_stringLstrcmpsafestrcasecmpsafekv_bsearchdir_hash_c cyrus_close_sock cyrus_reset_stdioF create_tempfile cyrus_mkdir\ become_cyrus timesubG cmdtime_settimer cmdtime_starttimer cmdtime_endtimer cmdtime_netstartcmdtime_netend<parseint32parseuint32buf_ensure^buf_cstringbuf_getmapbuf_len>buf_resetnbuf_truncatebuf_setcstr.buf_setmapbuf_copybuf_appendbuf_appendcstrhbuf_appendbit32buf_appendmap-buf_putcibuf_printfbuf_replace_all3buf_cmpbuf_initbuf_init_ro4buf_freecbuf_movestrconcat5!statylstatfstatmknod7!2dev_tWino_tcmode_tpnlink_t~uid_tgid_toff_ttime_ttimespectimestruc_tblksize_tblkcnt_tCstatkeyvaluekeyvalue passwd suseconds_t timevalint32_tuint32_tbufbit32 va_listsize_tgroup tm!beautybufbeautysize uid cmdtime_enabled_nettimevcmdtimetotaltimenettime_endnettime_startcmdtime_endcmdtime_start  @ `(      M"7M=R0`hxV V`)1@*BKQpchnsx)29 <A` R sp ] | -P !>(] Jl0   p S  0b$K @X(`$7+GM QVakP`{P-+IMPb1Qy] "####*#0$8%A#M#V#`#e#k%q&y%~%# %%  (0 L g*- M/[0{ 2 3/4/4/40" 36D I3Z780:;<<<<E L=o:??@ A  =B#C/D;EJ?a fFu<{G  =H<G  =@ ?M  g Kt K M N  O  O  P  P  Q  Q K S N S M I Q Q O P( P0 P; OC OT Kc Uh N K W N W U I O O3  8 33  8 3 &+ $S [ ZVZqa"c_Z [6cVfj"{fifZ[-ZZlZlj""\nZ9oi[nquuDr{""$x "dxr" 04z~!%*#\'`)+ , J N S W \ `  .  1" \ 5`  9 o >s  ? K I ^ Jb  L  R T1V5MXQYZp\t]^N_R`b?cCde/g3~hf<j@zk~0m4ApErsCtGrvvwrOPQWUSM%3@GUbiw#/7?GOW_is}!''4);GT+[gow,#+5B.IU]j1q}5 %/<9COYaiqy> %-5?GOYcksIJLR #+8T?KS`Vgs{X Y)19CKS[cmwZ \  # + 3 = J ]Q ] e r ^y   _    `        b  " c) 5 = E M U b di u  e   g   h    f      * j1 = E M Z ka m u }           m        # + 3 ; C K S [ c k u   p            r    ! . s5 A I Q Y f tm y       v      w   %-5=GQYaiqy4R H8DT"d@+ 4*!@TLLZZ\j_9{'`;baob(b i `oX s   x   )  >  signals.o/ 1361504347 0 0 100644 10004 ` ELF|#4(.strtab.text.bss.data.rodata.rodata1.comment.debug_info.debug_line.debug_abbrev.debug_pubnames.debug_funcnames.debug_typenames.debug_varnames.symtabsignals.cstatlstatfstatmknodsighandlerBbss.bssDdata.dataDrodata.rodata_xstat_lxstat_fxstat_xmknod.XAKgoyLbhuJRkj2.gotsignalsignals_add_handlerssigemptysetsigactionfatal.XAKgoyLbhuJRkj2.catchsignals_set_shutdown.XAKgoyLbhuJRkj2.shutdown_cbsignals_pollexit.rel.text.rel.debug_info.rel.debug_line.rel.debug_pubnames.rel.debug_funcnames.rel.debug_typenames.rel.debug_varnamesUE PEPj EEUE PEPj EEUE PEPj EEUjjEPE PEPjEEÐUEÐU$jEPEEEEEt$jEPj }jhjEPj }jhEEEE܋t[E܋t6UjEPP }E܋PhE@E܋E܋uÐUEÐU8tjjKЃjjK"Ett㐐EEunable to install signal handler for %d: %m@(#)time.h 2.77 09/06/02 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.16 09/07/02 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)syslog.h 1.11 96/05/17 SMI@(#)syslog.h 1.11 03/06/10 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)sysexits.h 1.7 00/05/01 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13] signals.c /var/tmp/cyrus-imapd-2.4.17/lib /opt/solstudio12.2/prod/bin/cc -c -I.. -I/usr/local/include -I/usr/local/include -I/usr/local/mysql/include -I/usr/local/include -I/usr/local/include -I/usr/include/gssapi -I/usr/local/include -I/include -I/usr/local/include -I/usr/local/lib/include -DHAVE_CONFIG_H -g signals.c -W0,-xp.XAKgoyLbhuJRkj2.Xa;g;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;G=.XAKgoyLbhuJRkj2.;backend;raw;cd;DBG_GEN 5.3.0statx U"_pathrz_bufr intcharunsigned long'dev_tlongD ] D'ino_t'mode_t'nlink_tDuid_tDgid_tD DDoff_tDtime_t timespec tv_sec# tv_nsecD#timestruc_tDblksize_tDblkcnt_t8 DD I D statz st_dev8# st_pad1L# st_ino]# st_modei# st_nlinkv# st_uid# st_gid# st_rdev8#$ st_pad2#( st_size#0 st_pad3D#4 st_atim#8 st_mtim#@ st_ctim#H st_blksize#P st_blocks#T st_fstype'#X st_pad48#hIlstat@U_pathz_buf fstat`U_fdz_buf mknodUQV_pathi_mode 8_devQ gotsignal7 sighandler:Usig9D catch?  D catch?signals_add_handlersBUPalarmA actionC iDPW _handlerR# _sigactionZ#unsigned D __sigbits#sigset_t D sigaction 6 sa_flags# _funcptr_# sa_mask# sa_resv#C6shutdownfn C shutdown_cbTdsignals_set_shutdowngUTsfsignals_polllUfatal__posix_sigwait'sigemptysetK'KsigactionPUexit_xmknod''_lxstat z _xstat5   z_fxstat_ 5 zD_ __posix_ctime_ri  d i tm$ / tm_sec# tm_min# tm_hour# tm_mday# tm_mon# tm_year# tm_wday# tm_yday# tm_isdst#  / __posix_asctime_ri 4 i  /var/tmp/cyrus-imapd-2.4.17/lib/usr/include/sys/usr/include/isosignals.cstat_impl.hstat.htypes.htime_impl.htime.hsignal.hselect.hsignals.htime_iso.h &; F[ f ;     &< i ~    y    DD%. : ; @ ' ID I: ;  $> &III: I  !I/  :  I8 4I : ;  . : ; @ ' D I!I.?  : ; @ ' D D ' D  :  : ' D I.?  : ; @ ' ID .? < ' D .? < ' ID .? < ' ID Qa signals_add_handlersssignals_set_shutdownsignals_pollDa statlstatfstatmknodssighandlera 8dev_t]ino_timode_tvnlink_tuid_tgid_toff_ttime_ttimespectimestruc_tblksize_tblkcnt_tIstat_sigset_tsigactionCshutdownfn tm@a [gotsignalcatchcatchYshutdown_cb  @ `(      :O[ek  `1Qy3 B W ]o uz """$ o   o"!# '5BIWdkv!$1#8DNV^fpz4B  ",+E 4a @vLwZqUjH{D4P  \! "P  \#  d#  l# . t#070701000a2e89000041ed0000000000000000000000035126e8a100000000000000b500010002ffffffffffffffff0000001900000000root/usr/local/lib/perl5070701000a2e8a000041ed0000000000000000000000035126e8a100000000000000b500010002ffffffffffffffff0000002300000000root/usr/local/lib/perl5/site_perl070701000a2e8b000041ed0000000000000000000000035126e8a100000000000000b500010002ffffffffffffffff0000002a00000000root/usr/local/lib/perl5/site_perl/5.12.3070701000a2e8c000041ed0000000000000000000000045126e8a100000000000000b500010002ffffffffffffffff0000003800000000root/usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris070701000a2e95000041ed0000000000000000000000035126e8a100000000000000b500010002ffffffffffffffff0000003d00000000root/usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/auto070701000a2e96000041ed0000000000000000000000045126e8a100000000000000b500010002ffffffffffffffff0000004300000000root/usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/auto/Cyrus070701000a2e9b000041ed0000000000000000000000035126e8a100000000000000b500010002ffffffffffffffff0000004900000000root/usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/auto/Cyrus/SIEVE070701000a2e9c000041ed0000000000000000000000025126e8a100000000000000b500010002ffffffffffffffff0000005500000000root/usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/auto/Cyrus/SIEVE/managesieve070701000a2e9d000081a40000000000000000000000015126e87e00000145000000b500010002ffffffffffffffff0000005f00000000root/usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/auto/Cyrus/SIEVE/managesieve/.packlist/usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/Cyrus/SIEVE/managesieve.pm /usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/auto/Cyrus/SIEVE/managesieve/managesieve.bs /usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/auto/Cyrus/SIEVE/managesieve/managesieve.so /usr/local/share/man/man3/Cyrus::SIEVE::managesieve.3 070701000a2e9f000081ed0000000000000000000000015126e87b000a5a40000000b500010002ffffffffffffffff0000006400000000root/usr/local/lib/perl5/site_perl/5.12.3/i86pc-solaris/auto/Cyrus/SIEVE/managesieve/managesieve.soELF4T 4 (#"ol XX   !#%&(),./0124567;<=?@BDFHIJKLMORSTUVYZ\_`abcfgijlnqtvxy}~    !"%&(*+,-/12369:=>BDGHJKLMOQSUWXZ\]_bcdefgikloqrsuvwxyz~ "$'*+-389:>ACEGNPQWX[]^dehkmoprsuwz{|  #$').04578;<?@ACEFINPRTVY[^`ahjmnpt{|}`  `#M "E /@HYk06I t1$ `  p%?kN OTQ ^ gn%V }`Z    */GQ@T aX hB W 0tN $@E@  Qi _z:  d p<$  ,x"b 4PD > D~ Sa/S ms05 {@Y ` pL o mP \0 WP$ g i s$ 8   0b 1  $  39C FlH_ns> 3 @;& ` k  P0 ")7K`@ ^kqw`6  % g # js 6M  /D;l LWpv kW t@x$ \  H 0   2 I  Q ^ y P.   X      % /  ? P W  q |  D  @) @C]   \' @k6 7 G ^ m dt  1$   '  ,!   0Z(  # D4 B L  f  5-      u3      . \ H e  p p0 x   g  +<    D  L v3   60Ag J: Vj<  *x    ;1 4i  5 @+] Sdp     3`    C #N-& 8>O(D\Tn p   c @B  !k 2`]@!< l@ f`C } &  Q     28` B` R_k hu7 |D@%V  l3Pm <i HDD`h+  y-J @2X 0!  tD( 5>A P` YW @* : p )@ 6DJP1K Udrw2Q A`P  6b "8P,| IP( ` 2+ `  P/ 0  AL  P /=# +L Zl hv`i `  > ``t (г 7`j_ EM Yi@ p9]  '* 0, P @  * CQX]lx~l5   @    9E B `WX`g~  #M P- P $4b >1 NdW^ o{6+ 1 9 p ` 0 8 Ш  '70" B@v WP dh<@P   0 d 1Q0n [@ cp|string_compareucase__iobfopenmpool_strdupPL_markstack_maxstrrchrPerl_newXS_flagsPerl_sv_2pv_flagsbuf_freebuf_appendcstrsqlite3_step_finisasl_disposeSSL_CTX_check_private_keystring_allocate.XAKgoyLfhuJR033.open_dbSSL_set_connect_stateinflateEndX509_verify_cert_error_stringX509_NAME_get_text_by_NIDprotgroup_freefreadauth_saslrandlvlxmallocstrcasecmpsafe_xstatprot_printfsignals_set_shutdowngai_strerrorstrlcatisieve_putmysql_fetch_lengthsPL_tmps_floorPerl_sv_2iv_flagsPL_Svsetuidsigemptyset.XAKgoyLbhuJR0i2.cmdtime_end.XAKgoyLghuJRE63.dbinitPQntuplesprot_settimeoutXS_Cyrus__SIEVE__managesieve_sieve_activate.XAKgoyLbhuJR0i2.cmdtime_start.XBKgoyLchuJR0r2.imclient_connect.didinitprot_removewaiteventPQgetvaluesqlite3_errmsgstrhashimclient_closestrlcpy__ctype.XAKgoyLbhuJR0i2.cmdtimestring_freelock_blocking.XAKgoyLchuJR0r2.issuer_CNmap_freeimclient_starttlssqlite3_column_bytesvsnprintfprot_setsaslstrcatPerl_newSVpvfSSL_CTX_set_tmp_rsa_callbackPerl_sv_newmortalPerl_new_versionbsearch_memprot_printastringprot_fillyyleximclient_writePerl_newSVpvnbuf_cstringhtonlbuf_cmpmpool_strndup.XAKgoyLchuJR0r2.peer_CNPerl_safesysmallocgetpwnamgetpidshowlistimclient_connectprot_putcprot_selectprotgroup_getelement.XBKgoyLbhuJREo2.retry_writev.iov_maxXS_Cyrus__SIEVE__managesieve_sieve_getbeautify_stringlock_sharedcyrusdb_backendsPerl_mg_setimparse_issequenceprot_newcyrusdb_initSSL_pendingiptostringfreeaddrinfoSSL_CTX_use_PrivateKey_filebuf_truncatebuf_appendhash_insertsetgidimparse_isatomsrandcyrusdb_done.XAKgoyLbhuJRUq2.sig_tblPerl_call_listatoiprot_setcompressbuf_printfreaddirdup2convert_to_uppercasePL_sv_undefprot_sasldecodememmovesignals_pollimparse_isnumberxstrdupSSL_freeperrorgetaddrinfobuf_getmapmemsetPerl_sv_setpvPerl_markstack_growprot_data_boundarySSL_CTX_ctrllseekabortstrcspnPQresStatusnew_mpoolfatalnonblockbeautify_copygetpassphraseprotgroup_copy.XAKgoyLchuJR0r2.verify_depthbuf_move_etextPerl_free_tmpsstrtoul.XAKgoyLchuJR0r2.charclasscyrusdb_sqlprotgroup_deletestrcasecmpfillin_interactionsxzmallocimclient_send.XBKgoyLbhuJR0i2.beautify_string.beautysizeisieve_getSSL_CTX_newstring_copybuf_resetmysql_real_connectmap_method_descPerl_croak_xs_usagesqlite3_closesasl_client_startSSL_CTX_remove_sessionmyfetchPL_stack_max.XAKgoyLbhuJRkj2.gotsignalparseuint32bsearch_comparesocketXS_Cyrus__SIEVE__managesieve_sieve_deletedb_env_createsafe_to_use_quoteddeflateInit2_SSL_ctrlmysql_free_resultPerl_sv_derived_fromPL_sv_yesread_capabilityPL_markstack_ptrstrchrlibcyrus_config_getstringdb_versioninflateInit2_cyrusdb_berkeley_hash_nosyncXS_Cyrus__SIEVE__managesieve_sieve_logoutcyrus_mkdirprot_errorinit_saslPL_scopestack_ix.XAKgoyLbhuJR0l2.convert_to_compareprotgroup_resetPerl_vstringify.XAKgoyLghuJRU53.dbenvPL_unitcheckav_edata.XAKgoyLchuJR0r2.cmdcallback_freelistbuf_setcstrlibcyrus_config_setintsasl_errdetailcyrus_reset_stdioSSL_CTX_set_verifycmdtime_netstart_lxstatprot_putbufsasl_setpropcyrusdb_berkeleysasl_decode64Perl_vcmplibcyrus_config_getswitch.XAKgoyLbhuJR0i2.nettime_startbuf_initSSL_connectSSL_clearmyforeachPerl_push_scopePerl_get_svimclient_setflagsPL_curpadSSL_CIPHER_get_bitsPQerrorMessageretry_writeSSL_get_peer_certificate_PROCEDURE_LINKAGE_TABLE_.XAKgoyLbhuJR0i2.nettime_endfree_mpoolbuf_lensasl_encodefclosetls_start_clienttlsPerl_newSVpvtimesubPerl_sv_setivtolowerexitcyrusdb_quotalegacymemchrprot_flushimclient_servernameXS_Cyrus__SIEVE__managesieve_sieve_get_errorprot_setflushonreadprot_setlogTLSv1_client_method.XAKgoyLbhuJRkj2.catch_xmknodbecome_cyrus.XBKgoyLghuJRU53.init.errpfxfwritePerl_pop_scopesqlite3_openfree_hash_tablestrcmpprot_settlslock_nonblockinggetservbyname.XAKgoyLbhuJRkj2.shutdown_cbretry_readcmdtime_starttimerRSA_generate_keydb_strerrorX509_STORE_CTX_get_errormap_refreshlibcyrus_config_setswitchusleepX509_get_issuer_namelist_wcbcyrusdb_convertbuf_replace_alllibcyrus_config_setstringmydeleteprot_rewindPerl_formdir_hash_cqsortsasl_client_stepcyrusdb_flat.XBKgoyL5huJR0W_.init_sasl.sasl_startedprot_ungetclibcyrus_doneXS_Cyrus__SIEVE__managesieve_sieve_get_handlePQcleargetsocknameerrnoconvert_to_lowercasegetnameinfomystoredb_createmkstempprotgroup_insert.XBKgoyLbhuJR0i2.beautify_string.beautybufgetscriptvaluebsearch_ncomparestrstrsigactionsetscriptactiverenamePerl_sv_2mortalSSL_newkv_bsearchPL_stack_spstrcpyconstruct_hash_tableprot_flush_internalassertionfailedftruncatestring_compare_withfsyncgetscripthandle_responsePerl_newSVivxreallocimclient_clearflagsfcntlcyrusdb_berkeley_hashstrcmpsafememcmpgetuidX509_NAME_onelinemysql_real_escape_stringPerl_sv_setref_pv.XAKgoyLfhuJR033.global_recovery_lib_versionSSL_get_current_cipherhash_dellock_unlockcyrusdb_berkeley_nosyncdeflatecmdtime_settimermunmap_fxstatPL_stack_basefprintfprot_fgetsinitgroupsPerl_croaksqlite3_column_textcmdtime_netendstrlenbuf_appendmapsieve_free_netimclient_havetlscyrusdb_skiplisttoken_lookup__assertprot_addwaiteventinit_netXS_Cyrus__SIEVE__managesieve_sieve_put_fileinteractionPerl_call_svmysql_initprot_setisclient.XAKgoyLbhuJR0i2.totaltimesasl_getpropmysql_field_countXS_Cyrus__SIEVE__managesieve_sieve_put_file_withdestretry_writevPerl_save_intntohlbuf_setmap.XAKgoyLghuJRE63.sql_enginesmmapbuf_putc.XAKgoyLchuJR0r2.basis_64nonblock_method_descisieve_put_filentohsdeflateEndX509_STORE_CTX_get_error_depthPQescapeByteasasl_client_newstrconcatPL_tmps_ix_GLOBAL_OFFSET_TABLE_cmdtime_endtimermemcpycreate_tempfileXS_Cyrus__SIEVE__managesieve_sieve_get_global_errorgetgidbuf_appendbit32geteuidlibcyrus_initbuf_ensurestrncasecmpstring_comparestrprot_setreadcallbackSSL_writeisieve_listsyslogprot_unsetsaslSSL_CTX_set_default_verify_pathsisieve_deleteisieve_logoutdeflateParamssasl_decodePQstatus.XAKgoyLghuJRE63.dbengineprot_printstring.XAKgoyLghuJRU53.dbinitSSL_CTX_load_verify_locationsSSL_CTX_use_certificate_chain_fileunlinkprot_printliteralhash_enumerateprotgroup_newinflatehash_lookupSSL_get_sessionlibcyrus_config_getintprot_readmapisieve_activatecyrus_close_sockstrncpySSL_readsprintfinstalldataPerl_sv_freeimclient_getselectinfodetect_mitmXS_Cyrus__SIEVE__managesieve_sieve_putimclient_processoneeventsasl_encode64lexer_statesasl_errstringgetpeernamePL_naXS_Cyrus__SIEVE__managesieve_sieve_listimclient_authenticategetegiddeleteascriptclosedirsqlite3_preparecyrusdb_detectSSL_library_initfdatasync.XBKgoyLchuJR0r2.tmp_rsa_cb.rsa_tmpxstrndupsignals_add_handlers_DYNAMIC.XAKgoyLchuJR0r2.verify_errorPQfinishSSL_load_error_strings.XAKgoyLchuJR0r2.index_64strncmpdo_referrallcasemysql_errormysql_store_resultsqlite3_finalizePL_opparseint32cyrusdb_fromnamePerl_stack_growprot_readimparse_astringX509_get_subject_nameprot_writemysql_closebuf_init_robuf_copyprot_freePQresultStatusmysql_real_queryPerl_safesysfreeboot_Cyrus__SIEVE__managesievecyrusdb_copyfilecyrus_optionslock_reopenSSL_set_fdPQexecPQunescapeByteaparseerrorimclient_addcallbackinstallafile.XAKgoyLbhuJR0i2.cmdtime_enabledsasl_client_initopendir.XAKgoyLchuJR0r2.callbacks.XAKgoyLbhuJR0i2.nettimeprot_resettimeoutimparse_wordmpool_malloc.XBKgoyLbhuJR0i2.become_cyrus.uidPerl_upg_versionX509_STORE_CTX_get_current_certprot_getcmyclosegettimeofdayPQconnectdbmysql_fetch_rowlibrt.so.1SUNW_1.2libz.so.1SUNW_1.1libdb-4.8.solibsasl2.so.3libssl.so.0.9.8libcrypto.so.0.9.8/usr/local/lib '= '= v71G)'(UZ1a=]}\ m q u y }                 8?e ^a(}KBW|3du?9w:K5 i~ #!R!!S"%P%l%%%'((()K*c*h**+ +K+T++,,$,.,8,B,-.U;_;;;1>=>>>)?6?M?}???!@@@@@BALAlAvAAAPCCCCkDuD[ElEIJKNCOOOPPQRHVYVVVVWWX ZZxZZZS[[\\']]]^ __L`P`T`y```ab1b`bbbccd d!d+dddxiijjkkkkklm m!m+mmmmBnLnnnolooooopqq&qئ+4Ѫɫ=aŲ+:ZyGVvcWa$.Q[˽4>akԾ޾ .8TWM "8)uO)<oyV}I }#c)3RfRW<r|bhrW7Agq8OZs+5JT x{   |g *BL ~4+5w8%###$4%%%%%%|&&&&&&''-(\((({))*+-!---.I...0$11"2|34c4459Z99 ??????,@AB~BBBBB C7C* ?*B*kj*x* *8**κ*K*Y*/**F*M*uQ*R*S*X*\*^**m**=***k*ܙZ+=4+ 5+j+RN+O+JR+??`?{{{H{{{{{{{{4{ {{p{{{{M {{u{7{H6{6{9{9{{:{:{:{={?{3C{k{k{~t{t{t{u{Ku{Yu{uu{{{{{{z{{{ {.{{{{{P{,{{ {i{{{{`{P{{_{{C{D{E{XF{F{F{F{N{V{"X{NX{X{]{Oh{i{j{d{8{F{{{ؑ{{{{{Η{{9{{{{{{`{n{G{U{{{{{]t!M!q "Q8apaqq1!Q@A`aqQqaA "q8pQA1q@a`qaQQ! QQ"Q8QpQQQQQqQ!QaQѿQQQQ@Q`QQQQQQQQI "8p ɱٳٴIyA`ɞ٤ٴɸ%/[jj>jjjDjjtj.!j^"j(j <jKjNjPj [j^[j[j\j\j2]j]j]j^j_j-yj>zjzj}j~jjjjjjjAjBjBjICjTjUjbjj_jȐjHjrjjj/jћjTj0AFHWdckLqǏݏ2ڹ7Tooqqxx9|ȭ}}q}S qGqcrc|#_<_Bȕvbb-babHH HtHHH2HHHHH0HTHHH"H=HHHH/HJHHHHHHnHH HrHHHHHH)H\HHHH H Hm H Hy!H!H!H6.Djcf-  ! &%PCQ~~ ~/~1~q2~4~0Y~Y~0c~!k~V~1~~R~p~X~L~~~.L~M~S~X~]~҉~~˓~U sijiX/~ c0TK` %H> [!```ab:bibA  bVL i!"Ff%w͑.N4OPPUUhȱq;;;;;;*; ;!;U=tIZZ)[}[[=\\Q]]]b^^5_``-zTz>>Z.7{  -(^F^~6r%.a%8j:^n~ M # 5C5#5'5d5555T55E5s55L5z55d5+55U55-5S5555Ď5+ '=|?P]ԡEXlo1Cݦ&&&&&&''2(a(((I)`V)))*:+CDXIIIJJJ@LaNQRSaTT-UKUU#V9V9d#rѷ@>\-H K{YY[EO6a(mݫM&dz5# $ 5 |   ơ #t'%o$}$$$$$$$$ %$'$'$'$'!%'/%'$=/=eO=l=w==h=A=k=L=^Q=R=Ɂ==͒==AjB'&(@(Z((@AJbYY[[4(sN(sh(ssssU(%)~f@$CE[gzfHY[))o*+[+T??(@bEJJOOOVVm^T0|VC]# jYY^Ci^?z  n;?,###$;%&*+.P... 0+11)234j4459a99??3@:DpDlEE FCF"I,KKYbZ\\^0^``aa bcccedd)eeYffgghh*iijHjjkllmtnnopNrrs,ttuuwwy2yyy zz||7}q}}/~~,SI%,ς wx tkB# ÏqZ'*3**+9*&s+&P*Q**C***U*@+CJJRSTQUU?V++h~,.-++W,,-,-y,-,l,,-,,,,,=-C-),E3,E,E,E,E=,gG,g,g,gg,t,]JGQ,)-JXQX-$-ćˊ 00r1T223l3s4$4KZ1;1n1n1Z1Z22Z2L)LLLL LLLLLL LL<LPLjLLLLbLL L. LB LL<LLL0LL L7LL!L/L3L8L9L{:L ;L9=LN3=3=4ww5B @BBzBoBBasBBZB68~9j8r * G*-::@S:EW:::':::::::6::}$:oL:L:-M:s=v,Kvd;6@6A6QA6{A6A6C6zD6 R6W6Z6Z6b6c6d60d6d6i6j6k6k6 l6m60m6m6Qn6n6o6o6 q6+q6Nt6u6u6v6dv6kx6|6|6~6~6666k66636Đ66t66a6666"6A66666ʝ6L6ƻ66 6f666636`66н66C6p6666=66.66~666(668666w66F6v6666:6Y6666" 666/6Q6666666:66)6&-6-6f6k6m69n6lo6q6q6%x6Lx6{6{6~66<5n>5AG5M5X5rY54p5?m@6 A6G6:I6EJ6K6M6c6g66666"6k%6,6-?6?6C3yc  (T3fj ""/28;`<=e]8MGQMGbGnGFV+IVgVVbIxIxJxJLxkNxQx-VxJd%!!L-L4NNNQVR]ݥ*MM{RN99699#9E9UՍV   S       : ~ M d % 2 > K ZU^UI\u\ ^A_m_%>cmdabObikffhij~f&f&h&#i&Tss.s.s=xxx'LyIyIyIyI]zIzIzIH|I[|IH}Ih}I|}I}I}I1~I~II,II IoI|}M~kTLL*]|ɔcy44}44<4:44f[4*g4Ti4TP/E7rrlrɟrܡ_ǢܨWOhO995A'.,R,,޲ ?N??̩?^??Q??1?PPp2!=yڻ4zԼGtW$T0ccvdT"#[>>W?;AAAOOUSdSd`tlt\\\\\\\m\|\\\jijH TiH&W O"50Q28;<=LLLLLoLLLDLQELELXgK0ZoDDDDU [ k kk.i.#.>E.H#HsHHHHl-H}-H77~7V$747]7mVmnmmmmmpmmmmmm%mymmm mAm~mmmmmmmmVmpmmmm8mRmjmmmmm3mmtmmmm=mSmmmmmmmmm)mAmYmymmmmmmm+mmmm7mWmgmmmm6 mp m mmmmm:mVmpmmmmm'mmmm[mmmmmmm%mammmmHmmmmNm$mDm\mtm m m m@!m`!m{!m!m&mF'mY'mq'm'm'm(m$(mz(m(m)m)m *m$*mp*m*m*m*mK+ma+m+m,m0,mH,m-m..mi.m.mt/me0m0m0m1mz1m2m3mJ3m3m3m3m4m55mR5m5m5m5m6mf6m|6m6m7mC7mX7mu7m7m7m7m7m;8mi8m~8m8m29m!:m;:mS:mp:m:m:m:m;m];m;m;m <m&<m><m<m<m=m.=mp=m=m=mRk#G[)k) # #C_D_G_I_&J_~_F/H4J7YKgZgNNQ.S\ =OP4UPrQrZUrVrQ5VV\8_K_`5a=aCaeeef2ffbkmmKoqx{~uaa"b,b>bGbYbebwbbbbbbbb*c3cPcYcvcccc dd0d>ddddddeIe_effffpg{gXhchiiknnxxV|g|aacUdeeIffghikxllmnp>rrsrtuuvwxyoz|a}~C9bbk$ eIEgzic"|:Srӆx*Cog*Ӈ00*Oh1d1[1*K % WڊWɊ<<BQ)Y)_)K)g)m)oьٌތ2Ahѐ HQ˕{ 8nڛkLj5FƠנբ XX@XJXWX#Vx+ib22]2L%ַN ts<ytyĖ/]<xI;Ph<h=h;h;;PnP_'~().:QSVWqmtbp-T%,[4nRtC#$g$CRDE%FCMj#>m?U:vj:>>EONX;EafaJ@fQݠd TYޣazTAwϥ0/eyGΦ-JPdxwFD1D v _dhlptx|ľȾ̾ $(,b0j48<@,DY2#{ (R,@%DuHLTltx<x(,048<@DHLPTX\`tx|  $(,048DHLPTX\`dhlptx| $(,048<@DHLP`M @] V l$048/<dH LYPT3X\`<dPhlpotxu|a*+?{BF$]t!JC @Pn hhh,h8h <h(@h0Dh8pPh@`ThHPXhP@\hX0`h` dhhhhplhxphthxh|hhhhhph`hPh@h0h hhhhhhhh h(h0h8ph@`hHPhP@hX0h` hhhphxhhhh hhhhph`$hPXh@US[+u P'USVW,[â+E0 EP  E܋M؉$(;u0+4E+ƋjVV~jPPFE+NjjWWmwjPdPkGE0ju cM1HA%=tjLQ8@Ly W( P,MMԉtGWP WMԋ E0E؋M9~E03,_^[à PUSVW,[Ö)Eԋ8 EP E܋M$(;uu0+E =@\=@=@4E+NjjWWwjpP}PGE+ƋjVV:~jXP1P8FA4E+NjjWWwjPPGE+ƋjVV~jxPPF4E+NjjWW@wjP7P>GE+ƋjVV~jPPFEԉ8juMԋ1HA%=tjLQ@Ly WPMM؉tMWP}t E0sEԉ0EM9~Eԉ03,_^[à HP PUSVW[ &E0$(;u0+4E+ƋjVVK~juFPMFE+NjjWWw u PGE0ju,3_^[ÐUSVW<[%$H 00E؋8Mԋ +ȋUȋLA%=tjjQEA EЋE؋|L MLMċDE j<E̋E@\HxE@ @HUPUB@JEB B$@PB(EĉB,B0EЉE8[u#@Eăj]PTt @EEĉEЃj:uCt @P?7HPP4t @P0MQPu#t*XM؋DEȋMԉuhE0t*XM؋DEȋMԉ j Eă j2MĉAQPE܋Uĉ B 0{EЅ7 urFE؍XEԍE uԍMQPE0WG EuEuhE0E W@PE E0Eȃ PuWEWuj E@P,tPu uWE}}tK EpuE0:LE8tWuЍE0~t@$H 0 0E<Uċ+׋MȋLA%=uA Ej"jQE|E|EEЃPuPjPtG<t uH G @u:TEЃTPuPjPFjPELPWu WGjuuVW}tE܍EԋEE$E܍|EԍhEЍE؃ V;P2Ẽ W#PPuuuuuuP E PVuWEt VuW j0PP 8PjPP(PjPP,PnjPP0PIjtPP4xP$j@PP8@Pj@PP<PjtPP@PjtPPDPjtPPHPkj@PPLtPF PtPT06\MDEȋMĉ<_^[Ãp dP`UE PEPj EEUE PEPj EEUE PEPj EEUjjEPE PEPjEEÐUEuEj PEj@PE@tEj@PE@tEj@PEj@ PEj@$PÐUjEPbjEPÐU E u CEE uCEPEP=EE"E@+ЋEPPR t+PEP=E6CEEt E~+PEP=E;w*PEP=EE\utjPEt=EkE"t4E\t,PEP=E/EB@E0|pE9hUMЍDЉ;s)PEP=EDžE}t*PEP=EYjPEE}=E&E t,PEP=EjPEE}=EE t,PEP=EE@EPjP t,PEP=E/E@tE@ Dž;s5jPB@;r˸BCEE0|lE9dUMЍDЉ;s)PEP=E:EPCPEPEEt5DjEPB@~E(pE)dE X@E*<E0BDžDžA?CEPEP=EU0}C"} } t뻐 t 먃(} "똍B؃w$m {}BЃ x$y {c'E+и+RPt,CPEPEPEP=Ez;w&PEP=EDjEPB@=w$ E ,,,,,,,,,,<Tt\<UE PEPj EEUE PEPj EEUE PEPj EEUjjEPE PEPjEEÐUEjPЋEPE@UPEUHD E u E5EPEPE PBP EUHD EEÐU EtEE EUE PEPBP EEEEÐUEj@PÐUEU @;Bt EEt EEEEEE t E EEEEEEU;P}3EEPEE@;t EE@EEU;P|EEÐU$E@EE @EEEE;E}EEEt EEEEEE t E EEE܉EEE;E}WEEPEE@;} EbEEPEE@;~ E>E@EE;E|E;Eu EE;E} E EEÐUjE PEE@;Et EvEt EEEEEE EEEU;P}5EEPEE@;t EE@EEU;P|EEÐUEE EE =~EE;EsE@t$E@ tE@ t E@} EME@"t E@\uE @E E =~ EE@EE;ErEEUE PEPj EEUE PEPj EEUE PEPj EEUjjEPE PEPjEEÐUEPh,jjÐUEE@EujhXE=t#E=tE=tjhhE=EPEP tjhpEPEPEE(;EPEP=-EPEP tjhpEPEP=tjhEt EEEjEPЋEPEPEP)tjhREE)t+Et#EPEPEE)tEu݋E)tjhEPEPEE uEPEPEE=tE=tjhEt EUPEzE=EPEP tjhpEPEPEE(uEE)t+Et#EPEPEE)tEu݋E)tjhEPEPEE uEPEPEE=tjhEt EUPEwEPEPEE EPEP(tjhEPEP=.EPEP tjhpEPEP=tjhEt EEEjEPЋEPEPEP)tjhjhE tE=u EEsE u=E tjhEPEP=tjhEPEP=tjh EEEÐUEPhE P jE PEPEPEjEPEPEPEPEPEEuE@t EnEt\jhЋEPEt EE EUjjEPh0jBPE EEÐUEEPhDE P EPhTE P EPEPE P h\E PjE PEPEPEjEPE PEPEPEPEEuE @t EmEt\jhЋE$PEt EE EU$jjEPh`jBPE EEÐU jEPjPEj/EPEEu EE E@EEPEPjEPUhtDPujEPЋMD EEEÐUDžXEuEEpPEP_hht3uE |PE PEElhEPEEu;jhЋE PE hj@P EujEPmLLPhDE P lPhTE P Dždd;lDžHl+d=}l+dHjjEPhjLPDDuZjhЋE PE hj@P jEPjLPE]DPLPE P dHdd;l h\E PjE PjEPjLPEPPP`jXPEPEPEP`P\\uE@t E}\tijhЋE PXtXH DžHU jjHPhjBPEEEU EEjhhDE PjE PEPEPEE=Et EE EEEEPEP ubEPEP=#tjhTEPEP=tjhhEPhx|Eu`jEPUD*u1jEPЋMD EPhxEPhEPh'jjEPEPEPEPEEEEEEÐU EEhDE PjE PEPEPEE=Et EEEEEEPEP ubEPEP=#tjhTEPEP=tjhhEPjEPEЃ |Eu`jEPUD*u1jEPЋMD EPjEPEЃ EPjEPEЃ EPjEPEЃ &jjEPEPEPEPEEEEEEÐUEEPhE P jE PEPEPEjEPEPEPEPEPEEuE@t EkEt\jhЋEPEt EE EUjjEPhjBPE EEUEtEE EEPhEEUjhtE P EhEPEjEPEu>jhЋEPUjjE PhjBPEMEt EEEUjjEPBPjEPjEPEEÐUEEEPhE P jE PEPEPEE=uiEuE PEPEP EPEP_EPEP=tjhEPEPEjEPEPEPEPEPEEuE@t EaEtQjhЋE PEt EE EU jjEPh jBPEEEUEEPhE P jE PEPEPEE=uBEUPEPEP=tjhEPEPEjEPEPEPEPEPEEuE@t EkEt\jhЋE PEt EE EU jjEPh jBPE EEUE PEPj EEUE PEPj EEUE PEPj EEUjjEPE PEPjEEÐUEEE@t*E@UBE@EE@u֋EEEÐUEEE@t*E@UBE@EE@u֋EEEÐUE @tuE @EE @E EWu1^UBE@EE ~ ?E E@EEUBE@EE @uUBEEEÐU jEPEE;Eu:E=~EEEEjP?EE;~EPPu4EEPPEEÐU Eu8E EEE u<E E EEPEPEEÐU Eu@E EEE uDE E EEPEPEEÐUEEEEEHEE;E|zEEEUE PEPEЃEEtNE} EHE E@EE;E|,EEEUE PEPEЃEEuEt E UE ЉEEEEÐUE EEEE@tRE@.tFUE3ЋE@3ЉUEEE@EE@t E@.uE+ƒAEUE@PBPEP uE@Phj EE EE@uEEÐUE@TEEÐUE@`th|hht EU PljjU M‰ApEEÐUE@`th|hht jjЋE@lM‰ApEEUE@`th|hht E t"E @`uhhht EU PtEEÐUE@`th|hht EU EUEEÐU EuEEjjEEU PEUPEUPE@ EuEUDEEEt'E@ tE@ EEt E@ uEUP EEEÐUEEEEt'E;E tEEE@ EEtE;E uEu8EuEU@ EU@ B jEPÐUEu$E?E@\t E@\E&E@Pt HEEEÐUE@`th|h"ht Ejj@P u,jPjPЋEP\E9E@ E@\E@PE@xE@|EEÐU8E@`th|h@ht E@Xt E@PE@Pu E@\tEE@,E@,@DžPUE@,R0P UE@,R4PEj@,PPPt]PtRPtGE@,jj@PPPh\jjhxЋEP\EJE@,U@;B4s'EU@0BUE@,R4+PEP Dž`E@(tEj@(P`Eu'E@tIEPtE@tR;P1EEEhjdP E@dPPE@R ӋPP`EPjEPjjdPBPEt6UEPEPЃEǀEǀE@tt:E@duDžL DžLULPBtP Dž``E@luE@djjPE@dtPHE@pHH\\;P}DžL\+PLEXXX@ TXP;P|)XX@PXPEPBЃ XXt.X@+PL;~X@+PLTXXcLEEhjdP E@dDDE@R ӋDPEPjEPjjdPBPEjjPEtEu&uuP;\GEt*EukuauWP;\|IE@du&jhЋEP\E EEu@hjjPjPЋEP\EjjЋE@lM‰ApE@(t UEh@PB(P EUEh@PBP EEuu tEEEt%jPjPЋEP\ E@PEE@ t%EPEPu EEU@BEUP E@,t(UE@,RPUE@,R PE@ E@ %E@jPPjjPPhj5E@EE@l} dLڐlu'E@EEEjjEPh@jEPjEPPEPEP E@EEEjjEPhDjEPjEPPEPEP E@EEEjjEPhHjEPjEPPEPEP zE@EEEjjEPhLjEPjEPPEPEP *!E@EE@dtu<ڐE@EEEjEPPEPEP nE@EEEEPEPEE@EEEjjEPhPjEPjEPPEPEP zE@EEEjjEPhTjEPjEPPEPEP *!E@EE@dtu<ڐriE@EEPs}5l}$c} %.Ѓcd 뼃l#뱐z}Bw$L`z두E@E j%E PEEjE PPE PEP E@\u E@Pt E EE8^`] ]UEtEPhXEP EEPh`EP EEtEEEPE PEP EEÐU EE uhhEPEE EE@tE=}uE@EE@%uXjD PjPЋXX@XX;\$jEPEjEPEjP|T`TDŽdT@TTU`TDŽdT@TTU `TUdT@TE+Ev;T8`E+UTdT@TTU`TDŽdT@TTU`TUdT@TE+Ev;T8`E+UTdT@TT`\TdT@TTH`TDŽdT@TPPEPPPj@PBP PTP`PBP xx}1hjPPEPEPPxPPDžXX;\EpEXpEX@j@PxEXXEX@j@PjDP>X‹UD +BjPp@P Uj|PBP X@XX;\ 4jPPEPV thh.h Lt0PPEPxxt xEEElhdÐUjEPEPEPEPE PEPEEUjEPEPEPEPE PEPEEUtpljjEEEuEEEPEPEE}EEE@E/jEPEP thheh jjEPEPE PEPuEEU;Pu]Ej@PjjEPE PRCPF@ЃEU+PUEPEPUEj@PBP EEjEPEUjEPBP EE}.hjEPEPEDEPUEPEEU;P$EUptEU@Dj@PxEUX\EU@Dj@PjDP>MjD P;Et;Ej@PXuEj@PUjDP3MjD PjPEExEUptEU@Dj@PxEUX\EU@Dj@PjDP>M‹UD +BjPx@P UjEPBP E@EEU;P$3.jEPEP thhh EtEPEP%EEtplÐUjhEEEtE uhhh E@<;E thhh E PEP+0jE PEP thhh E U @;Bu Ejju;Ej@P}%E@Phj EE @uh4hh U E j@PBP U jEPBP jju3Ej@P}E@Phj EEu E@<Eu(U E@,REA;vjEPE2Ej@MjD P;Et4Ej@PXuEj@PUjDP3MjD PjPEEEEUptEU@Dj@PxEUX\EU@Dj@PjDP>M‹UD +BjPE@P UjEPBP E@EEU;P$:E@E]jEPS‰EjEP E]Ej@PjjEPRCPEPEE;EEEEUptEU@Dj@PxEUX\EU@Dj@PjDP>M‹UD +BjPE@P UjEPBP E@EE;E=XEj@P},=} =a=V] jEPS+ЋE PE U @;BUUE @PBP}5E@Phj EjEPEEaE U@BjEPEE} EE2E PEPjE PE@<EE|xtÐUlhdDžjjjjE u3jEP4}E YE@8t E@4th4hkh ]MUEj@PjB PAPjCPE@<ththqh jjEP }&E@Phj E@ Ejj@Ph(hPE@hhP ЋEPE@}DPh0j E ujEPWEPE Ej@P}FPh\j E ujEPEPE8 )E@ jPjhЋPjj؋Ћ\Ejj0@P UPPBP ;tDž DžjPDžE;P s5<@E;P rˋ]E@j@4Pp{]E@j@4PSjD8P>jDjDMjD P;EtZEpuE@Ej@PxEX]E@Ej@PjDP>MjD PjPxEEUptEU@Dj@PxEUX\EU@Dj@PjDP>M‹UD +BjP@P UjxPBP E@EEU;P$DEj@Pu*UjjEPBPh(jEEj@PEt*UjjEPBPhpjEE@(U@B(jEPEjEP裩xxv/UjjxPBPhjEAEE;x EjEP3U;s}Ej@PXuEj@PUjDP3MjD PjPЋE$EUptEU@Dj@PxEUX\EU@Dj@PjDP>MjD PjPЋE$EEUptEU@Dj@PxEUX\EU@Dj@PjDP>M‹UD +BjP@P UjEPBP E@EE;x}Ej@PXuEj@PUjDP3MD +AjPGP UxP$PBP EjEP螦x;lxEjEPyU;JEj@PXuEj@PUjDP3MjD PjP EEUptEU@Dj@PxEUX\EU@Dj@PjDP>M‹UD +BjP@P Uj PBP E@EjEP/U;jEP U‰EEuEU;PVjjtmu]MUEj@PBPA PCPjFPjEPEEu E ujEPEEEuDjju3Ej@P}E@Phj EEu"jjЋEP0jEPEuDjju3Ej@P}E@Phj EEjj+EEE@(ul||Eupxx]MUjjxPEPBP|PA(PCPh,j(EuEtjEP;EEu E ujEP7EEE UE PEPj EEUE PEPj EEUE PEPj EEUjjEPE PEPjEEÐU jjEE@u E[EtE t E@j.EPEEu EE E@EEPEPEEÐUjj EjjEjjEPhE PEPEE;E rjKhEEEE +EE Ej!EPEEUBEPEPEUEPRhhE PEPEE;E rjKh!UBE@EEEEEEE +EE E@u5jjhhE PEP;E |jKhIjEP EUEPRhhE PEP;E |jKhÐU EEtE uhhh E EE @t"E j@PE j@PE @tE j@PEE @tlE j@PEEuEPhj EE j@PEEuEPhj EjE PEEEÐUEEtE uhhh Džh DžhE @EEjEPuClPEPt+U EPBPtjEPuE @Ph,j EjEPE j@P?E @ t3jEPEEuEPhDj EE @tlE j@PEEuEPhj EE j@PEEuEPhj EjE PEEEÐUEtWE@tEj@PE@tEj@PEjPjEPÐUjjEEU PE@E@E@ EEEÐUEEÐUEEÐUEEÐUEEÐUjj EEtEuhLhh` Džd DždjEPЋEPEjhP Ej/@PlltlBUpPBP'hhuGu=E t2hEPtUpPBPhhuaE tDž\ Dž\\`E@Php`P jEP<EDE tPO`N`E`PEUPEEÐUEuhjhh E EjEPEEÐUEEEEuhzhh E EEt E@Et E@EtEu1`PE Pu EEEt2E@uEUBEPE PEEjjE P EEu7u E2E Phj EEjjXP\PE PEPEEu+jjE PXPhjEEPE P/EEPEPE P E@EjE PjEPEPjEPEUEPBPЋEPUEPEPBP E@EEU+PE+Pj EP EEuEPEPE UBE@EEU+PE+Pj EP EEuEPEPEzUBjhЋEPEU@BEj@PЋEPEPEPEujEPEEÐU DžE E@tFEj@PEPE PP UBE Ejj@PE PhPtjPjEPEPEPPEPEEUj/EP@EhEPEEtvjhUDEhEPt EE EhEPjEPEPRhE PE EEEEÐU UPBP$EU PBP EEPEPEEÐU UPBPEU PBPEEPEPEEÐUHjjEjj EEEhEPjhÉEhEPjE PEEt EA EaE܉EEEEtEU;t|EUBjEPEESjEPEE(Eh PtEh Pu]jE PPE PC P EU@;Bu4E@UdBUE@PBPЋEPjh؋UEHBEE؋E؋@EԋEԋU@BEMԋPEjj PEPhPjEPEEjEPE@EEE؋E@EEKE jE PhEPhEPTPEP%EU@;Bu4E@UdBUE@PBPЋEPjh؋UEHBEPP@LLP@BELPEPhP HÐULEjjEjj EDžDžE E@tFEj@PEPE PP UBE Ejj@PE PhPEt)j!E Pt @E j jP PE PP[ E EDžEjh@PhhPEtDžA DžaDžrB/BBjPjPh Pth PuUPڋjh PhPAPPhP jPKjP@@tjPE tE @u EU BEjj@PjPPDž; jE PPPPEPEEtPPjPEt/jPPPPEPEЃt9jPPPPEPEЃEEt!@;Dž;s5jP@;rjPEEEU, DžDžDžEj@PEPE PP UBEjj@PPhPtjPEt6E@uEUBEPPfhjP uJu@Et8hPthhP u5uEt#Phj Etijj\P`PPPu0jjP\PhjEVPPUEtEPPP Eu@ DžDž@tJE uBEtE@PEPPPAE@hPP hhP jPhhP uBu8hPthhP uZPhj EtE@PEPPPEePjPtWPh4j EtE@PEP)PPEEj@PEPEPP EPj P BU Bjj@P E@PPBP E@;uE@PBPjPE@;ut uPhXj Ejj@PPh|jEtE@PEPPP EX@ujPЋPEuPPEEUjEPEPEPEPE PEPkEEUjEPEPEPEPE PEP;EEUjEPjjEPE PEPEEÐUEEUE PEPB ЃEEPEPEtE@u EUPUE DP E @E Ph`_E P E @EEÐUE pCP E @E Ph`_E P E @EEUE PEPj EEUE PEPj EEUE PEPj EEUjjEPE PEPjEEÐUhjjjKUjjEPE PhjUE Phj ÐU,EEEء@E؉E܋E܉EԋEԃt EvEPEPEP EuEuE}4jjEPEPEPjjjhj(jKh`E t EEjhEEt*jEPPhtj Eh`PЃjjPЃ jh@PЃ haPЃh`P Ѓjjjhj hhP(Ѓj PXЃjjEE}hjEPP`ЃEEuEPP\ЃEEuEPPdЃEEtChEPP(Ѓ jEPPhj jjEE}hjlEPPЃEEtChLEPP(Ѓ jEPPhXj jj EE| E=?~htjE jjjPjPЃEEtchEPP(Ѓ jPЃjEPPhj EE EjjhEPEPPЃEEtREtEuEEEjEPjjPEPhjEEEÐUHt E_jPЃEEt*jEPPhj E EEÐUuhLhh8 jjjjjPЃEEt)jEPPhTj E EEÐU hE PP jPjEPPЃ EEt*jEPPhxj EEEEE@tkE@Phj Ej@PEEt%E@Phj EEEE@ujEPjEPPЃ EEt*jEPPhj E5EEEE@EEE@t2UE@PBPuEEE@u΋E@E@Ph j Ej/@PЋPRP U썅PBPEEt$E@Ph(j E?EEE@jEPjEPPЃ EEt*jEPPhxj EEEEE@E@PhTj Ej/@PPPUPBPEEtE@Phlj E-EEE@qjEPEEÐU]] M UEjj@PBPAPCPEE]ÐUEEt E EEEtEtEuhhh8 E@jPEP EEt5jEPjjPEPhjEEtUhjEP(ЃUE hPE PjEPjEP ЃEEEt E EEEjEPjjPEPhEPUjEP@ЃEEt(jEPjjPEPhEPEEUPEEEUjjEPE PjEPEEÐUjjEPE PjEPEEÐU EEtEuhhh8 UjEP@ЃEEt%jEPPh j EEEEÐUEE@tsEPEj@PBlЃuh<hh8 EU @BE PE j@PBlЃjjPEPh\jjjjE PjPЃEEt2jEPjjPEPhpjEEE PE j@PBlЃjjPEPhjE U@BEEÐUHEEEEtEuhhh8 Et E@Et E@hEPEPG EEt EE jjEP jjEP E E܋EEUjE PEPEPEPEP`ЃEEt EUPEt EUĉPEEtE@PEPXE@E^jEPjjPE PhjE-E=} =t뽐=uD릐EEEÐUjEPEPEPEPE PEPEEUhEPEPEPEPE PEPEEÐUPEEEEEtEuhhPh8 EuhhQh8 jjEP jjEP hEPE P EEt EENUjEPЃEEt-jEPPhj EeUjjjEPEPEPHЃEEt-jEPPhj E E t@E @t4E E܋EEUjjjEPEPEPЃE&UjjjEPEPEPЃEEuE=uEzEt EPE PEP tTEt'jEPEPEPEPEPEЃUjEPЃEEt*jEPPhj EEjEPEPEPEPEPEЃEEt$E}h0jEUjjjEPEPEPHЃEEt-jEPPhj E1UjjjEPEPEPЃEWUjjjEPEPEPЃECUjjjEPEPEPЃEE=tʃt됐%UjjjEPEPEPЃEE=]EtPUjEPЃEEt-jEPPhj EUjjjEPEPEPHЃEEt-jEPPhj EUjjjEPEPEPЃEWUjjjEPEPEPЃEOJUjjjEPEPEPЃE#E=} =t =ttE=EEtFUjEPЃEEt'jEPPhj EEE tE @PEPxE @E~E tE @PEPHE @jEPPhPj E0E=}=o띐=UD놐EEEÐULEEEtEuhhh8 E tEuhphh8 hEPEP EEt EEjjEP jjEP E E܋EEEEEEċEuyjjjEPjPЃEEt*jEPPhj EUjEPBlЃPhj UjE PEPEPEPEPЃEEEt|UjEPBlЃPhj UjEPB\ЃEEt+jEPPhj EE=u9UjEPBlЃPhj UE$PEPB`ЃEEtfEtE@PEPyE@E=u E.jEPjjPE Ph4jEEEEUjjjjEPEPEPEPE PEP%(EEÐUjjjjEPEPEPEPE PEP(EEÐUjjjjEPEPEPEPE PEP(EEÐUjjjjEPEPEPEPE PEPe(EEÐU0EEEԡtEԃuhhSh8 E tEuhphTh8 h\EPEP EEt EEjjEP E E܋EEEuyjjjEPjPЃEEt*jEPPhdj EUjEPBlЃPhj UjjjEPEPEPLЃEEtE=uEEEt{UjEPBlЃPhj UjEPB\ЃEЋEЃt*jEPPhj EE=u9UjEPBlЃPhj U؋EPEPB`ЃEEtfEtE@PEPE@E=u E.jEPjjPE PhjEEEEÐUEPjEPEPE PEP/EEÐUEPjEPEPE PEPEEÐU E EtE uh@hh8 UjEPBlЃPhPj UEPEPB`ЃEFRhpjE8jEPPhj EEttɐEEEÐUjE PEP EEUjE PEP EEU E EtE uh@hh8 UjEPBlЃPhj UjEPB\ЃEEt*jEPPhj E EEUE PEPj EEUE PEPj EEUE PEPj EEUjjEPE PEPjEEÐUjjEEuh`jEoE tj jE P E EEt EEjjEPjEPEPEPEPEPEP(EEÐUU EEPBPЋE PU jjEPEPBPEPEE @EEÐU]EE Phj jE PEE E@;uEHEEPE PEP |jEP@t*jEPPhj EjEPuhjEjEPEEuxjEPEEt_jEPE]MUEj@PBPAPCPEPEЃEEujEPEEujEPEEE]ÐUjjjjhEPTEEÐUjjjjhEP$EEÐUjjjjhEPEEÐUjEPÐU$EEtjEPEEE tjE PE EEtjEPE EEtjEPE EEtjEPE EEEUMȋEjD@PEEEEt)E@tEPh EP U‰EE t)E @tE PhEP U‰EEt)E@tEPh$EP U‰EEt)E@tEPh0EP U‰EEt)E@tEPh@EP U‰EEPhPEP U‰EjEPEjEPjEPt*jEPPhdj E EEEÐUEPEPEP EEÐU(EE Phj E PEPEjEPEEujEPE&Et8jEPPhj jEPEjEPEEEE;EjEPEP ЍEPREjEPEP ЍEPREjEPEPEPEPEPEЃEjEPjEPE@EEu E;E`jEPEEEÐUjjjjhEPDEEÐUjjjjhEPEEÐUjjjjhEPEEÐUjEPÐU EPEPEEt,jEPPhdj jEPEEEÐUU E@PBPЋE PU EPEPBP EEE PUBE @EEÐU$EEE Phj jE PjEPEPRE PEPEEt+jEPPhj EEjEPEEdjEPEjEPEjEPEjEPEjEPEPEPEPEPEЃEEujEPEEdvjEPEEt(jEPPhj EEEEÐUjjjjhEPTEEÐUjjjjhEP$EEÐUjjjjhEPEEÐUjEPÐU EE@EEEEEt EjjE@t?Et@PEPu$@u@u2jjEPhhPjKPEu@Ph j EEEÐUHEEÐUEEÐUEEÐU<EjjEjjEjjEjjEjjEh4jEtjEP DžEEEEEE&j,EPEEtDUBE@u E@EE@tE؃tjPEPEPh\jj:EPE܋E܃tU܈BE@E܋EPEPEPEPEPEPBЃEԋEԃt'EPhj EEEEtjEPEԃu!EPhj Ej/EPEЋEЃtE@EЋEЉ EjPEj.EPEЋEЃt _UЈBjjEPhhPjjjjPEPBЃE @PBPEPhhPjjjjPEPBЃt3PhLj jEPB ЃE3jjЋEPE@UԉPE@ỦPEEUEuh<hhhd E EEj@PB ЃEj@PE@tEj@PE@ tEj@ PE@tEj@PjEPEEÐUEj@PBЃt"E@Phxj EjjEEÐU EEEE@tGEPEPBPЋE@PEPEPE PBP E@UPE@t)MUjEPEPEPE PBPAЃt?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~.A@@@@>?456789:;<=  !"#$%&'()*+,-./0123ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/F?Ѓ0P @ $$$objtcpversionVERSIONobj, cbobj, name, dataCyrus::SIEVE::managesieve::sieve_getCyrus::SIEVE::managesieve::sieve_activateCyrus::SIEVE::managesieve::sieve_listCyrus::SIEVE::managesieve::sieve_deleteCyrus::SIEVE::managesieve::sieve_putCyrus::SIEVE::managesieve::sieve_put_file_withdest$$Cyrus::SIEVE::managesieve::sieve_put_fileCyrus::SIEVE::managesieve::sieve_logoutCyrus::SIEVE::managesieve::sieve_get_global_errorCyrus::SIEVE::managesieve::sieve_get_error$$$$$Cyrus::SIEVE::managesieve::sieve_get_handle%sbootstrap parameter::$%s object version %-p does not match %s%s%s%s %-p0.01XS_VERSION%s::%smanagesieve.cobj, name, outputobj, nameobj, filename, destnameobj, filenamepossible MITM attack: list of available SASL mechamisms changedcould not allocate memory for mech listsasl mech list emptymanagesievesasl initialization failednetwork initialization failedsieveservername, username_cb, authname_cb, password_cb, realm_cbBad callback Please enter your realmrealmPlease enter your authentication nameauthnamePlease enter your usernameusernameBig trouble Please enter your passwordpasswordfailure: %s%dgetaddrinfo: %s connectsieveSTRINGEOL1SASLSIEVEIMPLEMENTATIONSTARTTLSSASL=EOL2CAPABILITY AUTHENTICATE "%s" {%d+} AUTHENTICATE "%s" * protocol errorsieve://tcpLOGOUTreferral failedoknobyeactivereferralsaslBad protocol from MANAGESIEVE server: %s lost connectionATOMexpected spaceexpected stringexpected RPARENexpected RPARANexpected string2expected LPARENunexpected response code with OK responseexpected spexpected EOLDELETESCRIPT "%s" Deleting script: %sPUTSCRIPT "%s" {%d+} Putting script: %s.scriptno such filefile i/o errorrput script: internal error: couldn't open temporary fileput script: failed to finish readingput script: %sYou have the following scripts on the server: LISTSCRIPTS Expected ACTIVE Expected EOL %s <- Active Sieve Script %s SETACTIVE "%s" Setting script active: %s%s wwritefile: unable to open %s for writingGETSCRIPT "%s" EOLGetting script: %s/dev/nullopen() on /dev/null failed%s/cyrus_tmpfile_XXXXXXtemporary file pathname is too long in prot_flushIOERROR: creating directory %s: %mcyrusno entry in /etc/passwd for user %sunable to initialize groups for user %s: %sunable to set group id to %d for user %s: %snum too bigprot.c!s->writedecoding error: %s; %sno detail1.2.5created %scompress buffer of %u bytesdefailed to start %scompressiondata is %sflushs->writebad protstream passed to prot_errorend of file reachedzlib inflate error: %d %sError decompressing dataidle for too longselect() failed: %m<%ld<>%ld>growing compress buffer from %u to %u byteszlib deflate error: %d %sError compressing dataencoding error: %s; %ss->writewrite to protstream buffer failed: %swrite to big buffer failedIOERROR: fstating temp protlayer buffer: %mfailed to fstat protlayer buffertemp protlayer bufferError setting compression levels->cnt > 0%ld%lu%lld%llu%d%u%tu%td%zu%zd{%u+} {%u} NIL"%s"""%sreadstreams || extra_read_fd != PROT_NO_FDextra_read_fd == PROT_NO_FD || extra_read_flagoutsrcgroup->groupgroupitemprotgroup_delete(): can't find protstream in groupCan't unwind any moreTrying to unput wrong characterGIF87aGIF89aGZIPJPEGPNGPNG  imclient.cimclienthost143OKNOBADBYEimap%lu %d%lu internal error: invalid format specifier in imclient_send str"{%u+} {%u} sbufEOFfdwanttowriteresultreplycontextt%s: tlistmechlistAUTHENTICATE %a* inputoutput[ unable to get certificate from '%s' ] [ unable to get private key from '%s' ] [ Private key does not match the certificate public key ] verify error:num=%d:%s issuer= %s cert not yet valid cert has expired [ TLS engine: cannot seed PRNG ] [ TLS engine: cannot load CA data ] [ TLS engine: cannot load cert/key data ] Could not allocate 'con' with SSL_new() SSL_set_fd failed [ SSL_connect error %d ] [ SSL session removed ] STARTTLS[ TLS engine failed ] [ TLS negotiation did not succeed ] unable to install signal handler for %d: %mInternal error: fcntl F_GETFL failedfcntlIOERROR: fstating %s file%s%s: %m for failed to fstat %s fileIOERROR: mapping %s file%s%s: %mfailed to mmap %s fileshared%s;%sVirtual memory exhaustedlibcyr_cfg.copt > CYRUSOPT_ZERO && opt < CYRUSOPT_LASTcyrus_options[opt].opt == optcyrus_options[opt].t == CYRUS_OPT_STRINGcyrus_options[opt].t == CYRUS_OPT_INTcyrus_options[opt].t == CYRUS_OPT_SWITCH/tmp/var/imapskiplistunixcmysql/dbDBERROR: init() on %serror opening %s for readingerror fstating %serror opening %s for writing (%d)error reading buferror writing buf (%d)can't open old databasecan't open new databaser skiplist fileskiplistberkeleyberkeley-hashcyrusdb backend %s not supportedcyrusdb_flat.cdb && tidIOERROR: unlocking db %s: %mIOERROR: fstat on %s: %marchiving database file: %sDBERROR: error archiving database file: %sfname && retIOERROR: opening %s: %mdbIOERROR: %s %s: %mIOERROR: stating flat %s: %mcouldn't reopen %s: %m.NEWopening %s for writing failed: %m IOERROR: writing %s: %mflatcyrusdb_skiplist.ct->syncfd != -1%s/skipstampDBERROR: writing %s: %mDBERROR: reading %s, assuming the worst: %marchiving database file: %sDBERROR: error archiving database file: %sTYPE(ptr) == DUMMY || TYPE(ptr) == INORDER || TYPE(ptr) == ADDdb && db->map_len && db->fname && db->map_base && db->is_open && db->lock_statusskiplist: file not large enough for header: %s skiplist fileskiplist: invalid magic header: %sskiplist: version mismatch: %s has version %d.%dskiplist %s: MAXLEVEL %d in database beyond maximum %d skiplist %s: CURLEVEL %d in database beyond maximum %d DBERROR: %s: first node not type DUMMYDBERROR: %s: DUMMY has non-zero KEYLENDBERROR: %s: DUMMY has non-zero DATALENDBERROR: %s: DUMMY level(%d) != db->maxlevel(%d)db->lock_status == WRITELOCKEDDBERROR: writing skiplist header for %s: %mdb->is_open && db->lock_status == WRITELOCKEDdb->lock_status == UNLOCKEDIOERROR: %s %s: %mIOERROR: lock_shared %s: %mIOERROR: fstat %s: %mIOERROR: stat %s: %mIOERROR: open %s: %mskiplist: unlock while not lockedIOERROR: lock_unlock %s: %mdb != NULL && tidptr != NULLdb->current_txn == *tidptrdb->current_txn == NULLskiplist: closed while still lockedskiplist: %s is already open %d time%s, returning objectsIOERROR: opening %s: %mDBERROR: writing dummy node for %s: %mDBERROR: fsync(%s): %mlist_entdb != NULL && key != NULLdb != NULLprefixlen >= 0key && keylenmyconsistent(db, tid, 1) == 0DBERROR: retry_writev(): %mDBERROR: retry_write(): %mdb && tiddb->current_txn == tidIOERROR: writing %s: %mtid->syncfd != -1myconsistent(db, db->current_txn, 1) == 0DBERROR: skiplist %s: commit AND abort failedTYPE(ptr) == ADD || TYPE(ptr) == DELETEDBERROR: skiplist abort %s: ftruncate: %mdb %s, inconsistent pre-checkpoint, bailing out%s.NEWDBERROR: skiplist checkpoint: open(%s): %mDBERROR: skiplist checkpoint %s: ftruncate %mDBERROR: skiplist checkpoint: fdatasync(%s): %mDBERROR: skiplist checkpoint: rename(%s, %s): %mDBERROR: skiplist checkpoint: fsync(%s): %mdb %s, inconsistent post-checkpoint, bailing outskiplist: checkpointed %s (%d record%s, %d bytes) in %d second%s%04lX: DUMMY INORDER ADD DELETE COMMIT kl=%d dl=%d lvl=%d %04X offset=%04X skiplist inconsistent: %04X: ptr %d is %04X; eof is %04X skiplist inconsistent: %04X: ptr %d is %04X; db->compar() = %d DBERROR: skiplist recovery %s: no dummy node?DBERROR: skiplist recovery %s: dummy node KEYLEN != 0DBERROR: skiplist recovery %s: dummy node DATALEN != 0DBERROR: skiplist recovery %s: dummy node level: %d != %dDBERROR: lseek %s: %mDBERROR: %s: offset %04X padding not -1skiplist recovery %s: incorrect logstart %04X changed to %04Xskiplist recovery %s: skipped %d bytes of zeros at %04XDBERROR: skiplist recovery %s: %04X should be ADD or DELETEDBERROR: skiplist recovery %s: found a RECSIZE of 0, truncating corrupted file instead of looping forever...skiplist recovery %s: found partial txn, not replayingDBERROR: skiplist recovery %s: ftruncate: %mDBERROR: skiplist recovery %s: DELETE at %04X doesn't exist, skippingDBERROR: skiplist recovery %s: ADD at %04X exists, replacingDBERROR: skiplist recovery %s: node claims level %d (greater than max %d)DBERROR: skiplist recovery %s: fdatasync: %mskiplist: recovered %s (%d record%s, %ld bytes) in %d second%sskiplist%sinsufficient buffer size in hash_quota%s%c/%s/domain/%sroot/quota/fname && tidcyrusdb_quotalegacy.cIOERROR: unlocking %s: %mIOERROR: closing %s: %mIOERROR: writing %s: %mIOERROR: unlinking %s: %mfname && retIOERROR: stating quota %s: %mdbIOERROR: opening quota file %s: %mIOERROR: %s quota %s: %m%.*s!%s/root?/...%s%s.NEWIOERROR: creating quota file %s: %mIOERROR: locking quota file %s: %mIOERROR: writing quota file %s: %mIOERROR: writing quota file %s: failed to write %d bytesquotalegacyDBERROR: critical database situationDBERROR %s: %sDBMSG: %sincorrect version of Berkeley db: compiled against %d.%d.%d, linked against %d.%d.%dwrong db versionDBERROR: db_appinit failed: %sdb%dDBERROR: invalid berkeley_locks_max value, using internal defaultset_lk_maxDBERROR: set_lk_max(): %sDBERROR: invalid berkeley_txns_max value, using internal defaultset_tx_maxDBERROR: set_tx_max(): %sDBERROR: invalid berkeley_cachesize value, using internal defaultset_cachesizeDBERROR: set_cachesize(): %sDBERROR: dbenv->open '%s' failed: %sDBERROR: error exiting application: %scyrusdb_berkeley.cdbinitDBERROR: couldn't checkpoint: %sDBERROR: error listing log files: %sremoving log file: %sDBERROR: error removing log file: %sDBERROR: error listing database files: %sarchiving database file: %sDBERROR: error archiving database file: %sarchiving log file: %sDBERROR: error archiving log file: %sdbinit && fname && retDBERROR: opening %s (creating database handle): %sDBERROR: opening %s: %sDBERROR: closing %s: %sdbinit && dbDBERROR: error closing: %s(txn_id((DB_TXN *)*mytid) != 0)%s: reusing txn %luDBERROR: error beginning txn (%s): %s%s: starting txn %lumyfetchDBERROR: error fetching %s: %scbforeachDBERROR: error closing cursor: %sDBERROR: unable to create cursor: %sDBERROR: foreach cb() failedDBERROR: error advancing: %skey && keylenmystoreDBERROR: mystore: error beginning txn: %smystore: starting txn %lumystore: aborting txn %luDBERROR: mystore: error aborting txn: %smystore: committing txn %luDBERROR: mystore: error storing %s: %sdeleteDBERROR: mydelete: error beginning txn: %smydelete: starting txn %lumydelete: aborting txn %luDBERROR: mydelete: error aborting txn: %smydelete: committing txn %luDBERROR: mydelete: error deleting %s: %sdbinit && tidmycommit: committing txn %lumycommit: tried to commit an already aborted transactionDBERROR: mycommit failed on commit: %sabort_txn: aborting txn %luDBERROR: abort_txn: error aborting txn: %sberkeleyberkeley-nosyncberkeley-hashberkeley-hash-nosyncDBERROR: SQL backend could not execute mysql_init()executing SQL cmd: %sDBERROR: SQL query failed: %sno results from SQL cmdSTART TRANSACTIONCOMMITROLLBACK host='%s' port='%s' user='%s' password='%s' dbname='%s' requiressl='%d'DBERROR: SQL backend: %sSQL backend: %s BEGIN;COMMIT;ROLLBACK;BEGIN TRANSACTIONCOMMIT TRANSACTIONROLLBACK TRANSACTIONSQL engine %s not supportedSQL backend defaulting to engine '%s'SQL backend trying to connect to a hostSQL backend trying to open db '%s' on host '%s'%s using SSLDBERROR: SQL backend could not connect to host %sDBERROR: could not open SQL database '%s'SELECT * FROM %s LIMIT 0;CREATE TABLE %s (dbkey %s NOT NULL, data %s);DBERROR: SQL failed: %sdbcyrusdb_sql.cDBERROR: failed to start txn on %sSELECT * FROM %s WHERE dbkey = '%s';DBERROR: SQL failed %sSELECT * FROM %s WHERE dbkey LIKE '%s%%' ORDER BY dbkey;DELETE FROM %s WHERE dbkey = '%s';UPDATE %s SET data = '%s' WHERE dbkey = '%s';INSERT INTO %s VALUES ('%s', '%s');DBERROR: failed to %s txn on %scommitabortmysqlBLOBpgsqlBYTEAsqlitesqllockingstatingopeningfcntlconstruct_hash_table called without a starting tableconstruct_hash_table called without a sizememory pool without a blobmpool_malloc called without a valid poolInternal error: assertion failed: %s: %d%s%s: Xr"2BRbr"2BRbr"2BRbr p 0  oioNoO@uo`oClltt|X0*     Pd $,0Ptp   0&@)0GPGpGGGI`M`M@S^_0___ aefgm`mp q`qzzP~( aefgm`mp q`q {`{~8 aefg0m`mp q`qzzP~H aefg0m`mp q`q {`{~@``0М0   !"#$%&'()*+,-/0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ 0NO$Խ  \  p 8XPddh !"7>JPUh^m{H  T  PJPUh^d  0  P  p(  `Z  0 UhJT^`    ( UhJX^         0 ( UhJP^+      ( 5` B@ L UhJP^V"  "  "  "( UhJ\^]@8  `8  8  8( d=  k= q? M N @Qz UhJl^Pp  pp  p  p(  p|,  p   P < " < R a@q q; |  j UJ^    Щ  ( UhJP^P  p    (   UhJ^<`      ( UhJ^`      ( UhJ^   @  `  ( UhJP^и      0( UhJP^  0  P  p( UhJ^      ( @@ UhJ^    @  `( 'm 17 9@4 E L Q X b if qP  . . 0 D P0 0 , R UhJ(^@  `    ( a @% pc J Q X  @ @ ` P :,  C O`( \ h L sp@ n    bi     . . `))    0  0   0& @) UhJl^H@  @  @  A( 0A A pC' ,D 1pFd :FG E0G LPG QpG XG bG EPOS TNS iIU If `M ^0N iO @S  `Xp '_? ^0 _0 0_, u`_P _? UhJ^~0`  P`  p`  `( `  `  a E a Le Qf Xg j< b0k m( 0m( i`m m7 0o ' p0  q3 `q w z6 z6  {6 `{6 { P~, ~, ~     UJ^p      Ѐ(  !X / ;' Ѓ' L' `0 mPc y"  ' ' '   @X ^  ' ' %' :  E@ L` Q X b i` H@X R \u & 0 @^ 0 М0 , e0   '0  UhJ^dpP  p    ( UhJ\^z`      ( UhJ\^@  `    ( UhJ`^p      Ь( UhJP^`      ( e UhJP^UhJP^P  p    ( UhJP^`  `#M E  06I %1$ 4AGTn`  ~pkN  Q     %V . 5 `Z A   V c k  v          @T  X > h]  B   W 0tN    @   i  + : 4 d F [ e p<$ r y      x b PD  ~   /S  $ 05 , @Y : S f o v `  pL o  mP \   P$  i $ $5 A  T 8 ]  j v    0b 1     \   C lH$> 53 @HMbn@;& ~` k lP0 `@ !-`6 7 % =g F# Tbjs q6M Dl pv W @x$ $\P [g H s0 } P.  /6X `n    $DA k@) w@C]  \@k6 d4 1$ @  Wf' x,! 0Z( D A5- #+ 5EQu3 cm \  p0  g &3+< ;IQVDjqL |v3   0Ag : <  *x  39HU  el;1 xi  +]   7>S  \ l3` |   C & (DTn p   KS_ez c @B  k `@!< @  `C  "*& 5AH ]Q  q   ` ` k u7 D@%V 0I"l[hPm }i DD+  -J ")@2X 70! F WtDh u~A ` W @* : p"4 i@ vP1K d2Q A`P /=M6b WbxP,| (  M  2+ `  P/ 0  *AL ?IP oU\=# k l `i ` q> ,OV``t hг w`j_  @ p9]  '*  0,   P 7 @ C  j   X    l5   !@ !!+! :! K!U!y!E ! !X!!!!!"  2 "#M ""1"B"H"P- S"P d"t"b ~"1 ""W^ a"6+ "1 "9 Dp """"` #0 /#8=#Ш I#T#[#k#0" v#@v #P #h###<#$@P $  %$0 2$dT$e$$0n i@ $$$blib/arch/auto/Cyrus/SIEVE/managesieve/managesieve.socrti.svalues-Xa.cDdata.dataBbss.bssDrodata.rodatamanagesieve.cperlsieve_getpassperlsieve_simplecall_listcbglobalerrDpicdata.picdataisieve.cfstatlstat_xmknodsieve_disposemake_secpropsgetauthlinerefer_simple_cblex.cmystring.crequest.cgetsievenameviewafilewritefileutil.cprot.czalloczfreeis_incompressibleprot_flush_logprot_flush_encodeprot_flush_writebufferimclient.cimclient_eofimclient_writeastringimclient_writebase64imclient_inputauthresulttlsresultimclient_authenticate_subimclient_decodebase64set_cert_stuffverify_callbacktmp_rsa_cbtls_rand_inittls_init_clientengineimparse.csignals.csighandlernonblock_fcntl.cmap_shared.ciptostring.cxmalloc.clibcyr_cfg.ccyrusdb.cconverter_cbcyrusdb_flat.cabort_txnfree_dbnew_txnbuf_initmydonemysyncmyarchivemyopenmyclosestarttxn_or_refetchmyfetchfetchlockmyforeachmystoredb_createmydelete_mysql_commit_txncyrusdb_skiplist.cgetsyncfdclosesyncfdmyinitLEVELRECSIZESAFE_TO_APPENDnewtxn.XAKgoyLfhuJR033.global_recoveryread_headerwrite_headerupdate_lockwrite_lockread_locklock_unlocklock_or_refreshdispose_dbstring_comparefind_nodemyconsistentmyabortmycommitmycheckpointdumpcyrusdb_quotalegacy.cname_to_hashcharhash_quotaabort_subtxncommit_subtxnnew_subtxncompar_qr_mboxcompar_qrpath_to_qrscan_qr_dirtxn_proccyrusdb_berkeley.cdb_panicdb_errdb_msgmbox_comparopen_btreeopen_hashgettidcreate_nosyncstore_nosyncdelete_nosynccommit_nosynccyrusdb_sql.c_mysql_open_mysql_escape_mysql_exec_mysql_begin_txn_mysql_rollback_txn_mysql_close_pgsql_open_pgsql_escape_pgsql_exec_pgsql_begin_txn_pgsql_commit_txn_pgsql_rollback_txn_pgsql_close_sqlite_open_sqlite_escape_sqlite_exec_sqlite_begin_txn_sqlite_commit_txn_sqlite_rollback_txn_sqlite_closestart_txnselect_cbfetch_cbfinish_txnbsearch.cretry.cstrhash.cmpool.cnew_mpool_blobassert.ccrtn.s_END__START_ucase__iobfopenmpool_strdupPL_markstack_maxstrrchrPerl_newXS_flagsPerl_sv_2pv_flagsbuf_freebuf_appendcstrsqlite3_step_finisasl_disposeSSL_CTX_check_private_keystring_allocate.XAKgoyLfhuJR033.open_dbSSL_set_connect_stateinflateEndX509_verify_cert_error_stringX509_NAME_get_text_by_NIDprotgroup_freefreadauth_saslrandlvlxmallocstrcasecmpsafe_xstatprot_printfsignals_set_shutdowngai_strerrorstrlcatisieve_putmysql_fetch_lengthsPL_tmps_floorPerl_sv_2iv_flagsPL_Svsetuidsigemptyset.XAKgoyLbhuJR0i2.cmdtime_end.XAKgoyLghuJRE63.dbinitPQntuplesprot_settimeoutXS_Cyrus__SIEVE__managesieve_sieve_activate.XAKgoyLbhuJR0i2.cmdtime_start.XBKgoyLchuJR0r2.imclient_connect.didinitprot_removewaiteventPQgetvaluesqlite3_errmsgstrhashimclient_closestrlcpy__ctype.XAKgoyLbhuJR0i2.cmdtimestring_freelock_blocking.XAKgoyLchuJR0r2.issuer_CNmap_freeimclient_starttlssqlite3_column_bytesvsnprintfprot_setsaslstrcatPerl_newSVpvfSSL_CTX_set_tmp_rsa_callbackPerl_sv_newmortalPerl_new_versionbsearch_memprot_printastringprot_fillyyleximclient_writePerl_newSVpvnbuf_cstringhtonlbuf_cmpmpool_strndup.XAKgoyLchuJR0r2.peer_CNPerl_safesysmallocgetpwnamgetpidshowlistimclient_connectprot_putcprot_selectprotgroup_getelement.XBKgoyLbhuJREo2.retry_writev.iov_maxXS_Cyrus__SIEVE__managesieve_sieve_getbeautify_stringlock_sharedcyrusdb_backendsPerl_mg_setimparse_issequenceprot_newcyrusdb_initSSL_pendingiptostringfreeaddrinfoSSL_CTX_use_PrivateKey_filebuf_truncatebuf_appendhash_insertsetgidimparse_isatomsrandcyrusdb_done.XAKgoyLbhuJRUq2.sig_tblPerl_call_listatoiprot_setcompressbuf_printfreaddirdup2convert_to_uppercasePL_sv_undefprot_sasldecodememmovesignals_pollimparse_isnumberxstrdupperrorgetaddrinfobuf_getmapmemsetPerl_sv_setpvPerl_markstack_growprot_data_boundarySSL_CTX_ctrllseekstrcspnPQresStatusnew_mpoolfatalnonblockbeautify_copygetpassphraseprotgroup_copy.XAKgoyLchuJR0r2.verify_depthbuf_move_etextPerl_free_tmpsstrtoul.XAKgoyLchuJR0r2.charclasscyrusdb_sqlprotgroup_deletestrcasecmpfillin_interactionsxzmallocimclient_send.XBKgoyLbhuJR0i2.beautify_string.beautysizeisieve_getSSL_CTX_newstring_copybuf_resetmysql_real_connectmap_method_descPerl_croak_xs_usagesqlite3_closesasl_client_startSSL_CTX_remove_sessionPL_stack_max.XAKgoyLbhuJRkj2.gotsignalparseuint32bsearch_comparesocketXS_Cyrus__SIEVE__managesieve_sieve_deletedb_env_createsafe_to_use_quoteddeflateInit2_SSL_ctrlmysql_free_resultPerl_sv_derived_fromPL_sv_yesread_capabilityPL_markstack_ptrstrchrlibcyrus_config_getstringdb_versioninflateInit2_cyrusdb_berkeley_hash_nosyncXS_Cyrus__SIEVE__managesieve_sieve_logoutcyrus_mkdirprot_errorinit_saslPL_scopestack_ix.XAKgoyLbhuJR0l2.convert_to_compareprotgroup_resetPerl_vstringify.XAKgoyLghuJRU53.dbenvPL_unitcheckav_edata.XAKgoyLchuJR0r2.cmdcallback_freelistbuf_setcstrlibcyrus_config_setintsasl_errdetailcyrus_reset_stdioSSL_CTX_set_verifycmdtime_netstart_lxstatprot_putbufsasl_setpropcyrusdb_berkeleysasl_decode64Perl_vcmplibcyrus_config_getswitch.XAKgoyLbhuJR0i2.nettime_startSSL_connectSSL_clearPerl_push_scopePerl_get_svimclient_setflagsPL_curpadSSL_CIPHER_get_bitsPQerrorMessageretry_writeSSL_get_peer_certificate_PROCEDURE_LINKAGE_TABLE_.XAKgoyLbhuJR0i2.nettime_endfree_mpoolbuf_lensasl_encodefclosetls_start_clienttlsPerl_newSVpvtimesubPerl_sv_setivtolowerexitcyrusdb_quotalegacymemchrprot_flushimclient_servernameXS_Cyrus__SIEVE__managesieve_sieve_get_errorprot_setflushonreadprot_setlogTLSv1_client_method.XAKgoyLbhuJRkj2.catchbecome_cyrus.XBKgoyLghuJRU53.init.errpfxfwritePerl_pop_scopesqlite3_openfree_hash_tablestrcmpprot_settlslock_nonblockingSSL_freegetservbyname.XAKgoyLbhuJRkj2.shutdown_cbretry_readcmdtime_starttimerRSA_generate_keydb_strerrorX509_STORE_CTX_get_errormap_refreshlibcyrus_config_setswitchusleepX509_get_issuer_namelist_wcbcyrusdb_convertbuf_replace_alllibcyrus_config_setstringprot_rewindPerl_formdir_hash_cqsortsasl_client_stepcyrusdb_flat.XBKgoyL5huJR0W_.init_sasl.sasl_startedprot_ungetclibcyrus_doneXS_Cyrus__SIEVE__managesieve_sieve_get_handlePQcleargetsocknameerrnoconvert_to_lowercasegetnameinfomkstempprotgroup_insert.XBKgoyLbhuJR0i2.beautify_string.beautybufgetscriptvaluebsearch_ncomparestrstrsigactionsetscriptactiverenamePerl_sv_2mortalSSL_newkv_bsearchPL_stack_spstrcpyconstruct_hash_tableprot_flush_internalassertionfailedftruncatestring_compare_withfsyncgetscripthandle_responsePerl_newSVivxreallocimclient_clearflagsfcntlcyrusdb_berkeley_hashstrcmpsafememcmpgetuidX509_NAME_onelinemysql_real_escape_stringPerl_sv_setref_pv_lib_versionSSL_get_current_cipherhash_delcyrusdb_berkeley_nosyncdeflatecmdtime_settimermunmap_fxstatPL_stack_basefprintfprot_fgetsinitgroupsPerl_croaksqlite3_column_textcmdtime_netendstrlenbuf_appendmapsieve_free_netimclient_havetlscyrusdb_skiplisttoken_lookup__assertprot_addwaiteventinit_netXS_Cyrus__SIEVE__managesieve_sieve_put_fileinteractionPerl_call_svmysql_initprot_setisclient.XAKgoyLbhuJR0i2.totaltimesasl_getpropmysql_field_countXS_Cyrus__SIEVE__managesieve_sieve_put_file_withdestretry_writevPerl_save_intntohlbuf_setmap.XAKgoyLghuJRE63.sql_enginesmmapbuf_putc.XAKgoyLchuJR0r2.basis_64nonblock_method_descisieve_put_filentohsdeflateEndX509_STORE_CTX_get_error_depthPQescapeByteasasl_client_newstrconcatPL_tmps_ix_GLOBAL_OFFSET_TABLE_cmdtime_endtimermemcpycreate_tempfileXS_Cyrus__SIEVE__managesieve_sieve_get_global_errorgetgidbuf_appendbit32geteuidlibcyrus_initbuf_ensurestrncasecmpstring_comparestrprot_setreadcallbackSSL_writeisieve_listsyslogprot_unsetsaslSSL_CTX_set_default_verify_pathsisieve_deleteisieve_logoutdeflateParamssasl_decodePQstatus.XAKgoyLghuJRE63.dbengineprot_printstring.XAKgoyLghuJRU53.dbinitSSL_CTX_load_verify_locationsSSL_CTX_use_certificate_chain_fileunlinkprot_printliteralhash_enumerateprotgroup_newinflatehash_lookupSSL_get_sessionlibcyrus_config_getintprot_readmapisieve_activatecyrus_close_sockstrncpySSL_readsprintfinstalldataPerl_sv_freeimclient_getselectinfodetect_mitmXS_Cyrus__SIEVE__managesieve_sieve_putimclient_processoneeventsasl_encode64lexer_statesasl_errstringgetpeernamePL_naXS_Cyrus__SIEVE__managesieve_sieve_listimclient_authenticategetegiddeleteascriptclosedirsqlite3_preparecyrusdb_detectSSL_library_initfdatasync.XBKgoyLchuJR0r2.tmp_rsa_cb.rsa_tmpxstrndupsignals_add_handlers_DYNAMIC.XAKgoyLchuJR0r2.verify_errorPQfinishSSL_load_error_strings.XAKgoyLchuJR0r2.index_64strncmpdo_referrallcasemysql_errormysql_store_resultsqlite3_finalizePL_opparseint32cyrusdb_fromnamePerl_stack_growprot_readimparse_astringX509_get_subject_nameprot_writebuf_init_robuf_copyprot_freePQresultStatusmysql_real_queryPerl_safesysfreeboot_Cyrus__SIEVE__managesievecyrusdb_copyfilecyrus_optionslock_reopenSSL_set_fdPQexecPQunescapeByteaparseerrorimclient_addcallbackinstallafile.XAKgoyLbhuJR0i2.cmdtime_enabledsasl_client_initopendir.XAKgoyLchuJR0r2.callbacks.XAKgoyLbhuJR0i2.nettimeprot_resettimeoutimparse_wordmpool_malloc.XBKgoyLbhuJR0i2.become_cyrus.uidPerl_upg_versionX509_STORE_CTX_get_current_certprot_getcgettimeofdayPQconnectdbmysql_fetch_rowanotate anotateT  % H $T$$    W   X l5 X  ` -'WQc] #{u anotate| xX4Y~7\l TH=anotate 00anotate m y \  m q u  y ,} , , , , , , , , , < T t  \   <anotate anotate anotate8 401>==>=_L`L`8^P``]T` ]anotate( $ ~Hg@4Panotate anotate anotate anotate  @anotatex tp,048<@DHL0PPTX\`anotate @ xp| @   0&@)anotate MIPO^IN_D_`__pC``_0GPGpGGGI`M`M@S^_0___anotate 'b`|bab`kj ae fgm`mp  q$`q(z,z0P~48H aLePfTgXm\`m`pd qh`ql {p`{t~x| aefg0m`mp q`qzzP~ aefg0m`mp q`q {`{~anotate@ <8dŚ@ `$(,0`48<0@DМHLP0lptxЃ|0P @ľȾ̾ anotate anotate anotate @(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)setjmp.h 1.38 04/09/28 SMI@(#)setjmp_iso.h 1.2 04/09/28 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.16 09/07/02 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)inet.h 1.21 08/01/04 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)times.h 1.10 97/08/12 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)ioctl.h 1.9 92/07/14 SMI@(#)dirent.h 1.37 04/09/28 SMI@(#)dirent.h 1.36 04/09/28 SMI@(#)mode.h 1.10 98/01/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)ieeefp.h 1.22 04/10/18 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)ieeefp.h 2.12 04/10/23 SMI@(#)ipc.h 1.23 03/02/05 SMI@(#)sem.h 1.31 03/02/05 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)file.h 1.70 07/03/05 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)time.h 2.77 09/06/02 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)file.h 1.70 07/03/05 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.16 09/07/02 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)inet.h 1.21 08/01/04 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)time.h 2.77 09/06/02 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.16 09/07/02 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)time.h 2.77 09/06/02 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.16 09/07/02 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)time.h 2.77 09/06/02 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)ipc.h 1.23 03/02/05 SMI@(#)msg.h 1.34 03/02/05 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.16 09/07/02 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)file.h 1.70 07/03/05 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)time.h 2.77 09/06/02 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)grp.h 1.22 04/09/28 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)pwd.h 1.22 04/09/28 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.16 09/07/02 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)syslog.h 1.11 96/05/17 SMI@(#)syslog.h 1.11 03/06/10 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)sysexits.h 1.7 00/05/01 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)time.h 2.77 09/06/02 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)syslog.h 1.11 96/05/17 SMI@(#)syslog.h 1.11 03/06/10 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.16 09/07/02 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)sysexits.h 1.7 00/05/01 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)time.h 2.77 09/06/02 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.16 09/07/02 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)sysexits.h 1.7 00/05/01 SMI@(#)inet.h 1.21 08/01/04 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)time.h 2.77 09/06/02 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)time.h 2.77 09/06/02 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.16 09/07/02 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)syslog.h 1.11 96/05/17 SMI@(#)syslog.h 1.11 03/06/10 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)sysexits.h 1.7 00/05/01 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)time.h 2.77 09/06/02 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)file.h 1.70 07/03/05 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.16 09/07/02 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)sysexits.h 1.7 00/05/01 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)time.h 2.77 09/06/02 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)mman.h 1.47 09/06/15 SMI@(#)syslog.h 1.11 96/05/17 SMI@(#)syslog.h 1.11 03/06/10 SMI@(#)sysexits.h 1.7 00/05/01 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.16 09/07/02 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)time.h 2.77 09/06/02 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.16 09/07/02 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)inet.h 1.21 08/01/04 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)time.h 2.77 09/06/02 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.16 09/07/02 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)sysexits.h 1.7 00/05/01 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)time.h 2.77 09/06/02 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.16 09/07/02 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)syslog.h 1.11 96/05/17 SMI@(#)syslog.h 1.11 03/06/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)time.h 2.77 09/06/02 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.16 09/07/02 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)inet.h 1.21 08/01/04 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)syslog.h 1.11 96/05/17 SMI@(#)syslog.h 1.11 03/06/10 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)sysexits.h 1.7 00/05/01 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)time.h 2.77 09/06/02 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.16 09/07/02 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)syslog.h 1.11 96/05/17 SMI@(#)syslog.h 1.11 03/06/10 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)sysexits.h 1.7 00/05/01 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)time.h 2.77 09/06/02 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.16 09/07/02 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)syslog.h 1.11 96/05/17 SMI@(#)syslog.h 1.11 03/06/10 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)time.h 2.77 09/06/02 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.16 09/07/02 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)syslog.h 1.11 96/05/17 SMI@(#)syslog.h 1.11 03/06/10 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)dirent.h 1.37 04/09/28 SMI@(#)dirent.h 1.36 04/09/28 SMI@(#)sysexits.h 1.7 00/05/01 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)time.h 2.77 09/06/02 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)pthread.h 1.37 04/09/28 SMI@(#)sched.h 1.10 03/03/06 SMI@(#)syslog.h 1.11 96/05/17 SMI@(#)syslog.h 1.11 03/06/10 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.16 09/07/02 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)sysexits.h 1.7 00/05/01 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)time.h 2.77 09/06/02 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)syslog.h 1.11 96/05/17 SMI@(#)syslog.h 1.11 03/06/10 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.16 09/07/02 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)sysexits.h 1.7 00/05/01 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)time.h 2.77 09/06/02 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)time.h 2.77 09/06/02 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.16 09/07/02 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)time.h 2.77 09/06/02 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)time.h 2.77 09/06/02 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.16 09/07/02 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)syslog.h 1.11 96/05/17 SMI@(#)syslog.h 1.11 03/06/10 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)sysexits.h 1.7 00/05/01 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)time.h 2.77 09/06/02 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.16 09/07/02 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)syslog.h 1.11 96/05/17 SMI@(#)syslog.h 1.11 03/06/10 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)sysexits.h 1.7 00/05/01 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.16 09/07/02 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)syslog.h 1.11 96/05/17 SMI@(#)syslog.h 1.11 03/06/10 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)assert.h 1.10 04/05/18 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)time.h 2.77 09/06/02 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.16 09/07/02 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)sysexits.h 1.7 00/05/01 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ld: Software Generation Utilities - Solaris Link Editors: 5.10-1.497managesieve.cmanagesieve.xs /var/tmp/cyrus-imapd-2.4.17/perl/sieve/managesieve /opt/solstudio12.2/prod/bin/cc -c -I../lib/ -I../../../lib/ -I/usr/local/lib/include -I/usr/local/include -I/usr/local/include -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS='64' -DPERL_USE_SAFE_PUTENV -O -DVERSION='"0.01"' -DXS_VERSION='"0.01"' -KPIC -I/usr/local/lib/perl5/5.12.3/i86pc-solaris/CORE -DPERL_POLLUTE managesieve.cXa;O;P;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0{isieve.c /var/tmp/cyrus-imapd-2.4.17/perl/sieve/lib /opt/solstudio12.2/prod/bin/cc -c -I. -I../../.. -I. -I./../../../lib -I/usr/local/include -I/usr/local/include -I/usr/local/mysql/include -I/usr/local/include -I/usr/local/include -I/usr/include/gssapi -I/usr/local/include -I/include -I/usr/local/include -I/usr/local/lib/include -DHAVE_CONFIG_H -Dbool='char' -DHAS_BOOL -g isieve.c -W0,-xp.XAKgoyL5huJR0W_.Xa;g;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;G=.XAKgoyL5huJR0W_.;backend;raw;cd;DBG_GEN 5.3.0_statx0UOOc_pathr_bufr intcharV^unsigned longhdev_tlong  hino_thmode_thnlink_tuid_tgid_t off_ttime_t timespec7 tv_sec# tv_nsec#timestruc_tblksize_tblkcnt_tVy    stat st_devy# st_pad1# st_ino# st_mode# st_nlink# st_uid# st_gid# st_rdevy#$ st_pad2#( st_size#0 st_pad3#4 st_atim7#8 st_mtim7#@ st_ctim7#H st_blksizeI#P st_blocksY#T st_fstypeh#X st_pad4y#hlstat0PUO_path_buf VfstatPpUODO_fd_buf mknodpUO_path_mode y_devV sieve_dispose_.UOZobj^V sasl_connsasl_conn_tOvoid sasl_callback K idh# proc# context# sasl_callback_tKunsigned charfunsigned!DOOOOOOOOOOO+O7COV[ ssl_cipher_st( ' validO# name`# idh# algorithmsh# algo_strengthh# algorithm2h# strength_bitsO# alg_bitsO# maskh# mask_strengthh#$eSSL_CIPHER '8=OIOUOa8m ssl_method_stt versionO# ssl_new# ssl_clear# ssl_free# ssl_accept# ssl_connect# ssl_read# ssl_peek# ssl_write# ssl_shutdown#$ ssl_renegotiate#( ssl_renegotiate_check#, ssl_get_message#0 ssl_read_bytes&#4 ssl_write_bytes2#8 ssl_dispatch_alert>#< ssl_ctrlJ#@ ssl_ctx_ctrlV#D get_cipher_by_charD#H put_cipher_by_charP#L ssl_pending\#P num_ciphersh#T get_ciphert#X get_ssl_method #\ get_timeout #` ssl3_enc( #d ssl_version4 #h ssl_callback_ctrl@ #l ssl_ctx_callback_ctrlL #py   ssl3_enc_method O- 9 E ySSL_METHOD Q Vg Vv O q { O O O O  O O  bio_method_st( typeO# namel # bwrite # bread # bputs # bgets # ctrl # create # destroy # callback_ctrl #$ BIO_METHOD  bio_st@ method # callback # cb_arg# initO# shutdownO# flagsO# retry_reasonO# numO# ptr# next_bio #$ prev_bio #( referencesO#, num_readh#0 num_writeh#4 ex_data#8 V   O O V  V O5 stack_st  numO# data # sortedO# num_allocO# comp5#:STACK  crypto_ex_data_st  sk# dummyO#CRYPTO_EX_DATA  BIO ssl_st8 ` versionO# typeO# methodb # rbioq # wbioq # bbioq # rwstateO# in_handshakeO# handshake_funcv# serverO#$ new_sessionO#( quiet_shutdownO#, shutdownO#0 stateO#4 rstateO#8 init_buf#< init_msg#@ init_numO#D init_offO#H packetw#L packet_length|#P s2z#T s3l*#X d1)C#\ read_aheadO#` msg_callback1C#d msg_callback_arg#h hitO#l paramC#p cipher_list#t cipher_list_by_id#x enc_read_ctx&!#| read_hashC# expandS## enc_write_ctx&!# write_hashC# compressS## cert D# sid_ctx_length|# sid_ctxD# session># generate_session_idZD# verify_modeO# verify_callbackvD# info_callback~D# errorO# error_codeO# ctx8T# debugO# verify_result# ex_data# client_CA# referencesO# optionsh# modeh# max_cert_list# first_packetO# client_versionO# tlsext_debug_cb@T# tlsext_debug_arg# tlsext_hostname# servername_doneO# tlsext_status_typeO# tlsext_status_expectedO# tlsext_ocsp_ids# tlsext_ocsp_exts[T# tlsext_ocsp_respw# tlsext_ocsp_resplenO# tlsext_ticket_expectedO# initial_ctx8T#Ov`e buf_mem_st  lengthO# data# maxO#{BUF_MEM ff  f f0 /f  H conn_id_length|# cert_type|# cert_length|# csl|# clear|# enc|# ccl# cipher_spec_length|#8 session_id_length|#< clen|#@ rlen|#Dssl2_state_st z three_byte_headerO# clear_textO# escapeO# ssl2_rollbackO# wnum|# wpend_totO# wpend_buf# wpend_offO# wpend_lenO# wpend_retO#$ rbuf_leftO#( rbuf_offsO#, rbufw#0 wbufw#4 write_ptrw#8 padding|#< rlength|#@ ract_data_lengthO#D wlength|#H wact_data_lengthO#L ract_dataw#P wact_dataw#T mac_dataw#X read_keyw#\ write_keyw#` challenge_length|#d challenge#h conn_id_length|# conn_id# key_material_length|# key_material# read_sequenceh# write_sequenceh# tmp#f f@ ?f f@ ?f  f  |size_t ssl3_buffer_st= bufw# len# offsetO# leftO# SSL3_BUFFERunsigned long long ssl3_record_st$ typeO# length|# off|# dataw# inputw# compw# epochh# seq_numO#eSSL3_RECORDf  f fEVP_MD_CTX (OO9>OTO`OlOxOOO  env_md_stH typeO# pkey_typeO# md_sizeO# flagsh# initO# update[# finalg# copys# cleanup# sign#$ verify#( required_pkey_type#, block_sizeO#@ ctx_sizeO#DEVP_MD  engine_stENGINE  env_md_ctx_st% digest# engine# flagsh# md_data# f6 fG fX fi h bignum_st di# topO# dmaxO# negO# flagsO#nBIGNUM  bn_mont_ctx_stH* riO# RR# N# Ni#, n0h#@ flagsO#DBN_MONT_CTX *VA|OaKPOfOrO~OO dh_method$P nameF# generate_keya# compute_keym# bn_mod_expy# init# finish# flagsO# app_data# generate_params# DH_METHOD P` dh_stL| padO# versionO# p# g# length# pub_key# priv_key# flagsO# method_mont_p<# q#$ j#( seedw#, seedlenO#0 counter#4 referencesO#8 ex_data#< methe#D engine#HjDH ec_key_stEC_KEYV !EVP_CIPHER f f f  f   evp_cipher_ctx_st! cipher# engine# encryptO# buf_lenO# oiv# iv# buf#0 numO#P app_data#T key_lenO#X flagsh#\ cipher_data#` final_usedO#d block_maskO#h final #l EVP_CIPHER_CTX !f+!f5!O_!&!0!:!O?!Od!Op!O|!O!O! evp_cipher_st4" nidO# block_sizeO# key_lenO# iv_lenO# flagsh# init_!# do_cipherk!# cleanupw!# ctx_sizeO# set_asn1_parameters!#$ get_asn1_parameters!#( ctrl!#, app_data#0""V"V"6$ comp_ctx_stD# meth"# compress_inh# compress_outh# expand_inh# expand_outh# ex_data#"COMP_CTXD#Oi#S#X#n#Ov#O### comp_method_st 6$ typeO# name"# initi## finishq## compress}## expand## ctrl## callback_ctrl###COMP_METHOD ssl_comp_st $ idO# name"# method"#H$SSL_COMP $$}& cert_verify_md6# finish_mdG# finish_md_lenO# peer_finish_mdX# peer_finish_md_lenO# message_sizeh# message_typeO# new_cipher8# dhK# ecdh# next_stateO# reuse_messageO# cert_reqO# ctype_numO# ctype# ca_names# use_rsa_tmpO# key_block_lengthO# key_blockw# new_sym_enc"# new_hash"# new_compression$# cert_requestO#f@& ?f@& ?ssl3_state_st l* flags# delay_buf_pop_retO# read_sequence# read_mac_secret# write_sequence#P write_mac_secret#X server_random# client_random# need_empty_fragmentsO# empty_fragment_doneO# rbuf=# wbuf=# rrec# wrec# alert_fragment# alert_fragment_len|# handshake_fragment # handshake_fragment_len|# wnum|# wpend_totO# wpend_typeO# wpend_retO# wpend_buf## finish_dgst1(# finish_dgst2(# change_cipher_specO# warn_alertO# fatal_alertO# alert_dispatchO# send_alert%# renegotiateO# total_renegotiationsO# num_renegotiationsO# in_read_app_dataO# tmp$# previous_client_finished}&# previous_client_finished_lenf# previous_server_finished&# previous_server_finished_lenf# send_connection_bindingO#&f*f*unsigned short dtls1_bitmap_st* mapO# lengthh# max_seq_numO# *DTLS1_BITMAPf+  _pqueue++pqueue record_pqueue_sta+ epoch*# q#+#0+record_pqueueu+f+ f0+ /f + f +  sess_cert_st+ asn1_string_st%, lengthO# typeO# dataw# flags# +ASN1_INTEGER %,V=, asn1_object_st, snB,# lnB,# nidO# lengthO# dataw# flagsO#G,ASN1_OBJECT,OASN1_BOOLEAN +ASN1_STRING,+ASN1_ENUMERATED ,+ASN1_BIT_STRING -+ASN1_OCTET_STRING !-+ASN1_PRINTABLESTRING >-+ASN1_T61STRING ^-+ASN1_IA5STRING x-+ASN1_GENERALSTRING -+ASN1_BMPSTRING -+ASN1_UNIVERSALSTRING -+ASN1_UTCTIME -+ASN1_GENERALIZEDTIME .+ASN1_VISIBLESTRING ".+ASN1_UTF8STRING @. ASN1_VALUE_st[.ASN1_VALUEk.0 ptr# boolean,# asn1_string,# object,# integer8,# enumerated-# bit_string-# octet_string9-# printablestringY-# t61strings-# ia5string-# generalstring-# bmpstring-# universalstring-# utctime-# generalizedtime.# visiblestring;.# utf8stringV.# set,# sequence,# asn1_value|.# asn1_type_st@0 typeO# value.#0ASN1_TYPE@0 X509_algor_st0 algorithm,# parameterP0#U0X509_ALGOR 0 X509_name_st0 entries# modifiedO# bytes# hashh# 0X509_NAME 0+ASN1_TIME  1 X509_val_stW1 notBefore1# notAfter1# 1X509_VALW1Vk1fu1 rsa_stX2 padO# version# meth4# engine# n# e# d# p# q# dmp1#$ dmq1#( iqmp#, ex_data#0 referencesO#8 flagsO#< _method_mod_n<#@ _method_mod_p<#D _method_mod_q<#H bignum_data#L blinding4#P mt_blinding4#T1RSA 2O2Oz1w2O2O3O3O3O(3O43O@3OL3OX3Od3Op3 rsa_meth_st84 namep1# rsa_pub_enc2# rsa_pub_dec 3# rsa_priv_enc3# rsa_priv_dec#3# rsa_mod_exp/3# bn_mod_exp;3# initG3# finishS3# flagsO#$ app_data#( rsa_sign_3#, rsa_verifyk3#0 rsa_keygenw3#4|3RSA_METHOD 44 bn_blinding_st4BN_BLINDING 41V4f4 dsa_stD5 padO# version# write_paramsO# p# q# g# pub_key# priv_key# kinv# r#$ flagsO#( method_mont_p<#, referencesO#0 ex_data#4 meth7#< engine#@4DSA 5 DSA_SIG_st6 r# s#5DSA_SIG6!6A64O5&6OF6OR6O^6Oj6Ov6O6O6O6 dsa_method07 name4# dsa_do_signA6# dsa_sign_setupM6# dsa_do_verifyY6# dsa_mod_expe6# bn_mod_expq6# init}6# finish6# flagsO# app_data#$ dsa_paramgen6#( dsa_keygen6#,6DSA_METHOD 774j7 ptr# rsa4# dsa7# dh7# ec7# evp_pkey_st{8 typeO# save_typeO# referencesO# pkey7# save_parametersO# attributes#7EVP_PKEY {8 X509_pubkey_st 8 algor0# public_key-# pkey8#8X509_PUBKEY8 ASN1_ENCODING_st -9 encw# len# modifiedO#8ASN1_ENCODING x509_cinf_st4 : version8,# serialNumber8,# signature0# issuer1# validityf1# subject1# key8# issuerUID-# subjectUID-# extensions#$ enc-9#(A9X509_CINF : AUTHORITY_KEYID_st": X509_POLICY_CACHE_st<:X509_POLICY_CACHE S:f:  x509_cert_aux_st: trust# reject# aliasV.# keyid9-# other#:X509_CERT_AUX: x509_st\9< cert_info:# sig_alg0# signature-# validO# referencesO# name# ex_data# ex_pathlen# ex_pcpathlen#$ ex_flagsh#( ex_kusageh#, ex_xkusageh#0 ex_nscerth#4 skid9-#8 akid7:#< policy_cachek:#@ sha1_hashp:#D aux:#X:X509 9< ssl_session_st > ssl_versionO# key_arg_length|# key_arg+# master_key_lengthO# master_key+# session_id_length|#D session_id+#H sid_ctx_length|#h sid_ctx+#l not_resumableO# sess_cert+# peerD<# verify_result# referencesO# timeout# time# compress_methO# cipher8# cipher_idh# ciphers# ex_data# prev># next># tlsext_hostname# tlsext_tickw# tlsext_ticklen# tlsext_tick_lifetime_hint#I<I<SSL_SESSION > dtls1_retransmit_state? enc_write_ctx&!# write_hashz+# compressS## session># epoch*# hm_header_st,? typef# msg_lenh# seq*# frag_offh# frag_lenh# is_ccs|# saved_retransmit_state># dtls1_timeout_st ? read_timeouts|# write_timeouts|# num_alerts|#suseconds_t timeval:@ tv_sec# tv_usec?#fK@ f \@  dtls1_state_st)C send_cookie|# cookieq*# rcvd_cookie*# cookie_len|# r_epoch*# w_epoch*# bitmap*# next_bitmap*# handshake_write_seq*# next_handshake_write_seq*# handshake_read_seq*# last_write_sequence+# unprocessed_rcdsa+# processed_rcdsa+# buffered_messages#+# sent_messages#+# buffered_app_dataa+# listen|# mtu|# w_msg_hdr?# r_msg_hdr?# timeout?# next_timeout @# timeout_duration*# alert_fragment:@# alert_fragment_len|# handshake_fragmentK@# handshake_fragment_len|# retransmitting|# change_cipher_spec_ok|#\@.C X509_VERIFY_PARAM_st C name# check_time# inh_flagsh# flagsh# purposeO# trustO# depthO# policies#6CX509_VERIFY_PARAMCCC cert_stDf !D SSL !D+D|OUD0Dw5D:DUDGEN_SESSION_CB OoD{D x509_store_st@E cacheO# objs# get_cert_methods# paramC# verifyI# verify_cbI# get_issuerI# check_issuedI# check_revocationI# get_crlJ#$ check_crl J#( cert_crlJ#, cleanup$J#0 ex_data#4 referencesO#<DX509_STORE EIOEEEOEOEOEOEOFOFOFO(FO4F X509_POLICY_TREE_st@FX509_POLICY_TREE VF X509_crl_info_st(G version8,# sig_alg0# issuer1# lastUpdate1# nextUpdate1# revoked# extensions# enc-9#rFX509_CRL_INFOG X509_crl_st}G crl#G# sig_alg0# signature-# referencesO# (GX509_CRL }G x509_store_ctx_sttI ctxE# current_methodO# certD<# untrusted# crls# paramC# other_ctx# verifyE# verify_cbE# get_issuerE#$ check_issuedE#( check_revocationE#, get_crl F#0 check_crlF#4 cert_crl#F#8 check_policy/F#< cleanup;F#@ validO#D last_untrustedO#H chain#L treemF#P explicit_policyO#T error_depthO#X errorO#\ current_certD<#` current_issuerD<#d current_crlG#h ex_data#lGX509_STORE_CTX OIEIOIOIOIOIOIOJOJOJD lhash_node_st kJ data# nextkJ# hashh#.J.JLHASH_NODEpJJJJOJJJJJLHASH_COMP_FN_TYPEJhJJJJLHASH_HASH_FN_TYPE lhash_st`L bJ# compJ# hashJ# num_nodes|# num_alloc_nodes|# p|# pmax|# up_loadh# down_loadh# num_itemsh#$ num_expandsh#( num_expand_reallocsh#, num_contractsh#0 num_contract_reallocsh#4 num_hash_callsh#8 num_comp_callsh#< num_inserth#@ num_replaceh#D num_deleteh#H num_no_deleteh#L num_retrieveh#P num_retrieve_missh#T num_hash_compsh#X errorO#\ KOM>L M>M, )N sess_connectO# sess_connect_renegotiateO# sess_connect_goodO# sess_acceptO# sess_accept_renegotiateO# sess_accept_goodO# sess_missO# sess_timeoutO# sess_cache_fullO# sess_hitO#$ sess_cb_hitO#(O)NOUNOO5Npem_password_cbUNOpNO|NONNNNNNf N ONONfN f O fO OOO*Ossl_ctx_st@ *T methodb # cipher_list# cipher_list_by_id# cert_store)J# sessionsL# session_cache_sizeh# session_cache_head># session_cache_tail># session_cache_modeO# session_timeout#$ new_session_cbM#( remove_session_cbM#, get_session_cbM#0 stats M#4 referencesO#` app_verify_callback0N#d app_verify_arg#h default_passwd_callbackkN#l default_passwd_callback_userdata#p client_cert_cbwN#t app_gen_cookie_cbN#x app_verify_cookie_cbN#| ex_data# rsa_md5N# md5N# sha1N# extra_certs# comp_methods# info_callbackN# client_CA# optionsh# modeh# max_cert_list# cert D# read_aheadO# msg_callbackN# msg_callback_arg# verify_modeO# sid_ctx_length|# sid_ctxN# default_verify_callbackN# generate_session_idZD# paramC# quiet_shutdownO# client_cert_engine# tlsext_servername_callbackN# tlsext_servername_arg# tlsext_tick_key_nameN# tlsext_tick_hmac_keyN# tlsext_tick_aes_key O# tlsext_ticket_key_cb%O# tlsext_status_cb1O# tlsext_status_arg#6OSSL_CTX *T=T:X509_EXTENSIONSETfBytef `T|uInt huLong internal_stateT dummyO#Tvoidpf TTqTqTTTalloc_funcUTTTUfree_func z_stream_s8V next_inlT# avail_inqT# total_in|T# next_outlT# avail_outqT# total_out|T# msg# stateT# zallocT# zfreeU#$ opaqueT#( data_typeO#, adler|T#0 reserved|T#4Uz_streamVVVV=V&V+Vprot_readcallback_t=VV\V|V&V\VaVprot_waiteventcallback_t|V prot_waiteventV mark# procV# rock# next\V# protstreamY bufw# buf_size|# ptrw# cnt|# fdO# logfdO# big_bufferO# conn# saslssfO# maxplainO#$ tls_conn#( zstrmV#, zbufw#0 zbuf_size|#4 zlevelO#8 zflushO#< bigbuf_base!V#@ bigbuf_sizh#D bigbuf_lenh#H bigbuf_posh#L eofO#P boundaryO#T fixedsizeO#X error#\ writeO#` dontblockO#d dontblock_issetO#h read_timeoutO#l timeout_mark#p flushonread&V#t can_ungetO#x bytes_inO#| bytes_outO# isclientO# readcallback_procWV# readcallback_rock# waitevent\V# userdata#iseive_s(@Z serverFQDN# portO# sockO# conn# callbacksa# refer_authinfo# refer_callbacksa# versionO# pin&V# pout&V#$Yisieve_t!@Zsieve_free_netl0QUZOZobjkinit_nets`ZUOV[serverFQDNrOportr V[objrhints[tres0j\tresj\terrOuportstro\vsockOwOZ|socklen_t#*sa_family_t$V[  sockaddr$[ sa_familyk[# sa_data}[#[ addrinfo "j\ ai_flagsO# ai_familyO# ai_socktypeO# ai_protocolO# ai_addrlen[[# ai_canonname# ai_addr[# ai_nextj\#[V\ make_secprops`U]\OminOmax ret]|sasl_ssf_tV\\V\\ sasl_security_properties] min_ssf\# max_ssf\# maxbufsize|# security_flags|# property_names\# property_values]#]sasl_security_properties_t]init_saslUO^OZobjOssf acallbackssasl_startedOTsaslresultOsecprops]addrsize[[saddr_l"_saddr_r"_localip_remoteip_V^ double^sockaddr_maxalign_t$V"_sockaddr_storage$_ ss_familyk[# _ss_pad1^# _ss_align^# _ss_pad2_#V<_ ;V<_ ;read_capability@U`OZobjstate%acap attrval88``lenO&` lenO#`mystring_t&` lexstate_s%%a str`# numberO#`lexstate_t% detect_mitm6@UOa!OZobj5!mechlist5 new_mechlist7chO8rO8"getauthlineR UO(c!OZobjP! lineP !5DlinelenP! errstrpQstate%aSresOTretOUlenVerrstr`Wlast_sendXF,T,T,{,last_send_lenOf auth_sasl!UOd!mechlist!OZobj !dmechusing!dssf! errstrclient_interactesaslresultOouteoutlen|ininlen|inbase64einbase64len|statuseETTssfpeVdd\VdVdVde sasl_interact}e idh# challenged# promptd# defresultd# result e# len|#esasl_interact_t}eVeVe#!e$STAT_CONT$STAT_NO$STAT_OKeimt_stat!e"refer_simple_cb 0UObf!context!Oid !lfresult!5Dlen Vbfgf do_referral!UOh!OZobj !refer_to  retO"servh#obj_newOZ$mechlist%portO&errstr'mtriedh(schemei)host*p*callbacksa+ssf\,99authid4userid4nO58$$_$k$k$newlistmtrtmp servent"h s_name# s_aliases # s_portO# s_proto# hVhVh isieve_logoutLUO?i!V[obj isieve_put_filePUOi!OZobj!filename !destname! errstrrefer_toretO isieve_putUOj!OZobj!name !data!Olen! errstrrefer_toretO isieve_deleteFUO k!OZobj!name ! errstrrefer_toretO isieve_listPUOk!OZobj!kcb !rock! errstrrefer_toretOkOkisieve_listcb_t!k isieve_activatevUO\l!OZobj!name ! errstrrefer_toretO isieve_getVUOm!OZobj!name ! output! errstrretOrefer_tomystr`e%fillin_interactions0mmV0m&xstrdupUm5m&xmallocpm|[pm&iptostringOmum||%parseerrorm`m&getscriptvalueO nO&V&Vm  &setscriptactiveOGnO&V&V  k&list_wcbOnO&V&VGn &installdataOnO&V&VO  &installafileOoO&V&V  &deleteascriptO;oO&V&V  &handle_responseOroOO&V m`&yylexOoroVo&prot_printfOo&Vo'Vo&prot_writeOo&Vo|&prot_flushOp&V&prot_setsaslO>p&Vp&prot_freeO[p&V&prot_new&V|pOO&prot_ungetcOpO&V&prot_getcOp&V&ucasep%freepVp&atoiO qpV q&snprintfO=q|q'V=q%perror]qBqV]q&printfOqbq' __FILE'^r _cntO# _ptrw# _basew# _flagf# _filef# (__orientation|# (__ionolock|#  (__seekable|#  (__extendedfd|#  (__xf_nocheck|#  (__filler|#  qVcr&fprintfOr^rhr'Vr&sasl_encode64Orr||5DVr&sasl_decode64O sr||5DV smVs s&sasl_client_stepOgsps|s%s5DVgsVqsvsVss&sasl_client_startOsplss{s5DsVsVsVsVs sp&sasl_client_newOEtsssss|s Et&sasl_client_initOstJtst&sasl_setpropOtpOxttt&sasl_getpropOtpOtVtVttVt&sasl_errstringt/uOtt%sasl_disposeKusVKu&strdupouPuVouVyu&strncasecmpOutu~u|VuVu&strcasecmpOuuuVuVu&strstrvuuVv&strrchr@vvOV@v&strchrivEvOVivVsv&strncmpOvnvxv|Vv&strlenvvVv&strcpyvvVvVv&strcmpO"wvvV"w&strcatKw'w&memsetowO|ow&memcpywtw|&__posix_ttyname_rOwO|&__posix_getlogin_rOwO&usleepOx|&closeO*xOV*x&gai_strerror/xTxO%freeaddrinfopxj\VpxVzx[xj\&getaddrinfoOxuxxxxVxVx&getservbynamehxxx&socketOyOOO&getsocknameOHyO[&getpeernameOqyO[[qy&connectOyOvy|*uint16_t(&ntohsyyyOVy&_xmknodOzyyhhOVz&_lxstatO5zz zOV:z&_xstatOhz5z?zO&_fxstatOzhzOz&__posix_ctime_rzz tm$)]{ tm_secO# tm_minO# tm_hourO# tm_mdayO# tm_monO# tm_yearO# tm_wdayO# tm_ydayO# tm_isdstO# z]{)__posix_asctime_rb{^klex.c /var/tmp/cyrus-imapd-2.4.17/perl/sieve/lib /opt/solstudio12.2/prod/bin/cc -c -I. -I../../.. -I. -I./../../../lib -I/usr/local/include -I/usr/local/include -I/usr/local/mysql/include -I/usr/local/include -I/usr/local/include -I/usr/include/gssapi -I/usr/local/include -I/include -I/usr/local/include -I/usr/local/lib/include -DHAVE_CONFIG_H -Dbool='char' -DHAS_BOOL -g lex.c -W0,-xp.XAKgoyL5huJR0Y_.Xa;g;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;G=.XAKgoyL5huJR0Y_.;backend;raw;cd;DBG_GEN 5.3.0Bstatx`UII]_pathr_bufr intcharPXunsigned longbdev_tlong  bino_tbmode_tbnlink_tuid_tgid_t off_ttime_t timespec1 tv_sec# tv_nsec#timestruc_tblksize_tblkcnt_tPs    stat st_devs# st_pad1# st_ino# st_mode# st_nlink# st_uid# st_gid# st_rdevs#$ st_pad2#( st_size#0 st_pad3#4 st_atim1#8 st_mtim1#@ st_ctim1#H st_blksizeC#P st_blocksS#T st_fstypeb#X st_pad4s#hlstatUI_path_buf PfstatUI>I_fd_buf mknodUI_path_mode s_devP lexer_stateI?X token_lookupNUIstrMIlenM P yylexZm UIdlvalpYqclientY chI[bufferv\buff_ptr^buff_end_countbaresultIcsynchronizingIestreamlXh h  `  ` 4` <L <L \llnewcountb<itendXXnewcountb<SStokenI lenI#mystring_t lexstate_sS str # numberI#%lexstate_tSvoidiPunsigned charunsignedsasl_connsasl_conn_t gFIII I I I) I5 IA IM Y Ie Iq I}   P ssl_cipher_st( m validI# name # idb# algorithmsb# algo_strengthb# algorithm2b# strength_bitsI# alg_bitsI# maskb# mask_strengthb#$ SSL_CIPHER m ~  I I I ~  ssl_method_stt ? versionI# ssl_new# ssl_clear# ssl_free# ssl_accept # ssl_connect # ssl_read # ssl_peek$ # ssl_write0 # ssl_shutdown< #$ ssl_renegotiateH #( ssl_renegotiate_checkT #, ssl_get_message` #0 ssl_read_bytesl #4 ssl_write_bytesx #8 ssl_dispatch_alert #< ssl_ctrl #@ ssl_ctx_ctrl #D get_cipher_by_char #H put_cipher_by_char #L ssl_pending #P num_ciphers #T get_cipher #X get_ssl_methodK #\ get_timeoutW #` ssl3_encn #d ssl_versionz #h ssl_callback_ctrl #l ssl_ctx_callback_ctrl #p ? D P ssl3_enc_method\ Is    SSL_METHOD  P 1P I   I I I I  II". bio_method_st(  typeI# name # bwrite # bread # bputs # bgets# ctrl# create# destroy)# callback_ctrl5#$:BIO_METHOD  bio_st@  method# callback3# cb_arg# initI# shutdownI# flagsI# retry_reasonI# numI# ptrq# next_bio#$ prev_bio#( referencesI#, num_readb#0 num_writeb#4 ex_data#8P3II P=BGPQV[I{L`e stack_st numI# data8# sortedI# num_allocI# comp{#STACK crypto_ex_data_st  sk# dummyI#CRYPTO_EX_DATABIO ssl_st8  versionI# typeI# method # rbio # wbio # bbio # rwstateI# in_handshakeI# handshake_func# serverI#$ new_sessionI#( quiet_shutdownI#, shutdownI#0 stateI#4 rstateI#8 init_buf #< init_msgq#@ init_numI#D init_offI#H packet#L packet_length#P s2#T s3,#X d1oE#\ read_aheadI#` msg_callbackwE#d msg_callback_argq#h hitI#l param.F#p cipher_list#t cipher_list_by_id#x enc_read_ctxl##| read_hash8F# expand%# enc_write_ctxl## write_hashBF# compress%# certQF# sid_ctx_length# sid_ctxVF# session@# generate_session_idF# verify_modeI# verify_callbackF# info_callbackF# errorI# error_codeI# ctx~V# debugI# verify_result# ex_data# client_CA# referencesI# optionsb# modeb# max_cert_list# first_packetI# client_versionI# tlsext_debug_cbV# tlsext_debug_argq# tlsext_hostname# servername_doneI# tlsext_status_typeI# tlsext_status_expectedI# tlsext_ocsp_ids# tlsext_ocsp_extsV# tlsext_ocsp_resp# tlsext_ocsp_resplenI# tlsext_ticket_expectedI# initial_ctx~V#;I buf_mem_st  lengthI# data# maxI#BUF_MEM * ; 0L / ] H# conn_id_length# cert_type# cert_length# csl# clear# enc# cclL# cipher_spec_length#8 session_id_length#< clen#@ rlen#Dssl2_state_st  three_byte_headerI# clear_textI# escapeI# ssl2_rollbackI# wnum# wpend_totI# wpend_buf# wpend_offI# wpend_lenI# wpend_retI#$ rbuf_leftI#( rbuf_offsI#, rbuf#0 wbuf#4 write_ptr#8 padding#< rlength#@ ract_data_lengthI#D wlength#H wact_data_lengthI#L ract_data#P wact_data#T mac_data#X read_key#\ write_key#` challenge_length#d challenge#h conn_id_length# conn_id*# key_material_length# key_material;# read_sequenceb# write_sequenceb# tmp]## @ ? @  ?   + size_t ssl3_buffer_st buf# len+# offsetI# leftI# 8SSL3_BUFFERunsigned long long ssl3_record_st$0 typeI# length# off# data# input# comp# epochb# seq_num#SSL3_RECORDS d dEVP_MD_CTXnIIIIIIII  env_md_stH typeI# pkey_typeI# md_sizeI# flagsb# init# update# final# copy# cleanup# sign#$ verify#( required_pkey_type#, block_sizeI#@ ctx_sizeI#DEVP_MDengine_stENGINE env_md_ctx_stk digest# engine# flagsb# md_dataq# |    b bignum_st d# topI# dmaxI# negI# flagsI#BIGNUM bn_mont_ctx_stHp riI# RR# N# Ni#, n0b#@ flagsI#DBN_MONT_CTXpP!IIIIII dh_method$ name# generate_key# compute_key# bn_mod_exp# init# finish# flagsI# app_data# generate_params# DH_METHOD  dh_stL! padI# versionI# p# g# length# pub_key# priv_key# flagsI# method_mont_p# q#$ j#( seed#, seedlenI#0 counter#4 referencesI#8 ex_data#< meth #D engine#H DHec_key_st!EC_KEY!P! #EVP_CIPHER! "&" 7"  H"  Y"  evp_cipher_ctx_stW# cipher"# engine# encryptI# buf_lenI# oiv"# iv&"# buf7"#0 numI#P app_dataq#T key_lenI#X flagsb#\ cipher_dataq#` final_usedI#d block_maskI#h finalH"#lY"EVP_CIPHER_CTXW#q#{#I#l#v##I#I#I#I#I#I# evp_cipher_st4$ nidI# block_sizeI# key_lenI# iv_lenI# flagsb# init## do_cipher## cleanup## ctx_sizeI# set_asn1_parameters##$ get_asn1_parameters##( ctrl##, app_dataq#0!$$P$P$|& comp_ctx_st% meth%# compress_inb# compress_outb# expand_inb# expand_outb# ex_data# %COMP_CTX%I%%%%I%I%%% comp_method_st |& typeI# name%# init%# finish%# compress%# expand%# ctrl%# callback_ctrl%#%COMP_METHOD ssl_comp_st & idI# name$# method%#&SSL_COMP &&( cert_verify_md|# finish_md# finish_md_lenI# peer_finish_md# peer_finish_md_lenI# message_sizeb# message_typeI# new_cipher~ # dh# ecdh!# next_stateI# reuse_messageI# cert_reqI# ctype_numI# ctype!# ca_names# use_rsa_tmpI# key_block_lengthI# key_block# new_sym_enc$# new_hash$# new_compression&# cert_requestI#@( ?@( ?ssl3_state_st , flags# delay_buf_pop_retI# read_sequence# read_mac_secret# write_sequence#P write_mac_secret#X server_random # client_random# need_empty_fragmentsI# empty_fragment_doneI# rbuf# wbuf# rrec0# wrec0# alert_fragmentB# alert_fragment_len# handshake_fragmentS# handshake_fragment_len# wnum# wpend_totI# wpend_typeI# wpend_retI# wpend_bufi# finish_dgst1n# finish_dgst2n# change_cipher_specI# warn_alertI# fatal_alertI# alert_dispatchI# send_alertk# renegotiateI# total_renegotiationsI# num_renegotiationsI# in_read_app_dataI# tmp&# previous_client_finished(# previous_client_finished_len# previous_server_finished(# previous_server_finished_len# send_connection_bindingI#(,,unsigned short dtls1_bitmap_st6- map# lengthb# max_seq_num# ,DTLS1_BITMAPZ- _pqueueZ-d-pqueue record_pqueue_st- epoch,# qi-#v-record_pqueue-- 0- / -  . sess_cert_st . asn1_string_stk. lengthI# typeI# data# flags# .ASN1_INTEGERk.P. asn1_object_st. sn.# ln.# nidI# lengthI# data# flagsI#.ASN1_OBJECT.IASN1_BOOLEAN.ASN1_STRING/.ASN1_ENUMERATED1/.ASN1_BIT_STRINGL/.ASN1_OCTET_STRINGg/.ASN1_PRINTABLESTRING/.ASN1_T61STRING/.ASN1_IA5STRING/.ASN1_GENERALSTRING/.ASN1_BMPSTRING/.ASN1_UNIVERSALSTRING0.ASN1_UTCTIME00.ASN1_GENERALIZEDTIMEH0.ASN1_VISIBLESTRINGh0.ASN1_UTF8STRING0ASN1_VALUE_st0ASN1_VALUE0V2 ptr# boolean/# asn1_string,/# object/# integer~.# enumeratedG/# bit_stringb/# octet_string/# printablestring/# t61string/# ia5string/# generalstring/# bmpstring 0# universalstring+0# utctimeC0# generalizedtimec0# visiblestring0# utf8string0# set,/# sequence,/# asn1_value0# asn1_type_st2 typeI# value0#V2ASN1_TYPE2 X509_algor_st2 algorithm/# parameter2#2X509_ALGOR2 X509_name_st<3 entries# modifiedI# bytes # hashb# 2X509_NAME<3.ASN1_TIMEQ3 X509_val_st3 notBeforea3# notAftera3#f3X509_VAL3P33 rsa_stX5 padI# version# meth6# engine# n# e# d# p# q# dmp1#$ dmq1#( iqmp#, ex_data#0 referencesI#8 flagsI#< _method_mod_n#@ _method_mod_p#D _method_mod_q#H bignum_data#L blinding 7#P mt_blinding 7#T3RSA5IE5I35I 5IJ5IV5Ib5In5Iz5I5I5I5I5I5 rsa_meth_st86 name3# rsa_pub_encE5# rsa_pub_decQ5# rsa_priv_enc]5# rsa_priv_deci5# rsa_mod_expu5# bn_mod_exp5# init5# finish5# flagsI#$ app_data#( rsa_sign5#, rsa_verify5#0 rsa_keygen5#45RSA_METHOD66bn_blinding_st6BN_BLINDING63P7 7 dsa_stD#8 padI# version# write_paramsI# p# q# g# pub_key# priv_key# kinv# r#$ flagsI#( method_mont_p#, referencesI#0 ex_data#4 meth9#< engine#@*7DSA#8 DSA_SIG_stY8 r# s#28DSA_SIGY8g88%7I-8l8I8I8I8I8I8I8I8I8 dsa_method09 name7# dsa_do_sign8# dsa_sign_setup8# dsa_do_verify8# dsa_mod_exp8# bn_mod_exp8# init8# finish8# flagsI# app_data#$ dsa_paramgen8#( dsa_keygen8#,8DSA_METHOD99*7 !C: ptr# rsa7# dsa9# dh9# ec9# evp_pkey_st: typeI# save_typeI# referencesI# pkey:# save_parametersI# attributes#C:EVP_PKEY: X509_pubkey_st ; algor2# public_keyb/# pkey:#:X509_PUBKEY; ASN1_ENCODING_st s; enc# len# modifiedI#1;ASN1_ENCODING x509_cinf_st4S< version~.# serialNumber~.# signature2# issuerL3# validity3# subjectL3# key,;# issuerUIDb/# subjectUIDb/# extensions#$ encs;#(;X509_CINFS<AUTHORITY_KEYID_sth<X509_POLICY_CACHE_st<X509_POLICY_CACHE<<  x509_cert_aux_st'= trust# reject# alias0# keyid/# other#<X509_CERT_AUX'= x509_st\> cert_infoc<# sig_alg2# signatureb/# validI# referencesI# name# ex_data# ex_pathlen# ex_pcpathlen#$ ex_flagsb#( ex_kusageb#, ex_xkusageb#0 ex_nscertb#4 skid/#8 akid}<#< policy_cache<#@ sha1_hash<#D aux;=#X@=X509> ssl_session_st @ ssl_versionI# key_arg_length# key_arg-# master_key_lengthI# master_key-# session_id_length#D session_id-#H sid_ctx_length#h sid_ctx-#l not_resumableI# sess_cert.# peer># verify_result# referencesI# timeout# time# compress_methI# cipher~ # cipher_idb# ciphers# ex_data# prev@# next@# tlsext_hostname# tlsext_tick# tlsext_ticklen+# tlsext_tick_lifetime_hint#>>SSL_SESSION @ dtls1_retransmit_stateXA enc_write_ctxl## write_hash-# compress%# session@# epoch,# hm_header_st,A type# msg_lenb# seq,# frag_offb# frag_lenb# is_ccs# saved_retransmit_state@# dtls1_timeout_st ?B read_timeouts# write_timeouts# num_alerts#suseconds_t timevalB tv_sec# tv_usec?B#B  B  dtls1_state_stoE send_cookie# cookie,# rcvd_cookie,# cookie_len# r_epoch,# w_epoch,# bitmap6-# next_bitmap6-# handshake_write_seq,# next_handshake_write_seq,# handshake_read_seq,# last_write_sequenceI-# unprocessed_rcds-# processed_rcds-# buffered_messagesi-# sent_messagesi-# buffered_app_data-# listen# mtu# w_msg_hdrXA# r_msg_hdrXA# timeoutA# next_timeoutQB# timeout_duration,# alert_fragmentB# alert_fragment_len# handshake_fragmentB# handshake_fragment_len# retransmitting# change_cipher_spec_ok#BtE X509_VERIFY_PARAM_st F name# check_time# inh_flagsb# flagsb# purposeI# trustI# depthI# policies#|EX509_VERIFY_PARAMF3F=Fcert_stGF gF ;SSLgFqFIFvF{FFFGEN_SESSION_CB IFF x509_store_st@G cacheI# objs# get_cert_methods# param.F# verify L# verify_cbL# get_issuer"L# check_issued.L# check_revocation:L# get_crlFL#$ check_crlRL#( cert_crl^L#, cleanupjL#0 ex_data#4 referencesI#<FX509_STOREGKIHGHIHI&HI2HI>HIJHIVHIbHInHIzHX509_POLICY_TREE_stHX509_POLICY_TREEH X509_crl_info_st(UI version~.# sig_alg2# issuerL3# lastUpdatea3# nextUpdatea3# revoked# extensions# encs;#HX509_CRL_INFOUI X509_crl_stI crliI# sig_alg2# signatureb/# referencesI# nIX509_CRLI x509_store_ctx_sttK ctxG# current_methodI# cert># untrusted# crls# param.F# other_ctxq# verifyH# verify_cb!H# get_issuer-H#$ check_issued9H#( check_revocationEH#, get_crlQH#0 check_crl]H#4 cert_crliH#8 check_policyuH#< cleanupH#@ validI#D last_untrustedI#H chain#L treeH#P explicit_policyI#T error_depthI#X errorI#\ current_cert>#` current_issuer>#d current_crlI#h ex_data#lIX509_STORE_CTXI LGKILILI'LI3LI?LIKLIWLIcLF lhash_node_st L dataq# nextL# hashb#tLtLLHASH_NODELLiLiLILLLLLLHASH_COMP_FN_TYPEiMb4MM#M4MLHASH_HASH_FN_TYPE lhash_st`2O bL# compM# hash9M# num_nodes# num_alloc_nodes# p# pmax# up_loadb# down_loadb# num_itemsb#$ num_expandsb#( num_expand_reallocsb#, num_contractsb#0 num_contract_reallocsb#4 num_hash_callsb#8 num_comp_callsb#< num_insertb#@ num_replaceb#D num_deleteb#H num_no_deleteb#L num_retrieveb#P num_retrieve_missb#T num_hash_compsb#X errorI#\RMIMO@7ORO@ZO, oP sess_connectI# sess_connect_renegotiateI# sess_connect_goodI# sess_acceptI# sess_accept_renegotiateI# sess_accept_goodI# sess_missI# sess_timeoutI# sess_cache_fullI# sess_hitI#$ sess_cb_hitI#(IoPIPIIq{Ppem_password_cb PIPIPIPPPPPQ Q IQI%QBQ SQ dQ IdQIpQssl_ctx_st@ pV method # cipher_list# cipher_list_by_id# cert_storeoL# sessions2O# session_cache_sizeb# session_cache_head@# session_cache_tail@# session_cache_modeI# session_timeout#$ new_session_cbMO#( remove_session_cbUO#, get_session_cbaO#0 statsfO#4 referencesI#` app_verify_callbackvP#d app_verify_argq#h default_passwd_callbackP#l default_passwd_callback_userdataq#p client_cert_cbP#t app_gen_cookie_cbP#x app_verify_cookie_cbP#| ex_data# rsa_md5P# md5P# sha1P# extra_certs# comp_methods# info_callbackP# client_CA# optionsb# modeb# max_cert_list# certQF# read_aheadI# msg_callbackQ# msg_callback_argq# verify_modeI# sid_ctx_length# sid_ctxQ# default_verify_callback Q# generate_session_idF# param.F# quiet_shutdownI# client_cert_engine# tlsext_servername_callback,Q# tlsext_servername_argq# tlsext_tick_key_name1Q# tlsext_tick_hmac_keyBQ# tlsext_tick_aes_keySQ# tlsext_ticket_key_cbkQ# tlsext_status_cbwQ# tlsext_status_argq#|QSSL_CTXpVVX509_EXTENSIONSVBytef"VuInt"buLong" internal_state!V dummyI#Vqvoidpf"q WVVVW Walloc_func!HWVV6WHWfree_func! z_stream_s8!NX next_inV# avail_inV# total_inV# next_outV# avail_outV# total_outV# msg# stateV# zalloc%W# zfreeMW#$ opaqueV#( data_typeI#, adlerV#0 reservedV#4]Wz_stream!NXPbX1YXlXqqXprot_readcallback_t XXXXlXXqXprot_waiteventcallback_t X prot_waitevent 1Y mark# procX# rockq# nextX# protstream [ buf# buf_size# ptr# cnt# fdI# logfdI# big_bufferI# conn# saslssfI# maxplainI#$ tls_conn#( zstrm]X#, zbuf#0 zbuf_size#4 zlevelI#8 zflushI#< bigbuf_basegX#@ bigbuf_sizb#D bigbuf_lenb#H bigbuf_posb#L eofI#P boundaryI#T fixedsizeI#X error#\ writeI#` dontblockI#d dontblock_issetI#h read_timeoutI#l timeout_mark#p flushonreadlX#t can_ungetI#x bytes_inI#| bytes_outI# isclientI# readcallback_procX# readcallback_rockq# waiteventX# userdataq#P[[string_allocateI\I[[prot_ungetcI7\IlXprot_getcIT\lX__posix_ttyname_rI\I__posix_getlogin_rI\IP\P\strcmpI\\\tolowerI\IP\printfI!]]IP&]_xmknodIZ]!]+]bbIP_]_lxstatI]Z]d]IP]_xstatI]]]I_fxstatI]]I]__posix_ctime_r^] tm$#^ tm_secI# tm_minI# tm_hourI# tm_mdayI# tm_monI# tm_yearI# tm_wdayI# tm_ydayI# tm_isdstI# ^^__posix_asctime_r^} mystring.c /var/tmp/cyrus-imapd-2.4.17/perl/sieve/lib /opt/solstudio12.2/prod/bin/cc -c -I. -I../../.. -I. -I./../../../lib -I/usr/local/include -I/usr/local/include -I/usr/local/mysql/include -I/usr/local/include -I/usr/local/include -I/usr/include/gssapi -I/usr/local/include -I/include -I/usr/local/include -I/usr/local/lib/include -DHAVE_CONFIG_H -Dbool='char' -DHAS_BOOL -g mystring.c -W0,-xp.XAKgoyL6huJRkZ_.Xa;g;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;G=.XAKgoyL6huJRkZ_.;backend;raw;cd;DBG_GEN 5.3.0Astatx  USSg_pathr_bufr intcharZbunsigned longldev_tlong  lino_tlmode_tlnlink_tuid_tgid_t off_ttime_t timespec; tv_sec# tv_nsec# timestruc_tblksize_tblkcnt_tZ}    stat st_dev}# st_pad1# st_ino# st_mode# st_nlink# st_uid# st_gid# st_rdev}#$ st_pad2#( st_size#0 st_pad3#4 st_atim;#8 st_mtim;#@ st_ctim;#H st_blksizeM#P st_blocks]#T st_fstypel#X st_pad4}#hlstat  US_path_buf Zfstat 0 USHS_fd_buf mknod0 X US_path_mode }_devZ string_allocate=`  USSlength:buf; +str<Z  lenS#mystring_t& string_copyO 8 US&oldstrM+newstrN resultSPstring_free\@ V U+str[ string_compareb`  USB&str1a&str2a data1Bcdata2BdlupSeZ string_compare_withu $ US&str1s&str2s &comptdata1Bvdata2BwlupSxlen1Szlen2S{lowS} string_comparestr0  US&str1Bstr2 str2lenSdata1Bdata2BlupS safe_to_use_quoted US BstrSlen endBZ unsigned size_tstrlen* Q  voidQ Q ^ memcpyY  Y c  mallocY   free Y SZ _xmknodS   llSZ _lxstatS'   SZ, _xstatSZ ' 1 S_fxstatS Z S __posix_ctime_rB  B tm$O tm_secS# tm_minS# tm_hourS# tm_mdayS# tm_monS# tm_yearS# tm_wdayS# tm_ydayS# tm_isdstS#  O __posix_asctime_rBT Bj+request.c /var/tmp/cyrus-imapd-2.4.17/perl/sieve/lib /opt/solstudio12.2/prod/bin/cc -c -I. -I../../.. -I. -I./../../../lib -I/usr/local/include -I/usr/local/include -I/usr/local/mysql/include -I/usr/local/include -I/usr/local/include -I/usr/include/gssapi -I/usr/local/include -I/include -I/usr/local/include -I/usr/local/lib/include -DHAVE_CONFIG_H -Dbool='char' -DHAS_BOOL -g request.c -W0,-xp.XAKgoyL6huJRUa_.Xa;g;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;G=.XAKgoyL6huJRUa_.;backend;raw;cd;DBG_GEN 5.3.0statxUQQe_pathr_bufr intcharX`unsigned longjdev_tlong  jino_tjmode_tjnlink_tuid_tgid_t off_ttime_t timespec9 tv_sec# tv_nsec# timestruc_tblksize_tblkcnt_tX{    stat st_dev{# st_pad1# st_ino# st_mode# st_nlink# st_uid# st_gid# st_rdev{#$ st_pad2#( st_size#0 st_pad3#4 st_atim9#8 st_mtim9#@ st_ctim9#H st_blksizeK#P st_blocks[#T st_fstypej#X st_pad4{#hlstatUQ_path_buf XfstatUQFQ_fd_buf mknod(UQ_path_mode {_devX parseerrorI0RUstrHX handle_responseQ`2UQQresOQversionO VpinOurefer_toP9ZerrstrPstatelZRrQSresQunsigned charunsignedsasl_connsasl_conn_tDQ!Q)Q5QAQMQYQeQqQ}QQQX ssl_cipher_st(  validQ# name# idj# algorithmsj# algo_strengthj# algorithm2j# strength_bitsQ# alg_bitsQ# maskj# mask_strengthj#$SSL_CIPHER QQQ ssl_method_stt o versionQ# ssl_new# ssl_clear# ssl_free$# ssl_accept0# ssl_connect<# ssl_readH# ssl_peekT# ssl_write`# ssl_shutdownl#$ ssl_renegotiatex#( ssl_renegotiate_check#, ssl_get_message#0 ssl_read_bytes#4 ssl_write_bytes#8 ssl_dispatch_alert#< ssl_ctrl#@ ssl_ctx_ctrl#D get_cipher_by_char#H put_cipher_by_char#L ssl_pending#P num_ciphers#T get_cipher#X get_ssl_method{ #\ get_timeout #` ssl3_enc #d ssl_version #h ssl_callback_ctrl #l ssl_ctx_callback_ctrl #po t  ssl3_enc_method Q   SSL_METHOD  X nX Q   Q Q Q" Q. : QF QR ^ bio_method_st(  typeQ# name # bwrite # bread # bputs) # bgets5 # ctrlA # createM # destroyY # callback_ctrle #$j BIO_METHOD  bio_st@ * method& # callbackc# cb_arg# initQ# shutdownQ# flagsQ# retry_reasonQ# numQ# ptrp# next_bio*#$ prev_bio*#( referencesQ#, num_readj#0 num_writej#4 ex_dataY#8+ X/c*Q4Q9voidhXzXQ stack_st  numQ# datau# sortedQ# num_allocQ# comp#STACK  crypto_ex_data_st Y sk!# dummyQ#&CRYPTO_EX_DATA + BIO ssl_st8  versionQ# typeQ# method # rbio # wbio # bbio # rwstateQ# in_handshakeQ# handshake_func# serverQ#$ new_sessionQ#( quiet_shutdownQ#, shutdownQ#0 stateQ#4 rstateQ#8 init_bufG#< init_msgp#@ init_numQ#D init_offQ#H packet#L packet_length#P s2#T s3*#X d1C#\ read_aheadQ#` msg_callbackC#d msg_callback_argp#h hitQ#l paramkD#p cipher_list!#t cipher_list_by_id!#x enc_read_ctx!#| read_hashuD# expand## enc_write_ctx!# write_hashD# compress## certD# sid_ctx_length# sid_ctxD# session?# generate_session_idD# verify_modeQ# verify_callbackD# info_callbackE# errorQ# error_codeQ# ctxT# debugQ# verify_result# ex_dataY# client_CA!# referencesQ# optionsj# modej# max_cert_list# first_packetQ# client_versionQ# tlsext_debug_cbT# tlsext_debug_argp# tlsext_hostname# servername_doneQ# tlsext_status_typeQ# tlsext_status_expectedQ# tlsext_ocsp_ids!# tlsext_ocsp_extsT# tlsext_ocsp_resp# tlsext_ocsp_resplenQ# tlsext_ticket_expectedQ# initial_ctxT#xQ buf_mem_st 9 lengthQ# data# maxQ#BUF_MEM 9L g x 0 /  H` conn_id_length# cert_type# cert_length# csl# clear# enc# ccl# cipher_spec_length#8 session_id_length#< clen#@ rlen#Dssl2_state_st  three_byte_headerQ# clear_textQ# escapeQ# ssl2_rollbackQ# wnum# wpend_totQ# wpend_bufQ# wpend_offQ# wpend_lenQ# wpend_retQ#$ rbuf_leftQ#( rbuf_offsQ#, rbuf#0 wbuf#4 write_ptr#8 padding#< rlength#@ ract_data_lengthQ#D wlength#H wact_data_lengthQ#L ract_data#P wact_data#T mac_data#X read_key#\ write_key#` challenge_length#d challengeV#h conn_id_length# conn_idg# key_material_length# key_materialx# read_sequencej# write_sequencej# tmp#` @$ ?5 @F ? W  h size_t ssl3_buffer_st buf# lenh# offsetQ# leftQ# uSSL3_BUFFERunsigned long long ssl3_record_st$m typeQ# length# off# data# input# comp# epochj# seq_num#SSL3_RECORD  VEVP_MD_CTX QQQQQQQQ0  env_md_stH! typeQ# pkey_typeQ# md_sizeQ# flagsj# init# update# final# copy# cleanup# sign#$ verify#( required_pkey_type#, block_sizeQ#@ ctx_sizeQ#D0EVP_MD !.engine_st8ENGINE D env_md_ctx_st digest3# engineQ# flagsj# md_datap#     j bignum_st@ d# topQ# dmaxQ# negQ# flagsQ#BIGNUM @ bn_mont_ctx_stH riQ# RR@# N@# Ni@#, n0j#@ flagsQ#DRBN_MONT_CTX XQQQQQ Q dh_method$ name# generate_key# compute_key# bn_mod_exp# init# finish# flagsQ# app_data# generate_params # %DH_METHOD  dh_stL padQ# versionQ# pM# gM# length# pub_keyM# priv_keyM# flagsQ# method_mont_p# qM#$ jM#( seed#, seedlenQ#0 counterM#4 referencesQ#8 ex_dataY#< meth#D engineQ#HDH ec_key_st EC_KEY X7 #"EVP_CIPHER 7 H c t    evp_cipher_ctx_st! cipherM # engineQ# encryptQ# buf_lenQ# oivR # ivc # buft #0 numQ#P app_datap#T key_lenQ#X flagsj#\ cipher_datap#` final_usedQ#d block_maskQ#h final #l EVP_CIPHER_CTX !!!Q!!!!Q!Q!Q!Q!Q "Q" evp_cipher_st4# nidQ# block_sizeQ# key_lenQ# iv_lenQ# flagsj# init!# do_cipher!# cleanup!# ctx_sizeQ# set_asn1_parameters"#$ get_asn1_parameters"#( ctrl"#, app_datap#07 #!%#X/#X9#$ comp_ctx_st# methC## compress_inj# compress_outj# expand_inj# expand_outj# ex_dataY#H#COMP_CTX#Q####Q#Q$$$ comp_method_st $ typeQ# name>## init## finish## compress$# expand $# ctrl$# callback_ctrl$$#)$COMP_METHOD ssl_comp_st % idQ# name4## methodC##$SSL_COMP %%' cert_verify_md# finish_md# finish_md_lenQ# peer_finish_md# peer_finish_md_lenQ# message_sizej# message_typeQ# new_cipher# dh# ecdh! # next_stateQ# reuse_messageQ# cert_reqQ# ctype_numQ# ctype& # ca_names!# use_rsa_tmpQ# key_block_lengthQ# key_block# new_sym_enc ## new_hash*## new_compression%# cert_requestQ#@' ?@"' ?ssl3_state_st * flags# delay_buf_pop_retQ# read_sequence# read_mac_secret# write_sequence$#P write_mac_secret5#X server_randomF# client_randomW# need_empty_fragmentsQ# empty_fragment_doneQ# rbuf# wbuf# rrecm# wrecm# alert_fragment# alert_fragment_len# handshake_fragment# handshake_fragment_len# wnum# wpend_totQ# wpend_typeQ# wpend_retQ# wpend_buf# finish_dgst1# finish_dgst2# change_cipher_specQ# warn_alertQ# fatal_alertQ# alert_dispatchQ# send_alert# renegotiateQ# total_renegotiationsQ# num_renegotiationsQ# in_read_app_dataQ# tmp%# previous_client_finished'# previous_client_finished_len# previous_server_finished'# previous_server_finished_len# send_connection_bindingQ#"'++unsigned short dtls1_bitmap_sts+ map# lengthj# max_seq_num# ,+DTLS1_BITMAP+ _pqueue++pqueue record_pqueue_st+ epoch+# q+#+record_pqueue!+, 0$, / 5,  F, sess_cert_stF, asn1_string_st, lengthQ# typeQ# data# flags# Z,ASN1_INTEGER ,X, asn1_object_st-- sn,# ln,# nidQ# lengthQ# data# flagsQ#,ASN1_OBJECT--QASN1_BOOLEAN Z,ASN1_STRINGW-Z,ASN1_ENUMERATED n-Z,ASN1_BIT_STRING -Z,ASN1_OCTET_STRING -Z,ASN1_PRINTABLESTRING -Z,ASN1_T61STRING -Z,ASN1_IA5STRING -Z,ASN1_GENERALSTRING .Z,ASN1_BMPSTRING 3.Z,ASN1_UNIVERSALSTRING M.Z,ASN1_UTCTIME m.Z,ASN1_GENERALIZEDTIME .Z,ASN1_VISIBLESTRING .Z,ASN1_UTF8STRING .ASN1_VALUE_st.ASN1_VALUE.0 ptr# booleanD-# asn1_stringi-# object?-# integer,# enumerated-# bit_string-# octet_string-# printablestring-# t61string-# ia5string.# generalstring..# bmpstringH.# universalstringh.# utctime.# generalizedtime.# visiblestring.# utf8string.# seti-# sequencei-# asn1_value.# asn1_type_st0 typeQ# value/#0ASN1_TYPE0 X509_algor_st1 algorithm?-# parameter0#0X509_ALGOR 1 X509_name_sty1 entries!# modifiedQ# bytesG# hashj# (1X509_NAME y1Z,ASN1_TIME 1 X509_val_st1 notBefore1# notAfter1#1X509_VAL1X11 rsa_stXN3 padQ# version# meth!5# engineQ# nM# eM# dM# pM# qM# dmp1M#$ dmq1M#( iqmpM#, ex_dataY#0 referencesQ#8 flagsQ#< _method_mod_n#@ _method_mod_p#D _method_mod_q#H bignum_data#L blindingI5#P mt_blindingI5#T2RSA N3Q3Q1X3Q]3Q3Q3Q3Q3Q3Q3Q3Q3Q3Q3 rsa_meth_st8 5 name1# rsa_pub_enc3# rsa_pub_dec3# rsa_priv_enc3# rsa_priv_dec3# rsa_mod_exp3# bn_mod_exp3# init3# finish3# flagsQ#$ app_data#( rsa_sign3#, rsa_verify3#0 rsa_keygen3#43RSA_METHOD  55bn_blinding_st&5BN_BLINDING 752XS5]5 dsa_stD`6 padQ# version# write_paramsQ# pM# qM# gM# pub_keyM# priv_keyM# kinvM# rM#$ flagsQ#( method_mont_p#, referencesQ#0 ex_dataY#4 meth*8#< engineQ#@g5DSA `6 DSA_SIG_st6 rM# sM#o6DSA_SIG666b5Qj66Q6Q6Q6Q6Q6Q7Q7Q7 dsa_method08 nameX5# dsa_do_sign6# dsa_sign_setup6# dsa_do_verify6# dsa_mod_exp6# bn_mod_exp6# init7# finish 7# flagsQ# app_data#$ dsa_paramgen7#( dsa_keygen$7#,)7DSA_METHOD 8%8g5 8 ptr# rsaN5# dsa/8# dh48# ec98# evp_pkey_st8 typeQ# save_typeQ# referencesQ# pkey>8# save_parametersQ# attributes!#8EVP_PKEY 8 X509_pubkey_st W9 algor#1# public_key-# pkey 9#9X509_PUBKEYW9 ASN1_ENCODING_st 9 enc# len# modifiedQ#n9ASN1_ENCODING x509_cinf_st4: version,# serialNumber,# signature#1# issuer1# validity1# subject1# keyi9# issuerUID-# subjectUID-# extensions!#$ enc9#(9X509_CINF:AUTHORITY_KEYID_st:X509_POLICY_CACHE_st:X509_POLICY_CACHE :;  x509_cert_aux_std; trust!# reject!# alias.# keyid-# other!#;X509_CERT_AUXd; x509_st\< cert_info:# sig_alg#1# signature-# validQ# referencesQ# name# ex_dataY# ex_pathlen# ex_pcpathlen#$ ex_flagsj#( ex_kusagej#, ex_xkusagej#0 ex_nscertj#4 skid-#8 akid:#< policy_cache:#@ sha1_hash:#D auxx;#X};X509 < ssl_session_st ? ssl_versionQ# key_arg_length# key_arg,# master_key_lengthQ# master_key,# session_id_length#D session_id$,#H sid_ctx_length#h sid_ctx5,#l not_resumableQ# sess_certU,# peer<# verify_result# referencesQ# timeout# time# compress_methQ# cipher# cipher_idj# ciphers!# ex_dataY# prev?# next?# tlsext_hostname# tlsext_tick# tlsext_ticklenh# tlsext_tick_lifetime_hint#<<SSL_SESSION ? dtls1_retransmit_state? enc_write_ctx!# write_hash+# compress## session?# epoch+# hm_header_st,#@ type# msg_lenj# seq+# frag_offj# frag_lenj# is_ccs# saved_retransmit_state?# dtls1_timeout_st |@ read_timeouts# write_timeouts# num_alerts#suseconds_t timeval@ tv_sec# tv_usec|@#@  @  dtls1_state_stC send_cookie# cookie*# rcvd_cookie+# cookie_len# r_epoch+# w_epoch+# bitmaps+# next_bitmaps+# handshake_write_seq+# next_handshake_write_seq+# handshake_read_seq+# last_write_sequence+# unprocessed_rcds+# processed_rcds+# buffered_messages+# sent_messages+# buffered_app_data+# listen# mtu# w_msg_hdr?# r_msg_hdr?# timeout#@# next_timeout@# timeout_duration+# alert_fragment@# alert_fragment_len# handshake_fragment@# handshake_fragment_len# retransmitting# change_cipher_spec_ok#@C X509_VERIFY_PARAM_st SD name# check_time# inh_flagsj# flagsj# purposeQ# trustQ# depthQ# policies!#CX509_VERIFY_PARAMSD!pD!zDcert_stD D xSSL DDQDDDDDGEN_SESSION_CB QDD x509_store_st@&F cacheQ# objs!# get_cert_methods!# paramkD# verifyGJ# verify_cbSJ# get_issuer_J# check_issuedkJ# check_revocationwJ# get_crlJ#$ check_crlJ#( cert_crlJ#, cleanupJ#0 ex_dataY#4 referencesQ#<EX509_STORE &F!JQRFZlexstate_t" deleteascript@,UQY[QversionVpout Vpinnameurefer_touerrstrpstatelZresQretQerrstr4Z installdata0\UQV\QversionVpout VpinscriptnamedataQlenurefer_to uerrstrp$resQretQerrstr4ZstatelZgetsievename`U\filenameretptrinstallafile,`UQ^Qversion)Vpout) Vpin)filename*destname*urefer_to+uerrstrp+ stream_-filestats.sizeQ/resultQ0cntQ1resQ2retQ3errstr4Z4statelZ5sievename66>H,H,buf_[amountQ\nQ] __FILE#y_ _cntQ# _ptr# _base# _flag# _file# __orientation#  __ionolock#   __seekable#   __extendedfd#   __xf_nocheck#   __filler#  ^FILE$y_X_showlist`UQ`QversionVpout Vpinurefer_tostatelZendQresQretQ strlist_wcb UQaQversionVpout Vpinbcbprockurefer_tostatelZendQresQretQSSSSttstrpaQpaisieve_listcb_t%asetscriptactiveUQbQversionVpout Vpinnameurefer_touerrstrpstatelZresQretQerrstr4ZviewafileUQ5c4Zdataname writefile!UQc4Zdata name  uerrstrp stream_"scrname$getscript=@!UQdQversion:Vpout: Vpin;name;Qsave;urefer_to<uerrstrp< resQ>errstr4Z?statelZ@retQAgetscriptvalueh@!|"UQeQversioneVpoute Vpinfnamef9Zdatafurefer_toguerrstrpg resQiretQjerrstr4ZkstatelZlXe!xstrdupee!xmallocpe>Z!yylexQ fepX f!prot_printfQ8fVf"X8f!prot_writeQjfV=f!prot_flushQfVXf!strconcatff"!__posix_ttyname_rQfQ!__posix_getlogin_rQ gQX g!strrchr4ggQX4g!strlenhXg9gXXg!strcpyg]gXgXg!strcmpQgggXg!snprintfQgg"hg^!fwritehhghhgh!freadhJhhhhgXJh!printfQohOh"XohXyh!fopen_hth~h^!fcloseQhh!mallocph#freehp#exitiQQXi!_xmknodQ;ii ijjQX@i!_lxstatQoi;iEiQXti!_xstatQioiyiQ!_fxstatQiiQi!__posix_ctime_rii tm$&j tm_secQ# tm_minQ# tm_hourQ# tm_mdayQ# tm_monQ# tm_yearQ# tm_wdayQ# tm_ydayQ# tm_isdstQ# ij$__posix_asctime_rj!:util.c /var/tmp/cyrus-imapd-2.4.17/lib /opt/solstudio12.2/prod/bin/cc -c -I.. -I/usr/local/include -I/usr/local/include -I/usr/local/mysql/include -I/usr/local/include -I/usr/local/include -I/usr/include/gssapi -I/usr/local/include -I/include -I/usr/local/include -I/usr/local/lib/include -DHAVE_CONFIG_H -g util.c -W0,-xp.XAKgoyLbhuJR0i2.Xa;g;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;G=.XAKgoyLbhuJR0i2.;backend;raw;cd;DBG_GEN 5.3.0'statx""U_pathrt_bufr intcharunsigned long!dev_tlong> W >!ino_t!mode_t!nlink_t>uid_t>gid_t> >>off_t>time_t timespec tv_sec# tv_nsec>#timestruc_t>blksize_t>blkcnt_t2 >> C > statt st_dev2# st_pad1F# st_inoW# st_modec# st_nlinkp# st_uid~# st_gid# st_rdev2#$ st_pad2#( st_size#0 st_pad3>#4 st_atim#8 st_mtim#@ st_ctim#H st_blksize#P st_blocks#T st_fstype!#X st_pad42#hClstat""U_patht_buf fstat""U_fdt_buf mknod"#UKP_pathc_mode 2_devKunsigned charU f~ >convert_to_lowercasekJU  >convert_to_uppercasemlcase#]#U   strscan ucase`##U g strscan beautify_copy#M$U  dstsrc cUbeautify_stringP$;%U BGsrcbeautybuf `beautysize\lenBstrcmpsafe@%%Uab strcasecmpsafe%%Uab kv_bsearch&&Ukeykv nelemcmpftopmidbotcmp keyvalue key # value #keyvaluedir_hash_c&'U  name full  c&'&q'&q'pt n DIR_XDIR_YDIR_PDIR_A Uunsignedcyrus_close_sock-''U fd,cyrus_reset_stdio3'(UF devnull4create_tempfileQ(3)U  pathPfdRpattern S  >cyrus_mkdirj@)*UR W pathicmodei p ksave_errnolsbufCmR become_cyrus *+U p newuidnewgidresultuidd passwd$ pw_name # pw_passwd # pw_uid~# pw_gid# pw_age # pw_comment # pw_gecos # pw_dir # pw_shell #  cmdtime_enabledhtimesub++U  B startB end double>suseconds_t timevalB tv_sec# tv_usec # cmdtime_settimer++U enablecmdtime_starttimer+M,Ucmdtime_endtimerP,,U  pcmdtime pnettime  cmdtime_netstart,,Ucmdtime_netend-J-Uparseint32P-B.Upptr resresultgotcharint32_t parseuint32P.B/Uinp}ptr resresultgotcharisx uint32_t buf_ensureP//UYbufn newlen |//////s  bufY s # len # alloc # flags# buf_cstring/C0UYbufbuf_getmap'P0m0UYbuf&base& len&buf_len-p00U 49buf,4buf_reset200UnYbuf1buf_truncate801UYbuf7 len7 000000more ;buf_setcstrD 1D1U$YbufC)strC $buf_setmapIP11U~YbufHbaseH lenH~buf_copyS11UYdstRsrcR buf_appendX11UYdstWsrcW buf_appendcstr]12U^Ybuf\cstr\ ^buf_appendbit32b2;2UYbufanuma nbit32c bit32buf_appendmaph@22U#Ybufg(baseg leng#buf_putcr22UiYbufqcq buf_printfy33UYbufxfmtx ...xargs zroom{n|voidva_list buf_replace_all305U Ybuf$match .replacen matchlenreplacelenp 445S45S45S44[44[44dp)buf_cmp055Uab len rbuf_init55UYbufbuf_init_ro6+6U*Ybuf/base len*buf_free06y6UcYbufbuf_move66UYdstYsrc Cstrconcat628U KPs1... szsZbuf p args KUnettime cmdtime xtotaltime pnettime_end nettime_start cmdtime_end cmdtime_start hfatal:xrealloc[ xmallocv __posix_ttyname_r  __posix_getlogin_r unlinksetuid>setgid(> getuid~ getgid geteuid~ getegidclosesyslogdup2mkstemp freestrcasecmp,,6strstr _1;_strchr d size_tstrlenstrerror strcpy  strcmp1 memsetU UmemmoveZ memcpy memcmp  __posix_getpwnam_r3  __posix_getpwuid_rm>  mgetpwnam r  group  gr_name # gr_passwd # gr_gid# gr_mem# __posix_getgrnam_r4 __posix_getgrgid_rn> ninitgroupss>tolowervsnprintf  snprintf  printfB"shutdownchtonl||open_xmknod!!_lxstat t _xstatD   t_fxstatn D tn mkdir s !> __posix_ctime_r     tm$ a! tm_sec# tm_min# tm_hour# tm_mday# tm_mon# tm_year# tm_wday# tm_yday# tm_isdst#  a!__posix_asctime_r !f! !gettimeofdayB 5 prot.c /var/tmp/cyrus-imapd-2.4.17/lib /opt/solstudio12.2/prod/bin/cc -c -I.. -I/usr/local/include -I/usr/local/include -I/usr/local/mysql/include -I/usr/local/include -I/usr/local/include -I/usr/include/gssapi -I/usr/local/include -I/include -I/usr/local/include -I/usr/local/lib/include -DHAVE_CONFIG_H -g prot.c -W0,-xp.XAKgoyLbhuJRUq2.Xa;g;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;G=.XAKgoyLbhuJRUq2.;backend;raw;cd;DBG_GEN 5.3.0n6statx@8`8U_pathrt_bufr intcharunsigned long!dev_tlong> W >!ino_t!mode_t!nlink_t>uid_t>gid_t> >>off_t>time_t timespec tv_sec# tv_nsec>#timestruc_t>blksize_t>blkcnt_t2 >> C > statt st_dev2# st_pad1F# st_inoW# st_modec# st_nlinkp# st_uid~# st_gid# st_rdev2#$ st_pad2#( st_size#0 st_pad3>#4 st_atim#8 st_mtim#@ st_ctim#H st_blksize#P st_blocks#T st_fstype!#X st_pad42#hClstat`88U_patht_buf fstat88U_fdt_buf mknod88UKP_pathc_mode 2_devK prot_newZ8b9UUfdYwriteY newstreamU[unsigned charunsignedsasl_connsasl_conn_tC *6BNZfr>~>> ssl_cipher_st(  valid# name# id!# algorithms!# algo_strength!# algorithm2!# strength_bits# alg_bits# mask!# mask_strength!#$SSL_CIPHER  ssl_method_stt d version# ssl_new # ssl_clear# ssl_free# ssl_accept%# ssl_connect1# ssl_read=# ssl_peekI# ssl_writeU# ssl_shutdowna#$ ssl_renegotiatem#( ssl_renegotiate_checky#, ssl_get_message#0 ssl_read_bytes#4 ssl_write_bytes#8 ssl_dispatch_alert#< ssl_ctrl#@ ssl_ctx_ctrl#D get_cipher_by_char#H put_cipher_by_char#L ssl_pending#P num_ciphers#T get_cipher#X get_ssl_methodp #\ get_timeout| #` ssl3_enc #d ssl_version #h ssl_callback_ctrl #l ssl_ctx_callback_ctrl #pd i >u ssl3_enc_method  > > SSL_METHOD   h       # >/ ; G >S bio_method_st( type# name # bwrite # bread # bputs # bgets* # ctrl6 # createB # destroyN # callback_ctrlZ #$_ BIO_METHOD  bio_st@  method # callbackX # cb_arg] # init# shutdown# flags# retry_reason# num# ptrj # next_bio #$ prev_bio #( references#, num_read!#0 num_write!#4 ex_dataS#8 $ >X  ) >>. voidb ] t y ~        stack_st  num# datao # sorted# num_alloc# comp # STACK  crypto_ex_data_st S sk# dummy# CRYPTO_EX_DATA  BIO ssl_st8  version# type# method # rbio # wbio # bbio # rwstate# in_handshake# handshake_func# server#$ new_session#( quiet_shutdown#, shutdown#0 state#4 rstate#8 init_bufA#< init_msgj #@ init_num#D init_off#H packet#L packet_length#P s2#T s3)#X d1B#\ read_ahead#` msg_callbackB#d msg_callback_argj #h hit#l parameC#p cipher_list#t cipher_list_by_id#x enc_read_ctx #| read_hashoC# expand"# enc_write_ctx # write_hashyC# compress"# certC# sid_ctx_length# sid_ctxC# session># generate_session_idC# verify_mode# verify_callbackC# info_callbackC# error# error_code# ctxS# debug# verify_result># ex_dataS# client_CA# references# options!# mode!# max_cert_list># first_packet# client_version# tlsext_debug_cbS# tlsext_debug_argj # tlsext_hostname] # servername_done# tlsext_status_type# tlsext_status_expected# tlsext_ocsp_ids# tlsext_ocsp_extsS# tlsext_ocsp_resp# tlsext_ocsp_resplen# tlsext_ticket_expected# initial_ctxS#r buf_mem_st 3 length# data] # max#BUF_MEM 3F a >r >0 >/  >HZ conn_id_length# cert_type# cert_length# csl# clear# enc# ccl# cipher_spec_length#8 session_id_length#< clen#@ rlen#Dssl2_state_st  three_byte_header# clear_text# escape# ssl2_rollback# wnum# wpend_tot# wpend_bufK# wpend_off# wpend_len# wpend_ret#$ rbuf_left#( rbuf_offs#, rbuf#0 wbuf#4 write_ptr#8 padding#< rlength#@ ract_data_length#D wlength#H wact_data_length#L ract_data#P wact_data#T mac_data#X read_key#\ write_key#` challenge_length#d challengeP#h conn_id_length# conn_ida# key_material_length# key_materialr# read_sequence!# write_sequence!# tmp#Z  >@ >?/ >@@ >? Q > b >size_t ssl3_buffer_st buf# lenb# offset# left# oSSL3_BUFFERunsigned long long ssl3_record_st$g type# length# off# data# input# comp# epoch!# seq_num#SSL3_RECORD > >PEVP_MD_CTX  * > env_md_stH type# pkey_type# md_size# flags!# init# update# final# copy# cleanup# sign#$ verify#( required_pkey_type#, block_size#@ ctx_size#D*EVP_MD (engine_st2ENGINE > env_md_ctx_st digest-# engineK# flags!# md_dataj #  > > > >! bignum_st: d# top# dmax# neg# flags#BIGNUM : bn_mont_ctx_stH ri# RR:# N:# Ni:#, n0!#@ flags#DLBN_MONT_CTX  dh_method$ name# generate_key# compute_key# bn_mod_exp# init# finish# flags# app_data] # generate_params# DH_METHOD  dh_stL pad# version# pG# gG# length># pub_keyG# priv_keyG# flags# method_mont_p# qG#$ jG#( seed#, seedlen#0 counterG#4 references#8 ex_dataS#< meth#D engineK#HDH ec_key_stEC_KEY1 >!EVP_CIPHER 1B] >n >  >  > evp_cipher_ctx_st cipherG# engineK# encrypt# buf_len# oivL# iv]# bufn#0 num#P app_dataj #T key_len#X flags!#\ cipher_dataj #` final_used#d block_mask#h final#lEVP_CIPHER_CTX            !! evp_cipher_st4" nid# block_size# key_len# iv_len# flags!# init # do_cipher # cleanup # ctx_size# set_asn1_parameters!#$ get_asn1_parameters !#( ctrl!#, app_dataj #01"")"3"# comp_ctx_st" meth="# compress_in!# compress_out!# expand_in!# expand_out!# ex_dataS#B"COMP_CTX"""""""> #># comp_method_st # type# name8"# init"# finish"# compress"# expand## ctrl## callback_ctrl####COMP_METHOD ssl_comp_st $ id# name."# method="##SSL_COMP $$% cert_verify_md# finish_md# finish_md_len# peer_finish_md# peer_finish_md_len# message_size!# message_type# new_cipher# dh# ecdh# next_state# reuse_message# cert_req# ctype_num# ctype # ca_names# use_rsa_tmp# key_block_length# key_block# new_sym_enc"# new_hash$"# new_compression$# cert_request#@ & >?@& >?ssl3_state_st ) flags># delay_buf_pop_ret# read_sequence# read_mac_secret # write_sequence#P write_mac_secret/#X server_random@# client_randomQ# need_empty_fragments# empty_fragment_done# rbuf# wbuf# rrecg# wrecg# alert_fragmenty# alert_fragment_len# handshake_fragment# handshake_fragment_len# wnum# wpend_tot# wpend_type# wpend_ret# wpend_buf# finish_dgst1# finish_dgst2# change_cipher_spec# warn_alert# fatal_alert# alert_dispatch# send_alert# renegotiate# total_renegotiations# num_renegotiations# in_read_app_data# tmp$# previous_client_finished%# previous_client_finished_len# previous_server_finished &# previous_server_finished_len# send_connection_binding#&*>*>unsigned short dtls1_bitmap_stm* map# length!# max_seq_num# &*DTLS1_BITMAP* >_pqueue**pqueue record_pqueue_st* epoch*# q*#*record_pqueue* + >0+ >/ /+ > @+ >sess_cert_st@+ asn1_string_st+ length# type# data# flags># T+ASN1_INTEGER ++ asn1_object_st', sn+# ln+# nid# length# data# flags#+ASN1_OBJECT',ASN1_BOOLEAN T+ASN1_STRINGQ,T+ASN1_ENUMERATED h,T+ASN1_BIT_STRING ,T+ASN1_OCTET_STRING ,T+ASN1_PRINTABLESTRING ,T+ASN1_T61STRING ,T+ASN1_IA5STRING ,T+ASN1_GENERALSTRING -T+ASN1_BMPSTRING --T+ASN1_UNIVERSALSTRING G-T+ASN1_UTCTIME g-T+ASN1_GENERALIZEDTIME -T+ASN1_VISIBLESTRING -T+ASN1_UTF8STRING -ASN1_VALUE_st-ASN1_VALUE-/ ptr] # boolean>,# asn1_stringc,# object9,# integer+# enumerated~,# bit_string,# octet_string,# printablestring,# t61string,# ia5string -# generalstring(-# bmpstringB-# universalstringb-# utctimez-# generalizedtime-# visiblestring-# utf8string-# setc,# sequencec,# asn1_value-# asn1_type_st/ type# value-#/ASN1_TYPE/ X509_algor_st 0 algorithm9,# parameter/#/X509_ALGOR  0 X509_name_sts0 entries# modified# bytesA# hash!# "0X509_NAME s0T+ASN1_TIME 0 X509_val_st0 notBefore0# notAfter0#0X509_VAL000 rsa_stXH2 pad# version># meth4# engineK# nG# eG# dG# pG# qG# dmp1G#$ dmq1G#( iqmpG#, ex_dataS#0 references#8 flags#< _method_mod_n#@ _method_mod_p#D _method_mod_q#H bignum_data] #L blindingC4#P mt_blindingC4#T0RSA H2|20R2W22222222222 rsa_meth_st84 name0# rsa_pub_enc|2# rsa_pub_dec2# rsa_priv_enc2# rsa_priv_dec2# rsa_mod_exp2# bn_mod_exp2# init2# finish2# flags#$ app_data] #( rsa_sign2#, rsa_verify2#0 rsa_keygen2#42RSA_METHOD 44bn_blinding_st 4BN_BLINDING 140M4W4 dsa_stDZ5 pad# version># write_params# pG# qG# gG# pub_keyG# priv_keyG# kinvG# rG#$ flags#( method_mont_p#, references#0 ex_dataS#4 meth$7#< engineK#@a4DSA Z5 DSA_SIG_st5 rG# sG#i5DSA_SIG555\4d55555555 66 dsa_method07 nameR4# dsa_do_sign5# dsa_sign_setup5# dsa_do_verify5# dsa_mod_exp5# bn_mod_exp5# init5# finish6# flags# app_data] #$ dsa_paramgen6#( dsa_keygen6#,#6DSA_METHOD 77a4z7 ptr] # rsaH4# dsa)7# dh.7# ec37# evp_pkey_st7 type# save_type# references# pkey87# save_parameters# attributes#z7EVP_PKEY 7 X509_pubkey_st Q8 algor0# public_key,# pkey8# 8X509_PUBKEYQ8 ASN1_ENCODING_st 8 enc# len># modified#h8ASN1_ENCODING x509_cinf_st49 version+# serialNumber+# signature0# issuer0# validity0# subject0# keyc8# issuerUID,# subjectUID,# extensions#$ enc8#(8X509_CINF9AUTHORITY_KEYID_st9X509_POLICY_CACHE_st9X509_POLICY_CACHE 99 > x509_cert_aux_st^: trust# reject# alias-# keyid,# other#9X509_CERT_AUX^: x509_st\; cert_info9# sig_alg0# signature,# valid# references# name] # ex_dataS# ex_pathlen># ex_pcpathlen>#$ ex_flags!#( ex_kusage!#, ex_xkusage!#0 ex_nscert!#4 skid,#8 akid9#< policy_cache9#@ sha1_hash9#D auxr:#Xw:X509 ; ssl_session_st = ssl_version# key_arg_length# key_arg*# master_key_length# master_key +# session_id_length#D session_id+#H sid_ctx_length#h sid_ctx/+#l not_resumable# sess_certO+# peer;# verify_result># references# timeout># time># compress_meth# cipher# cipher_id!# ciphers# ex_dataS# prev=# next=# tlsext_hostname] # tlsext_tick# tlsext_ticklenb# tlsext_tick_lifetime_hint>#;;SSL_SESSION > dtls1_retransmit_state> enc_write_ctx # write_hash*# compress"# session># epoch*# hm_header_st,? type# msg_len!# seq*# frag_off!# frag_len!# is_ccs# saved_retransmit_state># dtls1_timeout_st v? read_timeouts# write_timeouts# num_alerts#>suseconds_t timeval? tv_sec# tv_usecv?#? > ? > dtls1_state_stB send_cookie# cookie)# rcvd_cookie*# cookie_len# r_epoch*# w_epoch*# bitmapm*# next_bitmapm*# handshake_write_seq*# next_handshake_write_seq*# handshake_read_seq*# last_write_sequence*# unprocessed_rcds*# processed_rcds*# buffered_messages*# sent_messages*# buffered_app_data*# listen# mtu# w_msg_hdr># r_msg_hdr># timeout?# next_timeout?# timeout_duration*# alert_fragment?# alert_fragment_len# handshake_fragment?# handshake_fragment_len# retransmitting# change_cipher_spec_ok#?B X509_VERIFY_PARAM_st MC name] # check_time# inh_flags!# flags!# purpose# trust# depth# policies#BX509_VERIFY_PARAMMCjCtCcert_st~C C >rSSL CCCCCCCGEN_SESSION_CB CC x509_store_st@ E cache# objs# get_cert_methods# parameC# verifyAI# verify_cbMI# get_issuerYI# check_issuedeI# check_revocationqI# get_crl}I#$ check_crlI#( cert_crlI#, cleanupI#0 ex_dataS#4 references#<DX509_STORE  EILE6E;EQE]EiEuEEEEEEX509_POLICY_TREE_stEX509_POLICY_TREE E X509_crl_info_st(F version+# sig_alg0# issuer0# lastUpdate0# nextUpdate0# revoked# extensions# enc8#EX509_CRL_INFOF X509_crl_stF crlF# sig_alg0# signature,# references# FX509_CRL F x509_store_ctx_sttI ctx1E# current_method# cert;# untrusted# crls# parameC# other_ctxj # verifyLE# verify_cbXE# get_issuerdE#$ check_issuedpE#( check_revocation|E#, get_crlE#0 check_crlE#4 cert_crlE#8 check_policyE#< cleanupE#@ valid#D last_untrusted#H chain#L treeE#P explicit_policy#T error_depth#X error#\ current_cert;#` current_issuer;#d current_crl G#h ex_dataS#lGX509_STORE_CTX AI6E0IFIRI^IjIvIIIID lhash_node_st I dataj # nextI# hash!#IILHASH_NODEIIb Jb J2J JJJ2JLHASH_COMP_FN_TYPEb PJ!kJUJZJkJLHASH_HASH_FN_TYPE lhash_st`iL bJ# comp7J# hashpJ# num_nodes# num_alloc_nodes# p# pmax# up_load!# down_load!# num_items!#$ num_expands!#( num_expand_reallocs!#, num_contracts!#0 num_contract_reallocs!#4 num_hash_calls!#8 num_comp_calls!#< num_insert!#@ num_replace!#D num_delete!#H num_no_delete!#L num_retrieve!#P num_retrieve_miss!#T num_hash_comps!#X error#\JL=nLL>L, M sess_connect# sess_connect_renegotiate# sess_connect_good# sess_accept# sess_accept_renegotiate# sess_accept_good# sess_miss# sess_timeout# sess_cache_full# sess_hit#$ sess_cb_hit#(MM] j Mpem_password_cbMMMNNN%N/N7N PN >PN\NyN >N >N >NNssl_ctx_st@ S method # cipher_list# cipher_list_by_id# cert_storeI# sessionsiL# session_cache_size!# session_cache_head=# session_cache_tail=# session_cache_mode# session_timeout>#$ new_session_cbL#( remove_session_cbL#, get_session_cbL#0 statsL#4 references#` app_verify_callbackM#d app_verify_argj #h default_passwd_callbackM#l default_passwd_callback_userdataj #p client_cert_cbM#t app_gen_cookie_cbN#x app_verify_cookie_cb N#| ex_dataS# rsa_md5N# md5 N# sha1*N# extra_certs# comp_methods# info_callback2N# client_CA# options!# mode!# max_cert_list># certC# read_ahead# msg_callback:N# msg_callback_argj # verify_mode# sid_ctx_length# sid_ctx?N# default_verify_callbackWN# generate_session_idC# parameC# quiet_shutdown# client_cert_engineK# tlsext_servername_callbackcN# tlsext_servername_argj # tlsext_tick_key_namehN# tlsext_tick_hmac_keyyN# tlsext_tick_aes_keyN# tlsext_ticket_key_cbN# tlsext_status_cbN# tlsext_status_argj #NSSL_CTX SS X509_EXTENSIONSSBytef SuInt !uLong internal_state*T dummy#Tj voidpf j WT/TSSZ[ prot_setsaslp<=U\Usconn ssfp\ result<=<W=<W= maxp$\ maxb \b \prot_unsetsasl==U\\Uszalloc)==U/T\/Topaque'Sitems( Ssize(zfree/=>U\/Topaque-/Taddress. prot_setcompress:>?US]Us9 zr; zstrmU<S]]]!file_sig ] typeX]# lenb# sigb]#"g]]#> sig_tbl]ylg]H] > sig_tbl]ylis_incompressible?X@UD^I^pbn sigN^D^g]prot_data_boundary`@|@U^Usprot_settimeout@@U^Ustimeout prot_resettimeout@0AU_Usprot_setflushonread0AAUa_UsUflushs prot_setreadcallbackAAU_UsUproc j rockprot_addwaiteventABUUP`Usmark Vprocj rock newU curUprot_removewaiteventB nextU>DKDKDKDEDEDE zrMVG@JG@JG@J now sleepforKzLKzLKzL newtime timebufhc>;c > fd_set"[c fds_bits*c#;cfd_set"yc >prot_flush LMUcUsLMMMMM c  save_dontblock prot_flush_log"MNUdUs!MNMNMN ptr$ left% n& newtime' timebufd(d >prot_flush_encodeAN:QUfUs> foutput_buf? Coutput_len@ ptrB leftCNEPNEPNEP zrHEP.QTPQTPQ resultsxPQPQPQ errbuffv ed*fwff%f>%fprot_flush_writebuffer@QQUfUsfbuf blen nfprot_flush_internalQWUgUsforce n save_dontblock ptrg leftRV TV TVUVUVUV sbufC%UVUVUV fd)gprot_writerW.ZUhUsqhbufq lenq0XY?XY?XY?XYNXYNXY zr{ zlevel|hprot_putbuf0ZXZUhUsibuf buf#i s] # len# alloc# flags# hprot_printf`ZL`UjUskfmt j ... pvark percent]  p]  l> ul! i u bufkZ`Z_Z_Z_Zq_Zq_Z\Zy\Zy\[t\ ll$k ull`]8^ tub td1k^l_ zub% zd1k&$jj va_list$$k >long longssize_tprot_printliteralG```UkUoutFksF bsizeF rHkprot_printstringU`aU"lUoutT'lsT p1lV lenW"l,lprot_printastringnbbUlUoutmlsm lprot_read~b~cUlUs}] buf} size} cprot_selectcZiU4o~oreadstreamsextra_read_fd ooutoextra_read_flagotimeout sU timeout_protU retval~o max_fd found_fds i rfds[c have_readtimeout my_timeout? eventU now read_timeoutddfzdfzdf have_thistimeout this_timeoutf@if@if@i sleepforU!protgroup ~o nallocedb# next_elementb# group4o#9o~o?prot_fgets;`iYjU] p] buf:size: Us: p] < c=protgroup_newR`jjU~oUpbsizeQ ret~oSprotgroup_copy_j3kU~op~osrc^ dest~o`protgroup_resetk@kvkUp~ogroupjprotgroup_freetkkUq~ogroupsprotgroup_insert}klUq~ogroup|Uitem| i~ empty~protgroup_deletelmUq~ogroupUitem iprotgroup_getelementm0nUU2r~ogroupbelement prot_getc0nnUdrUsprot_ungetcnoUrcUs prot_putcoLpUrcUs r%fatalsrs&xstrdup] -s s&xreallocj Nsj &xzmallocj js&xmallocj s'signals_poll(cmdtime_netend(cmdtime_netstarts&create_tempfilessTs&inflateInit2_/tss/t&deflateInit2_}ts4t&deflateParamsts&inflateEndts&inflatets&deflateEndus&deflate$us&SSL_ctrl>Ou>j b Ou&SSL_writeuTu&SSL_readuj ru&SSL_pendinguuuuu&sasl_decode vuuuC v*v/v&sasl_encodelvu%v4vCb lvqv&sasl_getpropvuvvv&sasl_errdetailvvuvvvv&sasl_errstringv wvv%nonblock=w=wBw%map_freeiwGwiwnwxww%map_refreshwsw!}ww)cyrus_opt%]z*CYRUSOPT_ZERO*CYRUSOPT_AUTH_UNIX_GROUP_ENABLE*CYRUSOPT_USERNAME_TOLOWER*CYRUSOPT_SKIPLIST_UNSAFE*CYRUSOPT_TEMP_PATH*CYRUSOPT_PTS_CACHE_TIMEOUT*CYRUSOPT_CONFIG_DIR*CYRUSOPT_DB_INIT_FLAGS*CYRUSOPT_FULLDIRHASH*CYRUSOPT_PTSCACHE_DB *CYRUSOPT_PTSCACHE_DB_PATH *CYRUSOPT_PTLOADER_SOCK *CYRUSOPT_VIRTDOMAINS *CYRUSOPT_BERKELEY_CACHESIZE *CYRUSOPT_AUTH_MECH*CYRUSOPT_BERKELEY_LOCKS_MAX*CYRUSOPT_BERKELEY_TXNS_MAX*CYRUSOPT_DELETERIGHT*CYRUSOPT_SQL_DATABASE*CYRUSOPT_SQL_ENGINE*CYRUSOPT_SQL_HOSTNAMES*CYRUSOPT_SQL_USER*CYRUSOPT_SQL_PASSWD*CYRUSOPT_SQL_USESSL*CYRUSOPT_SKIPLIST_ALWAYS_CHECKPOINT*CYRUSOPT_LAST]z&libcyrus_config_getstringbzzw%freezj +abortz&imparse_isatomzzzz%assertionfailed{zz&__posix_ttyname_rK{] &__posix_getlogin_rv{] b v{&write1k{1k{{b &read1k{1k{&lseek{&fsync|&close|0| >"J| __sigbits|#0|J|&__posix_sigwait||O|o||%syslog||$|&strchr] |||&strlenb||&strerror]  }&memsetj /}j b /}&memcpyj ]}j 4}b ]}b g}&memcmp}b}l}}&snprintf}] }$}&printf}}$}&_xmknod$~}}!!)~&_lxstatX~$~.~t]~&_xstat~X~b~t&_fxstat~~t>~&__posix_ctime_r] ~~] tm$& tm_sec# tm_min# tm_hour# tm_mday# tm_mon# tm_year# tm_wday# tm_yday# tm_isdst# ~&__posix_asctime_r] ] &time;c,selectoԆ imclient.c /var/tmp/cyrus-imapd-2.4.17/lib /opt/solstudio12.2/prod/bin/cc -c -I.. -I/usr/local/include -I/usr/local/include -I/usr/local/mysql/include -I/usr/local/include -I/usr/local/include -I/usr/include/gssapi -I/usr/local/include -I/include -I/usr/local/include -I/usr/local/lib/include -DHAVE_CONFIG_H -g imclient.c -W0,-xp.XAKgoyLchuJR0r2.Xa;g;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;G=.XAKgoyLchuJR0r2.;backend;raw;cd;DBG_GEN 5.3.0UstatxPpppU$_pathr|_bufr intcharunsigned long)dev_tlongF _ F)ino_t)mode_t)nlink_tFuid_tFgid_tF FFoff_tFtime_t timespec tv_sec# tv_nsecF#timestruc_tFblksize_tFblkcnt_t: FF K F stat| st_dev:# st_pad1N# st_ino_# st_modek# st_nlinkx# st_uid# st_gid# st_rdev:#$ st_pad2#( st_size#0 st_pad3F#4 st_atim#8 st_mtim#@ st_ctim#H st_blksize #P st_blocks#T st_fstype)#X st_pad4:#hKlstatpppU_path|_buf fstatppU_fd|_buf mknodppUSX_pathk_mode :_devS ]u Fcharclassbvoid sasl_callback  id)# proc# context#sasl_callback_t Fcallbacks<6 Fcallbacks%imclient_connectp,tU5XimclientXhost XportXcbsshintsTYres0YresYsaslresultdidinit M FunsignedMsize_tV imclient_reply  keyword5# msgnoF# text5#pkimclient_proc_timclient_cmdcallback8 nextf# tag)# proc# rock# imclient_callback flags# keyword5# proc# rock# 8stringlist str5# next#sasl_connsasl_conn_tFj   + 7 FC O [ Fg bio_method_st(  type# name# bwrite # bread& # bputs2 # bgets> # ctrlJ # createV # destroyb # callback_ctrln #$s BIO_METHOD  bio_st@ 3 method/ # callbackl # cb_arg5# init# shutdown# flags# retry_reason# num# ptr# next_bio3 #$ prev_bio3 #( references#, num_read)#0 num_write)#4 ex_dataU #84 8 Fl 3 = FFB 5v {         stack_st  num# dataq # sorted# num_alloc# comp # STACK  crypto_ex_data_st U sk # dummy#" CRYPTO_EX_DATA 4 BIO ssl_st8  version# type# method# rbio# wbio# bbio# rwstate# in_handshake# handshake_func# server#$ new_session#( quiet_shutdown#, shutdown#0 state#4 rstate#8 init_bufC#< init_msg#@ init_num#D init_off#H packetY#L packet_lengthM#P s2#T s3(#X d1A#\ read_ahead#` msg_callbackA#d msg_callback_arg#h hit#l paramRB#p cipher_list #t cipher_list_by_id #x enc_read_ctx#| read_hash\B# expand!# enc_write_ctx# write_hashfB# compress!# certuB# sid_ctx_lengthM# sid_ctxzB# session=# generate_session_idB# verify_mode# verify_callbackB# info_callbackB# error# error_code# ctxB# debug# verify_resultF# ex_dataU # client_CA # references# options)# mode)# max_cert_listF# first_packet# client_version# tlsext_debug_cbB# tlsext_debug_arg# tlsext_hostname5# servername_done# tlsext_status_type# tlsext_status_expected# tlsext_ocsp_ids # tlsext_ocsp_extsC# tlsext_ocsp_respY# tlsext_ocsp_resplen# tlsext_ticket_expected# initial_ctxB#t  buf_mem_st 5 length# data5# max#BUF_MEM 5unsigned charHH^H y FH FH0 F/H  FHr conn_id_lengthM# cert_typeM# cert_lengthM# cslM# clearM# encM# ccl# cipher_spec_lengthM#8 session_id_lengthM#< clenM#@ rlenM#Dssl2_state_st  three_byte_header# clear_text# escape# ssl2_rollback# wnumM# wpend_tot# wpend_bufc# wpend_off# wpend_len# wpend_ret#$ rbuf_left#( rbuf_offs#, rbufY#0 wbufY#4 write_ptrY#8 paddingM#< rlengthM#@ ract_data_length#D wlengthM#H wact_data_length#L ract_dataY#P wact_dataY#T mac_dataY#X read_keyY#\ write_keyY#` challenge_lengthM#d challengeh#h conn_id_lengthM# conn_idy# key_material_lengthM# key_material# read_sequence)# write_sequence)# tmp#rH% FH@6 F?HG FH@X F?H i FH z F ssl3_buffer_st bufY# lenY# offset# left# zSSL3_BUFFERunsigned long long ssl3_record_st$r type# lengthM# offM# dataY# inputY# compY# epoch)# seq_num#SSL3_RECORDH FH FH[EVP_MD_CTX  5 F env_md_stH& type# pkey_type# md_size# flags)# init# update# final# copy# cleanup# sign#$ verify#( required_pkey_type$#, block_size#@ ctx_size#D5EVP_MD &3engine_st=ENGINE I env_md_ctx_st digest8# engineV# flags)# md_data# H FH FH FH F ssl_cipher_st(  valid# name# id)# algorithms)# algo_strength)# algorithm2)# strength_bits# alg_bits# mask)# mask_strength)#$SSL_CIPHER ) bignum_st' d# top# dmax# neg# flags#BIGNUM ' bn_mont_ctx_stH ri# RR'# N'# Ni'#, n0)#@ flags#D9BN_MONT_CTX  dh_method$ name# generate_key# compute_key# bn_mod_exp# init# finish# flags# app_data5# generate_params#  DH_METHOD  dh_stL pad# version# p4# g4# lengthF# pub_key4# priv_key4# flags# method_mont_p# q4#$ j4#( seedY#, seedlen#0 counter4#4 references#8 ex_dataU #< meth#D engineV#HDH ec_key_stEC_KEY F EVP_CIPHER /HJ FH[ FH l FH } F evp_cipher_ctx_st{ cipher4# engineV# encrypt# buf_len# oiv9# ivJ# buf[#0 num#P app_data#T key_len#X flags)#\ cipher_data#` final_used#d block_mask#h finall#l}EVP_CIPHER_CTX {HH evp_cipher_st4! nid# block_size# key_len# iv_len# flags)# init# do_cipher# cleanup# ctx_size# set_asn1_parameters#$ get_asn1_parameters#( ctrl #, app_data#0!& !! !" comp_ctx_st! meth*!# compress_in)# compress_out)# expand_in)# expand_out)# ex_dataU #/!COMP_CTX!!!!!!!F!F" comp_method_st " type# name%!# init!# finish!# compress!# expand!# ctrl!# callback_ctrl "#"COMP_METHOD ssl_comp_st " id# name!# method*!#"SSL_COMP ""$ cert_verify_md# finish_md# finish_md_len# peer_finish_md# peer_finish_md_len# message_size)# message_type# new_cipher# dh# ecdh# next_state# reuse_message# cert_req# ctype_num# ctype # ca_names # use_rsa_tmp# key_block_length# key_blockY# new_sym_enc!# new_hash!# new_compression## cert_request#H@$ F?H@ % F?ssl3_state_st ( flagsF# delay_buf_pop_ret# read_sequence# read_mac_secret%# write_sequence6#P write_mac_secretG#X server_randomX# client_randomi# need_empty_fragments# empty_fragment_done# rbuf# wbuf# rrecr# wrecr# alert_fragment# alert_fragment_lenM# handshake_fragment# handshake_fragment_lenM# wnumM# wpend_tot# wpend_type# wpend_ret# wpend_buf# finish_dgst1# finish_dgst2# change_cipher_spec# warn_alert# fatal_alert# alert_dispatch# send_alert# renegotiate# total_renegotiations# num_renegotiations# in_read_app_data# tmp## previous_client_finished$# previous_client_finished_lenH# previous_server_finished$# previous_server_finished_lenH# send_connection_binding# % H( F H) Funsigned short dtls1_bitmap_stZ) map# length)# max_seq_num# )DTLS1_BITMAPH~) F_pqueue~))pqueue record_pqueue_st) epoch)# q)#)record_pqueue&)H) FH0 * F/H * FH -* Fsess_cert_st-* asn1_string_st* length# type# dataY# flagsF# A*ASN1_INTEGER ** asn1_object_st+ sn*# ln*# nid# length# dataY# flags#*ASN1_OBJECT+ASN1_BOOLEAN A*ASN1_STRING>+A*ASN1_ENUMERATED U+A*ASN1_BIT_STRING p+A*ASN1_OCTET_STRING +A*ASN1_PRINTABLESTRING +A*ASN1_T61STRING +A*ASN1_IA5STRING +A*ASN1_GENERALSTRING +A*ASN1_BMPSTRING ,A*ASN1_UNIVERSALSTRING 4,A*ASN1_UTCTIME T,A*ASN1_GENERALIZEDTIME l,A*ASN1_VISIBLESTRING ,A*ASN1_UTF8STRING ,ASN1_VALUE_st,ASN1_VALUE,z. ptr5# boolean++# asn1_stringP+# object&+# integer*# enumeratedk+# bit_string+# octet_string+# printablestring+# t61string+# ia5string+# generalstring,# bmpstring/,# universalstringO,# utctimeg,# generalizedtime,# visiblestring,# utf8string,# setP+# sequenceP+# asn1_value,# asn1_type_st. type# value,#z.ASN1_TYPE. X509_algor_st. algorithm&+# parameter.#.X509_ALGOR . X509_name_st`/ entries # modified# bytesC# hash)# /X509_NAME `/A*ASN1_TIME u/ X509_val_st/ notBefore/# notAfter/#/X509_VAL//H/ rsa_stX51 pad# versionF# meth3# engineV# n4# e4# d4# p4# q4# dmp14#$ dmq14#( iqmp4#, ex_dataU #0 references#8 flags#< _method_mod_n#@ _method_mod_p#D _method_mod_q#H bignum_data5#L blinding03#P mt_blinding03#T/RSA 51i1/Y?1D1n1z111111111 rsa_meth_st82 name/# rsa_pub_enci1# rsa_pub_decu1# rsa_priv_enc1# rsa_priv_dec1# rsa_mod_exp1# bn_mod_exp1# init1# finish1# flags#$ app_data5#( rsa_sign1#, rsa_verify1#0 rsa_keygen1#41RSA_METHOD 23bn_blinding_st 3BN_BLINDING 3/:3HD3 dsa_stDG4 pad# versionF# write_params# p4# q4# g4# pub_key4# priv_key4# kinv4# r4#$ flags#( method_mont_p#, references#0 ex_dataU #4 meth6#< engineV#@N3DSA G4 DSA_SIG_st}4 r4# s4#V4DSA_SIG}444I3Q4444444445 dsa_method05 name?3# dsa_do_sign4# dsa_sign_setup4# dsa_do_verify4# dsa_mod_exp4# bn_mod_exp4# init4# finish4# flags# app_data5#$ dsa_paramgen4#( dsa_keygen 5#,5DSA_METHOD 5 6N3g6 ptr5# rsa53# dsa6# dh6# ec 6# evp_pkey_st6 type# save_type# references# pkey%6# save_parameters# attributes #g6EVP_PKEY 6 X509_pubkey_st >7 algor /# public_key+# pkey6#6X509_PUBKEY>7 ASN1_ENCODING_st 7 encY# lenF# modified#U7ASN1_ENCODING x509_cinf_st4w8 version*# serialNumber*# signature /# issuerp/# validity/# subjectp/# keyP7# issuerUID+# subjectUID+# extensions #$ enc7#(7X509_CINFw8AUTHORITY_KEYID_st8X509_POLICY_CACHE_st8X509_POLICY_CACHE 8H8 F x509_cert_aux_stK9 trust # reject # alias,# keyid+# other #8X509_CERT_AUXK9 x509_st\: cert_info8# sig_alg /# signature+# valid# references# name5# ex_dataU # ex_pathlenF# ex_pcpathlenF#$ ex_flags)#( ex_kusage)#, ex_xkusage)#0 ex_nscert)#4 skid+#8 akid8#< policy_cache8#@ sha1_hash8#D aux_9#Xd9X509 : ssl_session_st < ssl_version# key_arg_lengthM# key_arg)# master_key_length# master_key)# session_id_lengthM#D session_id *#H sid_ctx_lengthM#h sid_ctx*#l not_resumable# sess_cert<*# peer:# verify_resultF# references# timeoutF# timeF# compress_meth# cipher# cipher_id)# ciphers # ex_dataU # prev<# next<# tlsext_hostname5# tlsext_tickY# tlsext_ticklenY# tlsext_tick_lifetime_hintF#::SSL_SESSION < dtls1_retransmit_state|= enc_write_ctx# write_hash)# compress!# session=# epoch)# hm_header_st, > typeH# msg_len)# seq)# frag_off)# frag_len)# is_ccsM# saved_retransmit_state=# dtls1_timeout_st c> read_timeoutsM# write_timeoutsM# num_alertsM#Fsuseconds_t timeval> tv_sec# tv_usecc>#H> FH > F dtls1_state_stA send_cookieM# cookie(# rcvd_cookie(# cookie_lenM# r_epoch)# w_epoch)# bitmapZ)# next_bitmapZ)# handshake_write_seq)# next_handshake_write_seq)# handshake_read_seq)# last_write_sequencem)# unprocessed_rcds)# processed_rcds)# buffered_messages)# sent_messages)# buffered_app_data)# listenM# mtuM# w_msg_hdr|=# r_msg_hdr|=# timeout ># next_timeoutu># timeout_duration)# alert_fragment># alert_fragment_lenM# handshake_fragment># handshake_fragment_lenM# retransmittingM# change_cipher_spec_okM#>A X509_VERIFY_PARAM_st :B name5# check_time# inh_flags)# flags)# purpose# trust# depth# policies #AX509_VERIFY_PARAM:B&WB&aBcert_stkBH B Ft SSL BBMBBYBBBGEN_SESSION_CB BBVB X509_EXTENSIONSBB+CCC0C8C@CLCXCdCpC|CCCFCCCCFCFCCCD DD ssl_method_stt F version# ssl_new+C# ssl_clear3C# ssl_free;C# ssl_acceptGC# ssl_connectSC# ssl_read_C# ssl_peekkC# ssl_writewC# ssl_shutdownC#$ ssl_renegotiateC#( ssl_renegotiate_checkC#, ssl_get_messageC#0 ssl_read_bytesC#4 ssl_write_bytesC#8 ssl_dispatch_alertC#< ssl_ctrlC#@ ssl_ctx_ctrlC#D get_cipher_by_charC#H put_cipher_by_charC#L ssl_pendingD#P num_ciphersD#T get_cipherD#X get_ssl_methodF#\ get_timeoutF#` ssl3_encF#d ssl_versionF#h ssl_callback_ctrlF#l ssl_ctx_callback_ctrlF#p$DFFFFssl3_enc_methodFFFFFF$DSSL_METHOD x509_store_st@-H cache# objs # get_cert_methods # paramRB# verifyNL# verify_cbZL# get_issuerfL# check_issuedrL# check_revocation~L# get_crlL#$ check_crlL#( cert_crlL#, cleanupL#0 ex_dataU #4 references#< GX509_STORE -H(LYHCHHH^HjHvHHHHHHHX509_POLICY_TREE_stHX509_POLICY_TREE H X509_crl_info_st(I version*# sig_alg /# issuerp/# lastUpdate/# nextUpdate/# revoked # extensions # enc7#HX509_CRL_INFOI X509_crl_stJ crlI# sig_alg /# signature+# references# IX509_CRL J x509_store_ctx_stt(L ctx>H# current_method# cert:# untrusted # crls # paramRB# other_ctx# verifyYH# verify_cbeH# get_issuerqH#$ check_issued}H#( check_revocationH#, get_crlH#0 check_crlH#4 cert_crlH#8 check_policyH#< cleanupH#@ valid#D last_untrusted#H chain #L treeH#P explicit_policy#T error_depth#X error#\ current_cert:#` current_issuer:#d current_crlJ#h ex_dataU #lJX509_STORE_CTX NLCH=LSL_LkLwLLLLL G lhash_node_st L data# nextL# hash)#LLLHASH_NODEL MMM?MM$M)M?MLHASH_COMP_FN_TYPE]M)xMbMgMxMLHASH_HASH_FN_TYPE lhash_st`vO bM# compDM# hash}M# num_nodesM# num_alloc_nodesM# pM# pmaxM# up_load)# down_load)# num_items)#$ num_expands)#( num_expand_reallocs)#, num_contracts)#0 num_contract_reallocs)#4 num_hash_calls)#8 num_comp_calls)#< num_insert)#@ num_replace)#D num_delete)#H num_no_delete)#L num_retrieve)#P num_retrieve_miss)#T num_hash_comps)#X error#\MOC<{OO=O, P sess_connect# sess_connect_renegotiate# sess_connect_good# sess_accept# sess_accept_renegotiate# sess_accept_good# sess_miss# sess_timeout# sess_cache_full# sess_hit#$ sess_cb_hit#(PP5Ppem_password_cbPPQQ&Q&(Q&2Q N^str> !pX^@!lenMA!classB!buf]^CI^S^n^ Fimclient_writeq~dU^ kimclientp ^sp Ylenp^&imclient_inputp|U` kimclient 5buf len!replytag)!replyp!endreply5!p`!parsedY!literallen`!keywordlenY!keywordindex!cmdcba!cmdcbtempf!plainbufa!plainlenM!result't'b'b'l' l' l!availY'9Ԉ'EԈ'EԈ!iscompletion<`Muint32_t#f a&imclient_eofPUza kimclient!cmdcbf!replypimclient_getselectinfoP֌Ua kimclient afd awanttowriteimclient_processoneeventUc kimclient!bufc!n!writelen!rfdsEc!wfdsEc':':':'R'sL'sL!cryptlenM!cryptptrWc c FF%c F fd_set$Ec fds_bitsc#%cfd_set$Rc&authresultTDUc kimclientQ rockR replyS!resultedU(replytype7d)replytype_inprogress)replytype_ok)replytype_no)replytype_bad)replytype_prematureokauthresulted replytypec# r#7d&tlsresultgPUd kimclientd rocke replyf!resultedh%make_secpropsx<Uf0e minw maxw !retfyMsasl_ssf_tAeFePeUe sasl_security_propertiese min_ssf0e# max_ssf0e# maxbufsizeM# security_flagsM# property_namesKe# property_valuesZe#_esasl_security_properties_teinteraction@jUf kcontext gt 5user!resultg!cur'Y'PY'PY'd'q'q!ptr5ffg g sasl_interactg id)# challengef# promptf# defresultg# resultg# lenM#gsasl_interact_tg g Ffillin_interactionspUh kcontext gtlist 5user%imclient_authenticate_sub{Ui kimclient 5mechlist 5user minssf maxssf imechusing!saslresult!secpropsf!addrsizeX!saddr_l2j!saddr_r2j!localipj!remoteipj!client_interactg!outj!outlenM!inlen!result7diii Fdoubleisockaddr_maxalign_t!2j Fsockaddr_storage!j ss_familyX# _ss_pad1i# _ss_alignj# _ss_pad2 j#!depth? o F%tmp_rsa_cbpU?10p Csm exportn keylengtho!rsa_tmp?1q*tls_rand_init}U%tls_init_clientengine Uq kimclient verifydepth 5var_tls_cert_file 5var_tls_key_file 5var_tls_CAfile 5var_tls_CApath!off!verify_flags!CApath5!CAfile5!c_cert_file5!c_key_file5"tls_start_clienttls[Ur kimclientY BlayerZ q authidZ fdZ!sts\!session=]!ciphers^!peer:_!tls_cipher_usebits`!tls_cipher_algbitsa!tls_peer_CN5b!tls_issuer_CN5cr+imclient_havetlsU"imclient_starttls Ut kimclient 5cert_file 5key_file 5CAfile 5CApath!result!theresult7d!ssf0e!auth_id5 ,t F!issuer_CNt Xt F!peer_CNEt!verify_depthcmdcallback_freelistfYt,iptostringttM5Mttt,parseuint32'uttB,ucase5@u5@u-fatalduEudu,xstrdup5uiu,xreallocuM,xzmallocuM,xmallocuMuu-assertionfailedvuuQ53#v-SSL_CTX_set_tmp_rsa_callback`vv*vt `v,SSL_get_session=vevvv,SSL_CTX_load_verify_locationsvvvv,SSL_CTX_set_default_verify_pathswv.SSL_library_init-SSL_set_connect_stateOw.TLSv1_client_method,SSL_CTX_ctrlFwvFw,SSL_writeww,SSL_readw,SSL_connectx-SSL_free)xQ,SSL_newCIx)xQIx,SSL_CTX_check_private_keyxNxx-SSL_CTX_set_verifyxvxt x,SSL_get_peer_certificate:xx,SSL_CTX_remove_sessionyv</SSL_load_error_strings9y,SSL_CTX_use_certificate_chain_file~yv>y~y,SSL_CTX_use_PrivateKey_fileyvy,SSL_set_fdyy,SSL_CIPHER_get_bitszyat z,SSL_get_current_cipherNzz,SSL_clearkz$D,SSL_CTX_newBzkz/,X509_NAME_get_text_by_NIDzz5d9,X509_get_subject_namep/zz,X509_get_issuer_namep/&{z,X509_NAME_oneline5U{z5U{,X509_verify_cert_error_stringZ{{FJ,X509_STORE_CTX_get_current_cert:{{J,X509_STORE_CTX_get_error_depth{{,X509_STORE_CTX_get_error+|{+|,RSA_generate_key?1k|).|3|p|z||,sasl_decode|k|u|M|B|||,sasl_encode}k||M|B}g}}!},sasl_client_steph}k| }M}&}Bh}r}w}}},sasl_client_start}k|m}}|}B}}}}}}k|,sasl_client_newF~}}}}}M~F~,sasl_client_initt~K~t~,sasl_setprop~k|y~~~,sasl_getprop~k|~-sasl_dispose~~,__posix_ttyname_r,5M,__posix_getlogin_rW5ssize_te,writeWWjM,readWWM,close,strlcpyYY,strstr59 9,strchr5b>b,memchrgM,strncmpɀMɀ,strlenY΀,strcpy55 ,strcmpI%I,strcat5r5N,memsetM,memmoveŁMŁ,memcpyʁM,snprintf$5M# __FILE% _cnt# _ptrY# _baseY# _flagH# _fileH# 0__orientationM# 0__ionolockM#  0__seekableM#  0__extendedfdM#  0__xf_nocheckM#  0__fillerM#  $,fgets5(5(,printfM-#M,getpassphrase5xR,mallocM-free-freeaddrinfoƒYƒ̃TYփY,getaddrinfoǃуۃ,socket7,shutdownX,getsocknameOY,getpeernameOYY,connectلMބ,_xmknodل)),_lxstatF|K,_xstatyFP|,_fxstaty|F,__posix_ctime_r5Յ5 tm$&n tm_sec# tm_min# tm_hour# tm_mday# tm_mon# tm_year# tm_wday# tm_yday# tm_isdst# Յn,__posix_asctime_r5s5%cu>1selectH {imparse.c /var/tmp/cyrus-imapd-2.4.17/lib /opt/solstudio12.2/prod/bin/cc -c -I.. -I/usr/local/include -I/usr/local/include -I/usr/local/mysql/include -I/usr/local/include -I/usr/local/include -I/usr/include/gssapi -I/usr/local/include -I/include -I/usr/local/include -I/usr/local/lib/include -DHAVE_CONFIG_H -g imparse.c -W0,-xp.XAKgoyLchuJR0K3.Xa;g;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;G=.XAKgoyLchuJR0K3.;backend;raw;cd;DBG_GEN 5.3.0rstatxU"_pathrz_bufr intcharunsigned long'dev_tlongD ] D'ino_t'mode_t'nlink_tDuid_tDgid_tD DDoff_tDtime_t timespec tv_sec# tv_nsecD#timestruc_tDblksize_tDblkcnt_t8 DD I D statz st_dev8# st_pad1L# st_ino]# st_modei# st_nlinkv# st_uid# st_gid# st_rdev8#$ st_pad2#( st_size#0 st_pad3D#4 st_atim#8 st_mtim#@ st_ctim#H st_blksize#P st_blocks#T st_fstype'#X st_pad48#hIlstatЩU_pathz_buf fstatЩU_fdz_buf mknodUQV_pathi_mode 8_devQ imparse_word= Us:retval: c> imparse_astringVUNsSretvalS cW dX lenY sawdigitZ imparse_isatomUs len imparse_issequenceܰUs c len sawcolon imparse_isnumberKUV[sV`printfe_xmknod''_lxstatz_xstat%z_fxstatO%zDO__posix_ctime_rT tm$ tm_sec# tm_min# tm_hour# tm_mday# tm_mon# tm_year# tm_wday# tm_yday# tm_isdst#  __posix_asctime_r ] msignals.c /var/tmp/cyrus-imapd-2.4.17/lib /opt/solstudio12.2/prod/bin/cc -c -I.. -I/usr/local/include -I/usr/local/include -I/usr/local/mysql/include -I/usr/local/include -I/usr/local/include -I/usr/include/gssapi -I/usr/local/include -I/include -I/usr/local/include -I/usr/local/lib/include -DHAVE_CONFIG_H -g signals.c -W0,-xp.XAKgoyLbhuJRkj2.Xa;g;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;G=.XAKgoyLbhuJRkj2.;backend;raw;cd;DBG_GEN 5.3.0vstatxPpU"_pathrz_bufr intcharunsigned long'dev_tlongD ] D'ino_t'mode_t'nlink_tDuid_tDgid_tD DDoff_tDtime_t timespec tv_sec# tv_nsecD#timestruc_tDblksize_tDblkcnt_t8 DD I D statz st_dev8# st_pad1L# st_ino]# st_modei# st_nlinkv# st_uid# st_gid# st_rdev8#$ st_pad2#( st_size#0 st_pad3D#4 st_atim#8 st_mtim#@ st_ctim#H st_blksize#P st_blocks#T st_fstype'#X st_pad48#hIlstatpU_pathz_buf fstatU_fdz_buf mknodرUQV_pathi_mode 8_devQ gotsignal7 sighandler:Usig9D catch?<  D catch?<signals_add_handlersBUPalarmA actionC iDPW _handlerR# _sigactionZ#unsigned D __sigbits#sigset_t D sigaction 6 sa_flags# _funcptr_# sa_mask# sa_resv#C6shutdownfn C shutdown_cbTdsignals_set_shutdowngUTsfsignals_polll`Ufatal__posix_sigwait'sigemptysetK'KsigactionPUexit_xmknod''_lxstat z _xstat5   z_fxstat_ 5 zD_ __posix_ctime_ri  d i tm$ / tm_sec# tm_min# tm_hour# tm_mday# tm_mon# tm_year# tm_wday# tm_yday# tm_isdst#  / __posix_asctime_ri 4 i nonblock_fcntl.c /var/tmp/cyrus-imapd-2.4.17/lib /opt/solstudio12.2/prod/bin/cc -c -I.. -I/usr/local/include -I/usr/local/include -I/usr/local/mysql/include -I/usr/local/include -I/usr/local/include -I/usr/include/gssapi -I/usr/local/include -I/include -I/usr/local/include -I/usr/local/lib/include -DHAVE_CONFIG_H -g nonblock_fcntl.c -W0,-xp.XAKgoyLfhuJRkl3.Xa;g;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;G=.XAKgoyLfhuJRkl3.;backend;raw;cd;DBG_GEN 5.3.0gystatx`U0_pathr_bufr intchar#+unsigned long5dev_tlongR k R5ino_t5mode_t5nlink_tRuid_tRgid_tR RRoff_tRtime_t timespec tv_sec# tv_nsecR#timestruc_tRblksize_tRblkcnt_t#F RR W R stat st_devF# st_pad1Z# st_inok# st_modew# st_nlink# st_uid# st_gid# st_rdevF#$ st_pad2#( st_size#0 st_pad3R#4 st_atim#8 st_mtim#@ st_ctim#H st_blksize#P st_blocks&#T st_fstype5#X st_pad4F#hWlstatU_path_buf #fstatU_fd_buf mknodU_d_pathw_mode F_dev#_#i nonblock_method_descn@ nonblockKWUfdHmodeH flagsL#fatal fcntl*#/_xmknodc*455#h_lxstatcm#_xstat_fxstatR#__posix_ctime_r+ tm$ tm_sec# tm_min# tm_hour# tm_mday# tm_mon# tm_year# tm_wday# tm_yday# tm_isdst# +__posix_asctime_r map_shared.c /var/tmp/cyrus-imapd-2.4.17/lib /opt/solstudio12.2/prod/bin/cc -c -I.. -I/usr/local/include -I/usr/local/include -I/usr/local/mysql/include -I/usr/local/include -I/usr/local/include -I/usr/include/gssapi -I/usr/local/include -I/include -I/usr/local/include -I/usr/local/lib/include -DHAVE_CONFIG_H -g map_shared.c -W0,-xp.XAKgoyLfhuJR0x3.Xa;g;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;G=.XAKgoyLfhuJR0x3.;backend;raw;cd;DBG_GEN 5.3.0zstatx`U(_pathr_bufr intchar#unsigned long-dev_tlongJ c J-ino_t-mode_t-nlink_tJuid_tJgid_tJ JJoff_tJtime_t timespec tv_sec# tv_nsecJ#timestruc_tJblksize_tJblkcnt_t> JJ O J stat st_dev># st_pad1R# st_inoc# st_modeo# st_nlink|# st_uid# st_gid# st_rdev>#$ st_pad2#( st_size#0 st_pad3J#4 st_atim#8 st_mtim#@ st_ctim#H st_blksize#P st_blocks#T st_fstype-#X st_pad4>#hOlstatU_path_buf fstatU _fd_buf mknodUW\_patho_mode >_devWa map_method_descf: map_refreshHݶUCfd@onceonly@ Mbase@Rlen@-newlen@\name@fmboxname@ sbufOIbufkJCH-WaP| JO map_freewUbasetRlent fatalsyslogunsignedgetpagesizes2Hgetpagesizes2nmunmapnncaddr_tmmapJsnprintfn_xmknod; --@_lxstato;Et_xstatoy_fxstatJ__posix_ctime_rnn tm$ tm_sec# tm_min# tm_hour# tm_mday# tm_mon# tm_year# tm_wday# tm_yday# tm_isdst#  __posix_asctime_rn n( iptostring.c /var/tmp/cyrus-imapd-2.4.17/lib /opt/solstudio12.2/prod/bin/cc -c -I.. -I/usr/local/include -I/usr/local/include -I/usr/local/mysql/include -I/usr/local/include -I/usr/local/include -I/usr/include/gssapi -I/usr/local/include -I/include -I/usr/local/include -I/usr/local/lib/include -DHAVE_CONFIG_H -g iptostring.c -W0,-xp.XAKgoyLghuJRkD4.Xa;g;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;G=.XAKgoyLghuJRkD4.;backend;raw;cd;DBG_GEN 5.3.0|statx @U(_pathr_bufr intchar#unsigned long-dev_tlongJ c J-ino_t-mode_t-nlink_tJuid_tJgid_tJ JJoff_tJtime_t timespec tv_sec# tv_nsecJ#timestruc_tJblksize_tJblkcnt_t> JJ O J stat st_dev># st_pad1R# st_inoc# st_modeo# st_nlink|# st_uid# st_gid# st_rdev>#$ st_pad2#( st_size#0 st_pad3J#4 st_atim#8 st_mtim#@ st_ctim#H st_blksize#P st_blocks#T st_fstype-#X st_pad4>#hOlstat@`U_path_buf fstat`U _fd_buf mknodUW\_patho_mode >_devW iptostring8ϸUraddr7addrlen7 out8woutlen8 hbuf9 pbuf9 niflags:unsigned shortsa_family_t: J sockaddrm sa_family# sa_data)#:munsignedwsocklen_tJ  Jsnprintfwwsize_tstrlen:getnameinfoe#wwwj_xmknodeo--_lxstat_xstat_fxstat/J/__posix_ctime_ra4 tm$  tm_sec# tm_min# tm_hour# tm_mday# tm_mon# tm_year# tm_wday# tm_yday# tm_isdst# a__posix_asctime_r xmalloc.c /var/tmp/cyrus-imapd-2.4.17/lib /opt/solstudio12.2/prod/bin/cc -c -I.. -I/usr/local/include -I/usr/local/include -I/usr/local/mysql/include -I/usr/local/include -I/usr/local/include -I/usr/include/gssapi -I/usr/local/include -I/include -I/usr/local/include -I/usr/local/lib/include -DHAVE_CONFIG_H -g xmalloc.c -W0,-xp.XAKgoyLbhuJREf2.Xa;g;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;G=.XAKgoyLbhuJREf2.;backend;raw;cd;DBG_GEN 5.3.0~statxиU"_pathrz_bufr intcharunsigned long'dev_tlongD ] D'ino_t'mode_t'nlink_tDuid_tDgid_tD DDoff_tDtime_t timespec tv_sec# tv_nsecD#timestruc_tDblksize_tDblkcnt_t8 DD I D statz st_dev8# st_pad1L# st_ino]# st_modei# st_nlinkv# st_uid# st_gid# st_rdev8#$ st_pad2#( st_size#0 st_pad3D#4 st_atim#8 st_mtim#@ st_ctim#H st_blksize#P st_blocks#T st_fstype'#X st_pad48#hIlstatU_pathz_buf fstat0U_fdz_buf mknod0XUQV_pathi_mode 8_devQ xmalloc6`Usize5 ret7voidunsigned xzmallocAUsize@ retB xreallocO{UPptrNsizeN retP xstrdup[UstrZ p\ xstrndupbUstralena pcfatalstrncpyM#Msize_tstrlenW~R~strcpymemsetreallocmalloc _xmknod>''C_lxstatr>Hzw_xstatr|z_fxstatzD__posix_ctime_r  tm$ tm_sec# tm_min# tm_hour# tm_mday# tm_mon# tm_year# tm_wday# tm_yday# tm_isdst#   __posix_asctime_r $ libcyr_cfg.c /var/tmp/cyrus-imapd-2.4.17/lib /opt/solstudio12.2/prod/bin/cc -c -I.. -I/usr/local/include -I/usr/local/include -I/usr/local/mysql/include -I/usr/local/include -I/usr/local/include -I/usr/include/gssapi -I/usr/local/include -I/include -I/usr/local/include -I/usr/local/lib/include -DHAVE_CONFIG_H -g libcyr_cfg.c -W0,-xp.XAKgoyLbhuJR0o2.Xa;g;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;G=.XAKgoyLbhuJR0o2.;backend;raw;cd;DBG_GEN 5.3.0Xstatx0U(_pathr_bufr intchar#unsigned long-dev_tlongJ c J-ino_t-mode_t-nlink_tJuid_tJgid_tJ JJoff_tJtime_t timespec tv_sec# tv_nsecJ#timestruc_tJblksize_tJblkcnt_t> JJ O J stat st_dev># st_pad1R# st_inoc# st_modeo# st_nlink|# st_uid# st_gid# st_rdev>#$ st_pad2#( st_size#0 st_pad3J#4 st_atim#8 st_mtim#@ st_ctim#H st_blksize#P st_blocks#T st_fstype-#X st_pad4>#hOlstat0PU_path_buf fstatPpU _fd_buf mknodpUW\_patho_mode >_devW cyrus_opt CYRUSOPT_ZERO CYRUSOPT_AUTH_UNIX_GROUP_ENABLE CYRUSOPT_USERNAME_TOLOWER CYRUSOPT_SKIPLIST_UNSAFE CYRUSOPT_TEMP_PATH CYRUSOPT_PTS_CACHE_TIMEOUT CYRUSOPT_CONFIG_DIR CYRUSOPT_DB_INIT_FLAGS CYRUSOPT_FULLDIRHASH CYRUSOPT_PTSCACHE_DB CYRUSOPT_PTSCACHE_DB_PATH CYRUSOPT_PTLOADER_SOCK CYRUSOPT_VIRTDOMAINS CYRUSOPT_BERKELEY_CACHESIZE CYRUSOPT_AUTH_MECH CYRUSOPT_BERKELEY_LOCKS_MAX CYRUSOPT_BERKELEY_TXNS_MAX CYRUSOPT_DELETERIGHT CYRUSOPT_SQL_DATABASE CYRUSOPT_SQL_ENGINE CYRUSOPT_SQL_HOSTNAMES CYRUSOPT_SQL_USER CYRUSOPT_SQL_PASSWD CYRUSOPT_SQL_USESSL CYRUSOPT_SKIPLIST_ALWAYS_CHECKPOINT CYRUSOPT_LASTacyrus_config_valueA s# iJ# bJ# cyrus_opttype CYRUS_OPT_NOTOPT CYRUS_OPT_STRING CYRUS_OPT_INT CYRUS_OPT_SWITCHA cyrusopt_s  opt# val# t#8 Jcyrus_options>libcyrus_config_getstring@UP K aoptK libcyrus_config_getint@U aoptlibcyrus_config_getswitchU aoptlibcyrus_config_setstringȀU" aopt' val " libcyrus_config_setint Uu aoptval libcyrus_config_setswitchZU aoptval libcyrus_init`jUlibcyrus_donepzUcyrusdb_donecyrusdb_init ) assertionfailed\ $ . a _xmknod \ f -- _lxstat    _xstat   _fxstat&  J& __posix_ctime_r0 ] + 0 tm$ tm_sec# tm_min# tm_hour# tm_mday# tm_mon# tm_year# tm_wday# tm_yday# tm_isdst# ]  __posix_asctime_r0  0 Icyrusdb.c /var/tmp/cyrus-imapd-2.4.17/lib /opt/solstudio12.2/prod/bin/cc -c -I.. -I/usr/local/include -I/usr/local/include -I/usr/local/mysql/include -I/usr/local/include -I/usr/local/include -I/usr/include/gssapi -I/usr/local/include -I/include -I/usr/local/include -I/usr/local/lib/include -DHAVE_CONFIG_H -g cyrusdb.c -W0,-xp.XAKgoyLchuJR0N3.Xa;g;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;G=.XAKgoyLchuJR0N3.;backend;raw;cd;DBG_GEN 5.3.0;statxU"_pathrz_bufr intcharunsigned long'dev_tlongD ] D'ino_t'mode_t'nlink_tDuid_tDgid_tD DDoff_tDtime_t timespec tv_sec# tv_nsecD#timestruc_tDblksize_tDblkcnt_t8 DD I D statz st_dev8# st_pad1L# st_ino]# st_modei# st_nlinkv# st_uid# st_gid# st_rdev8#$ st_pad2#( st_size#0 st_pad3D#4 st_atim#8 st_mtim#@ st_ctim#H st_blksize#P st_blocks#T st_fstype'#X st_pad48#hIlstatU_pathz_buf fstatU_fdz_buf mknodUQV_pathi_mode 8_devQ[e  j o&2 cyrusdb_backendDN name`# init# done# sync# archive# open# close# fetch# fetchlock# foreach#$ create#( store#, delete #0 commit#4 abort!#8 dump-#< consistent9#@>N$d Dcyrusdb_backendsSAcyrusdb_initQU iRrRdbdir Sconfdir%TinitflagsU D cyrusdb_doned#U]iecyrusdb_copyfilem0@U  srcnamel dstnamel srcfdndstfdnsbufIobuf" pnq  5 Dconverter_cb@U  rock key keylen datadatalencr- void   db txn convert_rock - backendN# db # tid # cyrusdb_convert}U  fromfname tofname NfrombackendNtobackendfromdb todb cr fromtid r  cyrusdb_detect؀PU   fnamef buf nbdb_magic   unsigned char unsigned __FILE _cnt# _ptr # _base # _flag # _file # __orientation # __ionolock #  __seekable #  __extendedfd #  __xf_nocheck #  __filler #   FILE   D uint32_t cyrusdb_fromnamePUN{  nameidbNerrbuf {  D  retry_write   fatal cyrus_opt CYRUSOPT_ZEROCYRUSOPT_AUTH_UNIX_GROUP_ENABLECYRUSOPT_USERNAME_TOLOWERCYRUSOPT_SKIPLIST_UNSAFECYRUSOPT_TEMP_PATHCYRUSOPT_PTS_CACHE_TIMEOUTCYRUSOPT_CONFIG_DIRCYRUSOPT_DB_INIT_FLAGSCYRUSOPT_FULLDIRHASHCYRUSOPT_PTSCACHE_DB CYRUSOPT_PTSCACHE_DB_PATH CYRUSOPT_PTLOADER_SOCK CYRUSOPT_VIRTDOMAINS CYRUSOPT_BERKELEY_CACHESIZE CYRUSOPT_AUTH_MECHCYRUSOPT_BERKELEY_LOCKS_MAXCYRUSOPT_BERKELEY_TXNS_MAXCYRUSOPT_DELETERIGHTCYRUSOPT_SQL_DATABASECYRUSOPT_SQL_ENGINECYRUSOPT_SQL_HOSTNAMESCYRUSOPT_SQL_USERCYRUSOPT_SQL_PASSWDCYRUSOPT_SQL_USESSLCYRUSOPT_SKIPLIST_ALWAYS_CHECKPOINTCYRUSOPT_LASTlibcyrus_config_getint libcyrus_config_getstring __posix_ttyname_r   __posix_getlogin_rG  Gunlinkk Lssize_t readk k y close syslog  snprintf    size_t freadO    "OYfopen  T ^ fclose strncmp   strcpy   strcmp5  5strcat^  :^open c _xmknod   ' '_lxstat   z_xstat&   z_fxstatP &  zDP__posix_ctime_r U  tm$  tm_sec# tm_min# tm_hour# tm_mday# tm_mon# tm_year# tm_wday# tm_yday# tm_isdst#  __posix_asctime_r  Tcyrusdb_flat.c /var/tmp/cyrus-imapd-2.4.17/lib /opt/solstudio12.2/prod/bin/cc -c -I.. -I/usr/local/include -I/usr/local/include -I/usr/local/mysql/include -I/usr/local/include -I/usr/local/include -I/usr/include/gssapi -I/usr/local/include -I/include -I/usr/local/include -I/usr/local/lib/include -DHAVE_CONFIG_H -g cyrusdb_flat.c -W0,-xp.XAKgoyLfhuJRE33.Xa;g;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;G=.XAKgoyLfhuJRE33.;backend;raw;cd;DBG_GEN 5.3.05statx U,_pathr_bufr intchar'unsigned long1dev_tlongN g N1ino_t1mode_t1nlink_tNuid_tNgid_tN NNoff_tNtime_t timespec tv_sec# tv_nsecN#timestruc_tNblksize_tNblkcnt_tB NN S N stat st_devB# st_pad1V# st_inog# st_modes# st_nlink# st_uid# st_gid# st_rdevB#$ st_pad2#( st_size#0 st_pad3N#4 st_atim#8 st_mtim#@ st_ctim#H st_blksize#P st_blocks"#T st_fstype1#X st_pad4B#hSlstat @U_path_buf fstat@`U _fd_buf mknod`U[`_paths_mode B_dev[abort_txn\U>db[jtid[ r] rw^ sbufS_ db> fname# fd# inog# base# size1# len1# txnj fnamenew# fd#Cfree_db7U>dbnew_txn@tUj retjinitU dbdirmyflags  doneUmysyncUmyarchiveUfnames$dirname r d_length d_remain fname3 dstname8 dp).KNmyopenUfnameflags ret db> sbufS level>mycloseFU/ >dbstarttxn_or_refetchPU, >db, mytid r sbufSlll lockfailaction6 lxxnewfdj1 myfetch5U >db1 key2 keylen2 data3 datalen3, mytid4r6offset7len18   fetchRU >mydbN keyO keylenO dataP datalenP, mytidQ   fetchlockZ.U@ >dbVE keyW keylenWT dataX datalenX, mytidY@ J O foreachw0Uv>dbrprefixs prefixlensgoodptcbu~rocku, mytidv rxoffsetylen1zp%{pend%{key/keylen@dataRdataendRdatalen@dontmovesavebufsavebuflen@savebufsize@dbbase\dblen1dbfd6BBrealprefixino1sz1sssKKKdblsizeaddsizevoidv~foreach_p ~foreach_cb  *unsigned4size_tMWmystoreDU>dbkey keylendatadatalen, mytidoverwrite rfnamebufoffsetlen1 lockfailaction  writefd iovK niov sbufStmpkeyNcaddr_t iovecK iov_base# iov_lenN#P\ N createPU>dbkey keylendatadatalen, tidstoreUs>dbxkey keylendatadatalen, tids}deleteU>dbkey keylen, mytidforcecommit_txn2U>dbjtid writefdrsbufS+7CO[ cyrusdb_backendDw name# init# done# sync# archive# open# close# fetch# fetchlock# foreach#$ create#( store&#, delete2#0 commit>#4 abortJ#8 dumpV#< consistentb#@cyrusdb_flatg(cyrus_mkdir1retry_writevxstrdupxrealloc~7~4xzmalloc~S4xmalloc~n4lock_unlocklock_reopen1bsearch_mem%11%*map_freeQ/QV`jmap_refresh[1eocyrusdb_copyfileassertionfailed',strlcat@['1@[strlcpy@'`@strrchrstrchrstrlen@vmemcpy~/~4v/v9memcmpg4>4gsysloglfree~printf__posix_ttyname_r4__posix_getlogin_r  unlinkD%DNrenamewISfsyncdup2dupcloseopen _xmknod>11C_lxstatr>Hw_xstatr|_fxstatN__posix_ctime_r tm$  tm_sec# tm_min# tm_hour# tm_mday# tm_mon# tm_year# tm_wday# tm_yday# tm_isdst# __posix_asctime_r4cyrusdb_skiplist.c /var/tmp/cyrus-imapd-2.4.17/lib /opt/solstudio12.2/prod/bin/cc -c -I.. -I/usr/local/include -I/usr/local/include -I/usr/local/mysql/include -I/usr/local/include -I/usr/local/include -I/usr/include/gssapi -I/usr/local/include -I/include -I/usr/local/include -I/usr/local/lib/include -DHAVE_CONFIG_H -g cyrusdb_skiplist.c -W0,-xp.XAKgoyLfhuJR033.Xa;g;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;G=.XAKgoyLfhuJR033.;backend;raw;cd;DBG_GEN 5.3.0statx@`U  4_pathr_bufr intchar'/unsigned long9dev_tlongV o V9ino_t9mode_t9nlink_tVuid_tVgid_tV VVoff_tVtime_t timespec tv_sec# tv_nsecV#timestruc_tVblksize_tVblkcnt_t'J VV [ V stat st_devJ# st_pad1^# st_inoo# st_mode{# st_nlink# st_uid# st_gid# st_rdevJ#$ st_pad2#( st_size#0 st_pad3V#4 st_atim#8 st_mtim#@ st_ctim#H st_blksize#P st_blocks*#T st_fstype9#X st_pad4J#h[lstat`U _path_buf 'fstatU  _fd_buf mknodU ch_path{_mode J_dev'c global_recoveryl''unsigneduint32_t txn  syncfd # logstart# logend#'' (   dbDY fname# fd # map_base# map_len9# map_size9# map_inoo# version# version_minor# maxlevel# curlevel#$ listsize#( logstart#, last_recovery#0 lock_status #4 is_open #8 current_txn#< compar(#@-c db_list  dbY# next^# refcount # open_db^pgetsyncfd1UYdbt closesyncfd@eU#Ydbt myinitpU dbdir myflags sfile fd  r  net32_time''VmydoneU mysyncU myarchive 8U   fnames dirname r fname dstname  dp length !rest !'  ' '  ' VLEVEL@;Ub g ptrpq qq 'b l RECSIZE@]U  ptrret ' SAFE_TO_APPEND`GU  YdbnewtxnPU  Ydb tidptr tidViir read_header_U  Ydbdptr r ' write_header;`U F Ydb:bufF <n ='0W V/update_lockWU  YdbVtxnV write_lockb lU * Ydba/ altnamea sbuf[clockfailaction9 dfnameC e'* '4 '> read_lockpU  Ydbsbuf[sbuffile[newfd unlockU  Ydblock_or_refresh U IYdb tidptr r dispose_dbU |Ydbmyopen9U fname flags retdbYlist_ent^r new TTTn Qdsize RbufS'Ymyclose@U  Ydblist_ent^prev^compare U s1 l1 s2 l2min cmp ''find_node UOJYdbYkey  keylen^updateoffsetsptrhi offset'J'T'cmyfetchU KYdbPkey  keylen_dataddatalen tidptrptrnr MxUxUxr1 'K'UZ 'ifetchU Ymydb key  keylen dataddatalen tidptr''fetchlockU Ydbkey  keylendataddatalen tidptr''myforeach$U ^Ydbprefix   prefixlen goodp!cb"frock" tidptr# ptr %savebuf&savebuflen'savebufsize(r )cb_r )need_unlock *I::X:inooNsz9OBvoid^'k'u fp z foreach_p'' f  foreach_cb'size_trandlvl;UdYdblvlmystore@ U Ydbkey  keylendata datalen tidptr overwrite ptrklendleniov,lvlinum_iovtidlocaltidendpaddingzeropadding>updateoffsetsOnewoffsets`addrectypedelrectypetodeletenewoffsetnetnewoffsetr BC'''caddr_t iovec , iov_base# iov_lenV#> V1O VT` VTq Vcreate>  U Ydb:key;  keylen;data< datalen< tid=''storeF  U YdbBkeyC  keylenCdataD datalenD tidE''mydeleteM U >YdbJCkeyK  keylenK tidptrL forceLptrMNdelrectypeOupdateoffsetsRPoffsetQwritebufcRtidSlocaltidSiTr UppnetnewoffsetB'>'HTc Vt VmycommitU Ydbtid commitrectyper  BBr2 myabortU Ydbtid ptrupdateoffsetsoffsetir  DD$::netnewoffsetDlvlnetnewoffset q!B'T V'mycheckpointW)&U +!YdbV lockedV fname+!Xoldfd Yiov>!Znum_iov[updateoffsetsP!\ptrf!]offset^r _iorectype`iastartbdsize buf!!!lvlnewoffsetnetnewoffset!"!~"!~"netnewoffset$ %L$ %L$ %sbuf[f% &diff 4'>!VP! V1Ta! V'a!dumpD0&8)U !YdbC detailC ptr!Eend!EiF'!consistent~@)^)U !"Ydb}myconsistent`),U 9#Ydbtid  lockedptr>#offset.*^,:*R,:*R,iF*+f*+f*+ ++,++,++qH#cmp B'9#'C#recovery,@U &Ydb flags ptr&keyptr&updateoffsets&offsetoffsetnetmyoffr need_checkpoint starti121212121s21s2zerooffset >2V>2?>2?>p&Uq&U233333orig _+565656p&6)>6868686868newoffset 8)>8)>(9)>(9)>B9>B9>lvlnewoffsets&9>9>9><><><>newoffsetnet ?:@?:@?:@diff C B '&T& V'&'&T' V'''' 9'' #' >' J' V' b' n' z' ' ' ' ' ' ' ' ' ' cyrusdb_backendD) name'# init9'# doneE'# syncQ'# archive]'# openi'# closeu'# fetch'# fetchlock'# foreach'#$ create'#( store'#, delete'#0 commit'#4 abort'#8 dump'#< consistent'#@cyrusdb_skiplist'V t'#)cyrus_mkdir Q)()9retry_writev ) Q) ^)retry_write ) )')xstrdup))xreallocf)fxzmallocf*xmallocf0*'0*5*9map_freea*:*?*'a*f*'p*'z*map_refresh*  k*?*9u**lock_unlock * lock_shared * '*'+ +lock_reopen B+ ++cyrus_opt -CYRUSOPT_ZEROCYRUSOPT_AUTH_UNIX_GROUP_ENABLECYRUSOPT_USERNAME_TOLOWERCYRUSOPT_SKIPLIST_UNSAFECYRUSOPT_TEMP_PATHCYRUSOPT_PTS_CACHE_TIMEOUTCYRUSOPT_CONFIG_DIRCYRUSOPT_DB_INIT_FLAGSCYRUSOPT_FULLDIRHASHCYRUSOPT_PTSCACHE_DB CYRUSOPT_PTSCACHE_DB_PATH CYRUSOPT_PTLOADER_SOCK CYRUSOPT_VIRTDOMAINS CYRUSOPT_BERKELEY_CACHESIZE CYRUSOPT_AUTH_MECHCYRUSOPT_BERKELEY_LOCKS_MAXCYRUSOPT_BERKELEY_TXNS_MAXCYRUSOPT_DELETERIGHTCYRUSOPT_SQL_DATABASECYRUSOPT_SQL_ENGINECYRUSOPT_SQL_HOSTNAMESCYRUSOPT_SQL_USERCYRUSOPT_SQL_PASSWDCYRUSOPT_SQL_USESSLCYRUSOPT_SKIPLIST_ALWAYS_CHECKPOINTCYRUSOPT_LASTlibcyrus_config_getswitch .B+'.snprintf 8. . '8.printf ].=. '].'g.cyrusdb_copyfile .b.l.'.'.bsearch_ncompare .. . '.'.assertionfailed/. .__posix_ttyname_r M/ __posix_getlogin_r x/  ssize_t^/writex//x//'/unlink //'/'/rename  0//^readx/10x/ 0lseekT0  Vpid_t!getpidT0ftruncate 0 Vfsync 0 fdatasync 0 close 0 '0syslog1 0 '' 1strlcpy;111';1strrchre1@1 'e1strlen1j1'1'1strcmp 111^1memcpyf1f1^1^1memcmp "211dup2 ?2  srandT2!rand freev2f"abortntohl2htonl2'2open 22   '2_xmknod 32299 '3_lxstat H333 'M3_xstat {3H3R3 _fxstat 3{3 V3__posix_ctime_r33 tm$ p4 tm_sec # tm_min # tm_hour # tm_mday # tm_mon # tm_year # tm_wday # tm_yday # tm_isdst # 3p4__posix_asctime_r4u4#time4+ cyrusdb_quotalegacy.c /var/tmp/cyrus-imapd-2.4.17/lib /opt/solstudio12.2/prod/bin/cc -c -I.. -I/usr/local/include -I/usr/local/include -I/usr/local/mysql/include -I/usr/local/include -I/usr/local/include -I/usr/include/gssapi -I/usr/local/include -I/include -I/usr/local/include -I/usr/local/lib/include -DHAVE_CONFIG_H -g cyrusdb_quotalegacy.c -W0,-xp.XAKgoyLfhuJRk43.Xa;g;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;G=.XAKgoyLfhuJRk43.;backend;raw;cd;DBG_GEN 5.3.0Mstatx@@U&&:_pathr_bufr intchar-5unsigned long?dev_tlong\ u \?ino_t?mode_t?nlink_t\uid_t\gid_t\ \\off_t\time_t timespec tv_sec# tv_nsec\#timestruc_t\blksize_t\blkcnt_t-P \\ a \ stat st_devP# st_pad1d# st_inou# st_mode# st_nlink# st_uid# st_gid# st_rdevP#$ st_pad2#( st_size#0 st_pad3\#4 st_atim#8 st_mtim#@ st_ctim#H st_blksize #P st_blocks0#T st_fstype?#X st_pad4P#halstat@@U&_path_buf -fstat@AU&&_fd_buf mknodA(AU&in_path_mode P_dev-iname_to_hashchar0AAU-name&isprefix config_fulldirhash& idx-- hash_quotaAfCUbufsize qrpath config_virtdomains& config_fulldirhash& c- p len-unsignedsize_t-abort_subtxnpCDU&Wfnametid r&subtxn fd&# fnamenew# fdnew&# delete&# Wcommit_subtxnDjFU&$fnametid writefd& r& sbufafree_dbpFFUP dbvoidP bucket  key# dataX# next#]]bucketmpool hash_table  size# table# pool#hash_table&  txnW table# proc # result&#PW Pa & \ f k db path# data# txn" # compar # new_subtxn%F'GU" ' fname#&fd$ ret&-" init10GBGU&o t dbdir/&myflags0 -o done6PGbGU&mysync;pGGU&myarchiveAGGU&  fnames? dirname@ -  - myopenFGIU&  fnameE&flagsE  retEdb GsbufaHpIr&JH@IH@IH@Ilevel&\-  mycloseiIIU&"  dbhmyfetchtIVMU&  dbqquota_pathq datardatalenrtidsmytiduquota_fd&vquota_basewquota_len?xgJJwJJwJJsbufaJKJKJK@KKLKKLKKr&sbufalockfailaction$KLLLLLpeol-  &"  --fetch`M0NU& dbkey &keylendatadatalentidquota_pathtmpkey---\path_to_qr0NNUvqpathbuf qrp-q-{-compar_qrNCOU&%*v14v2 qr1>qr2>qrbuf1Cqrbuf2VP%P/-9-V\-i\compar_qr_mbox POOU& v1v2 qr1 qr2 qrbuf1" qrbuf25 PP--5\-H\scan_qr_dirO=SUquota_pathprefix pathbufconfig_fulldirhash&config_virtdomains&endponlyc-c& i& qrdir'!next"R5SZR5SZR5SbufaKqr_path  path# count# alloc# dd_fd&# dd_loc&# dd_size&# dd_buf# DIRunsigned short-O \ dirent  d_inou# d_off# d_reclen,# d_name># Oforeacha@S`XU& db\prefix] &prefixlen]Pgoodp^cb_Xrock_tid` r&bconfig_fulldirhash&cconfig_virtdomains&dquota_pathepathbuffigtmpprefixhphXTqVpTqVpTqVendp|c&}i&}n&}qrdir'~nextVWVWVWdatakeykeylen&datalen&--&@X &&foreach_p @-U-_&XZ&d&iforeach_cb -\-mystore`X^U& dbkey &keylendata&datalentid&overwrite quota_pathtmpkeymytidr&DYZSYZSYZfd&sbufalockfailactionZ^Z^Z^new_quota_pathbufpnewfd&ܿr1&ؿnԿ---\--\&ssize_tcreateP^_U& dbLkeyM &keylenMdataN&datalenNtidO--storeX_0_U& dbT$keyU &keylenU.dataV&datalenVtidW--)delete_0_\_U& db\key] &keylen]mytid^&force^-txn_procd`__U%fnamecXdatac Xrockctid er&fcommit_txno__U&g dbn tidn abort_txny_/`U& dbx tidx --&&&&&&&&&&+&7&C&O&[&g&s& cyrusdb_backendD  name# init# done# sync# archive# open# close# fetch# fetchlock&# foreach2#$ create>#( storeJ#, deleteV#0 commitb#4 abortn#8 dumpz#< consistent#@cyrusdb_quotalegacy-cyrus_mkdir&?-dir_hash_c&&-fatal>&->xstrdupcCxreallocXXxzmallocXxmallocXlock_unlock&&lock_blocking&&-- lock_reopen&B&cyrus_opt ! CYRUSOPT_ZERO CYRUSOPT_AUTH_UNIX_GROUP_ENABLE CYRUSOPT_USERNAME_TOLOWER CYRUSOPT_SKIPLIST_UNSAFE CYRUSOPT_TEMP_PATH CYRUSOPT_PTS_CACHE_TIMEOUT CYRUSOPT_CONFIG_DIR CYRUSOPT_DB_INIT_FLAGS CYRUSOPT_FULLDIRHASH CYRUSOPT_PTSCACHE_DB CYRUSOPT_PTSCACHE_DB_PATH CYRUSOPT_PTLOADER_SOCK CYRUSOPT_VIRTDOMAINS CYRUSOPT_BERKELEY_CACHESIZE CYRUSOPT_AUTH_MECH CYRUSOPT_BERKELEY_LOCKS_MAX CYRUSOPT_BERKELEY_TXNS_MAX CYRUSOPT_DELETERIGHT CYRUSOPT_SQL_DATABASE CYRUSOPT_SQL_ENGINE CYRUSOPT_SQL_HOSTNAMES CYRUSOPT_SQL_USER CYRUSOPT_SQL_PASSWD CYRUSOPT_SQL_USESSL CYRUSOPT_SKIPLIST_ALWAYS_CHECKPOINT CYRUSOPT_LASTlibcyrus_config_getswitch&"B-" "?map_free8"""-8"="-G"-Q"map_refresh"&&B""?L"V"!"free_hash_table"""!"hash_enumerate"""Xhash_delX#"-#hash_lookupXD##"-D#hash_insertXw#I#X"construct_hash_tablew##w#&-#-#__assert###&# \ $ __sigbits###$__posix_sigwait&A$$-A$-K$bsearch_compare&}$F$P$__posix_readdir_r&$}$$closedir&$}$readdir$}$-$opendir'%$--%strlcatF%%%-F%strlcpyu%%K%-u%-%strstr%z%%-%strrchr%%&-%strchr%%&P%memchrX)&&&-)&-3&strncmp&b&.&8&-b&strlen&g&-&-&strcspn&&&-&strcpy&&-&-&strcmp&'&&memsetX:'X&P:'memcpyXh'X?'-h'syslog'&m'"&'qsort'X'free'X-'snprintf&('"-(sprintf&.(("-.(printf&S(3("__posix_ttyname_r&(&__posix_getlogin_r&(&P(write((-(unlink&((-(-)rename&1)) )lseekT)&&ftruncate&v)&\fsync&)&close&)&-)open&))&"&-)_xmknod& *))??&-*_lxstat&=* **&-B*_xstat&p*=*G*&_fxstat&*p*&\*__posix_ctime_r** tm$ e+ tm_sec&# tm_min&# tm_hour&# tm_mday&# tm_mon&# tm_year&# tm_wday&# tm_yday&# tm_isdst&# *e+#__posix_asctime_rj+Kecyrusdb_berkeley.c /var/tmp/cyrus-imapd-2.4.17/lib /opt/solstudio12.2/prod/bin/cc -c -I.. -I/usr/local/include -I/usr/local/include -I/usr/local/mysql/include -I/usr/local/include -I/usr/local/include -I/usr/include/gssapi -I/usr/local/include -I/include -I/usr/local/include -I/usr/local/lib/include -DHAVE_CONFIG_H -g cyrusdb_berkeley.c -W0,-xp.XAKgoyLghuJRU53.Xa;g;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;G=.XAKgoyLghuJRU53.;backend;raw;cd;DBG_GEN 5.3.0statx0`P`U  4_pathr_bufr intchar'/unsigned long9dev_tlongV o V9ino_t9mode_t9nlink_tVuid_tVgid_tV VVoff_tVtime_t timespec tv_sec# tv_nsecV#timestruc_tVblksize_tVblkcnt_t'J VV [ V stat st_devJ# st_pad1^# st_inoo# st_mode{# st_nlink# st_uid# st_gid# st_rdevJ#$ st_pad2#( st_size#0 st_pad3V#4 st_atim#8 st_mtim#@ st_ctim#H st_blksize#P st_blocks*#T st_fstype9#X st_pad4J#h[lstatP`p`U _path_buf 'fstatp``U  _fd_buf mknod``U ch_path{_mode J_dev'c dbinit ` db_panici``UN%dbenvg errnoh __envENVunsigneddb_mutex_t8DB_ENV' '6unsigned char; __FILE- _cnt # _ptrL# _baseL# _flag;# _file;# __orientation# __ionolock#  __seekable#  __extendedfd#  __xf_nocheck#  __filler#  QFILE -'=G O[cksvoid{ 'size_tu_intu_int32_t;u_int8_tdb_timeout_t__fh_tDB_FH# 4 @ L X dpx                (  4  @  L  X  d  p  |                            (  4  @  L  X  d  p  |                            $  0  <  H  T  `  l  x                              ,  8  D  P  \  h  t                              (  4  @  L  X  d  p  |                          $ 0<DL T ` l x                , 8 DPX ` l x                ,__db_envN% env# mtx_db_env# db_errcall6# db_errfile8# db_errpfxB# db_msgcallJ# db_msgfile8# app_dispatchV# db_event_func^# db_feedbackf#$ db_freen#( db_paniccallv#, db_malloc#0 db_realloc#4 is_alive#8 thread_id#< thread_id_string#@ db_log_dir#D db_tmp_dir#H db_create_dir#L db_data_dir#P data_cnt #T data_next #X intermediate_dir_mode#\ shm_keyV#` passwd#d passwd_len#h cl_handle#l cl_id#p app_private#t api1_internal#x api2_internal#| verbose# mutex_align# mutex_cnt# mutex_inc# mutex_tas_spins# lk_conflicts# lk_modes # lk_detect# lk_max# lk_max_lockers# lk_max_objects# lk_partitions# lk_timeout# lg_bsize# lg_filemode # lg_regionmax# lg_size# lg_flags# mp_gbytes# mp_bytes# mp_max_gbytes# mp_max_bytes# mp_mmapsize# mp_maxopenfd # mp_maxwrite # mp_ncache# mp_pagesize# mp_tablesize# mp_maxwrite_sleep# tx_max# tx_timestamp# tx_timeout# thr_max# registry/# registry_off# envreg_timeout# flags# add_data_dir;# cdsgroup_beginG# closeS# dbremove_# dbrenamek# errs# errx{# failchk# fileid_reset# get_alloc# get_app_dispatch# get_cache_max# get_cachesize# get_create_dir# get_data_dirs# get_encrypt_flags# get_errcall# get_errfile# get_errpfx# get_flags # get_feedback # get_home# # get_intermediate_dir_mode/ # get_isalive; # get_lg_bsizeG # get_lg_dirS # get_lg_filemode_ # get_lg_maxk # get_lg_regionmaxw # get_lk_conflicts # get_lk_detect # get_lk_max_lockers # get_lk_max_locks # get_lk_max_objects # get_lk_partitions # get_mp_max_openfd # get_mp_max_write # get_mp_mmapsize # get_mp_pagesize # get_mp_tablesize # get_msgcall # get_msgfile # get_open_flags # get_shm_key# # get_thread_count/ # get_thread_id_fn; # get_thread_id_string_fnG # get_timeoutS # get_tmp_dir_ # get_tx_maxk # get_tx_timestampw # get_verbose # is_bigendian # lock_detect # lock_get # lock_id # lock_id_free # lock_put # lock_stat # lock_stat_print # lock_vec # log_archive # log_cursor # log_file # log_flush # log_get_config+ # log_printf7 # log_putC # log_set_configO # log_stat[ # log_stat_printg # lsn_resets # memp_fcreate # memp_register # memp_stat # memp_stat_print # memp_sync # memp_trickle # mutex_alloc # mutex_free # mutex_get_align # mutex_get_increment # mutex_get_max # mutex_get_tas_spins # mutex_lock # mutex_set_align # mutex_set_increment' # mutex_set_max3 # mutex_set_tas_spins? # mutex_statK # mutex_stat_printW # mutex_unlockc # openo # remove{ # rep_elect # rep_flush # rep_get_clockskew # rep_get_config # rep_get_limit # rep_get_nsites # rep_get_priority # rep_get_request # rep_get_timeout # rep_process_message # rep_set_clockskew # rep_set_config # rep_set_limit # rep_set_nsites# # rep_set_priority/ # rep_set_request; # rep_set_timeoutG # rep_set_transportS # rep_start_ # rep_statk # rep_stat_printw # rep_sync # repmgr_add_remote_site # repmgr_get_ack_policy # repmgr_set_ack_policy # repmgr_set_local_site # repmgr_site_list # repmgr_start # repmgr_stat # repmgr_stat_print # set_alloc # set_app_dispatch # set_cache_max# set_cachesize# set_create_dir# set_data_dir+# set_encrypt7# set_errcall?# set_errfileG# set_errpfxO# set_event_notify[# set_feedbackg# set_flagss# set_intermediate_dir_mode# set_isalive# set_lg_bsize# set_lg_dir# set_lg_filemode# set_lg_max# set_lg_regionmax# set_lk_conflicts# set_lk_detect# set_lk_max_lockers# set_lk_max_locks# set_lk_max_objects# set_lk_partitions# set_mp_max_openfd# set_mp_max_write'# set_mp_mmapsize3# set_mp_pagesize?# set_mp_tablesizeK# set_msgcallS# set_msgfile[# set_paniccallg# set_rpc_servers# set_shm_key# set_thread_count# set_thread_id# set_thread_id_string# set_timeout# set_tmp_dir# set_tx_max# set_tx_timestamp# set_verbose# stat_print# txn_begin# txn_checkpoint# txn_recover# txn_stat# txn_stat_print'# prdbt3# db_erru`aU%%dbenvp%db_prfxq %bufferq%'%'% db_msg{aaU%%dbenvy &msgz %'&init aeU &&dbdir myflags r  do_retry  flags  maj  min  patch  errpfx& opt '&' ' V doneexfU ;'r mysyncfgU n'r myarchive1gjU a(k(fnames0u(dirname0 r 2begin3list3fname(4dstname(5dp5length 6rest 6'a(f('p('z(('(Vmbox_comparj,kU ()db$Ka .Kbt)DB_PRIORITY_UNCHANGEDDB_PRIORITY_VERY_LOWDB_PRIORITY_LOWDB_PRIORITY_DEFAULTDB_PRIORITY_HIGHDB_PRIORITY_VERY_HIGH(DB_CACHE_PRIORITYK __db_dbt* data# size# ulen# dlen# doff# app_data# flags#)DBT*db_recno_t =*) **"*B* J**DB_BTREEDB_HASHDB_RECNODB_QUEUEDB_UNKNOWNV*DBTYPE __db_mpoolfileg- fhp/# ref# pinref# qq-# env# mfp-# clear_len# fileid-# ftype #4 lsn_offset-#8 gbytes#< bytes#@ pgcookie *#D priority-#H addr#L len#P config_flags#T close-#X get.#\ get_clear_len.#` get_fileid.#d get_flags(.#h get_ftype4.#l get_last_pgno@.#p get_lsn_offsetL.#t get_maxsizeX.#x get_pgcookied.#| get_priorityp.# open|.# put.# set_clear_len.# set_fileid.# set_flags.# set_ftype.# set_lsn_offset.# set_maxsize.# set_pgcookie.# set_priority.# sync.# flags#*g-- tqe_nextg-# tqe_prevl-#__mpoolfile-MPOOLFILE-- V int32_t . --- -  . . !. -. 9. E. Q. ]. i. u. . . . . . . . . . .*DB_MPOOLFILE' /'/ V__fname'/FNAME1/db_pgno_t__db_lockerR/DB_LOCKER`/__db_txnmgru/DB_TXNMGR/"3__db_thread_info/DB_THREAD_INFO/ __db_txn1 mgrp/# parent/# thread_info/# txnid# name# lockerp/# td# lock_timeout# expire# txn_list#$ links1#( kids1#0 events2#8 logsY2#@ klinks2#H api_internal#P xml_internal#T cursors#X abort2#\ commit2#` discard2#d get_name2#h id2#l prepare2#p set_name 3#t set_timeout3#x set_txn_lsnp3#| flags#/11 tqe_next1# tqe_prev1# __kids1 tqh_first1# tqh_last1#__txn_event1 2@2 tqh_first 2# tqh_last2#__txn_logrec@2O22 stqh_firstO2# stqh_lastT2#2 tqe_next1# tqe_prev1# 2/2 2 2 22 2 3 33/DB_TXNroff_t3DB_LOCK_NGDB_LOCK_READDB_LOCK_WRITEDB_LOCK_WAITDB_LOCK_IWRITEDB_LOCK_IREADDB_LOCK_IWRDB_LOCK_READ_UNCOMMITTEDDB_LOCK_WWRITE<3db_lockmode_t __db_lock_u34 off/3# ndx# gen# mode3# 3DB_LOCK__dbU@ pgsize# priorityt)# db_append_recno=*# db_feedbackE*# dup_compareQ*# app_private# dbenvN%# env# type*# mpf-#$ mutex#( fname#, dname#0 dirname/#4 open_flags#8 fileid/#< adj_fileid#P log_filename=/#T meta_pgnoB/#X lockerp/#\ cur_lockerp/#` cur_txn/#d associate_lockerp/#h handle_lock34#l cl_id#| timestamp# fid_gen# my_rskey*# my_rkey*# my_rdata*# saved_open_fhp/# dblistlinks_@# free_queuefE# active_queueE# join_queueE# s_secondariesE# s_linksF# s_refcnt# s_callbackGF# s_primary)# s_assoc_flags# f_primarieseF# s_foreign)# api_internal# bt_internal# h_internal# p_internal# q_internal# associateF# associate_foreignF# closeF# compactF# cursorF# delF# errF# errxF# existsF# fdF# getF# get_allocG# get_append_recno G# get_bt_compareG# get_bt_compress%G# get_bt_minkey1G# get_bt_prefix=G# get_byteswappedIG# get_cachesizeUG# get_create_diraG# get_dbnamemG# get_dup_compareyG# get_encrypt_flagsG# get_envG# get_errcallG# get_errfileG# get_errpfxG# get_feedbackG# get_flagsG# get_h_compareG# get_h_ffactorG# get_h_hashG# get_h_nelemG# get_lorderG# get_mpf H# get_msgcallH# get_msgfileH# get_multiple%H# get_open_flags1H# get_pagesize=H# get_partition_callbackIH# get_partition_dirsUH# get_partition_keysaH# get_prioritymH# get_q_extentsizeyH# get_re_delimH# get_re_lenH# get_re_padH# get_re_sourceH# get_transactionalH# get_typeH# joinH# key_rangeH# openH# pgetH# putH# remove I# renameI# set_alloc!I# set_append_recno-I# set_bt_compare9I# set_bt_compressEI# set_bt_minkeyQI# set_bt_prefix]I# set_cachesizeiI# set_create_diruI# set_dup_compareI# set_encryptI# set_errcallI# set_errfileI# set_errpfxI# set_feedbackI# set_flagsI# set_h_compareI# set_h_ffactorI# set_h_hashI# set_h_nelemI# set_lorderI# set_msgcallJ# set_msgfile J# set_pagesizeJ# set_paniccall!J# set_partition-J# set_partition_dirs9J# set_priorityEJ# set_q_extentsizeQJ# set_re_delim]J# set_re_leniJ# set_re_paduJ# set_re_sourceJ# sort_multipleJ# statJ# stat_printJ# syncJ# truncateJ# upgradeJ# verifyJ# dumpJ# db_am_removeJ# db_am_renameJ# stored_getK# stored_closeK# am_ok# preserve_fid # orig_flags# flags#A4U@@ tqe_nextU@# tqe_prevZ@#__dbc@jC dbp)# dbenvN%# env# thread_info/# txn/# priorityt)# links~C# rskey *# rkey *#$ rdata *#( my_rskey*#, my_rkey*#H my_rdata*#d lrefp/# lockerp/# lock_dbt*# lockC# mylock34# cl_id# dbtype*# internal-D# closeCD# cmpOD# count[D# delgD# dupsD# getD# get_priorityD# pgetD# putD# set_priorityD# c_closeD# c_countD# c_delD# c_dupD# c_getD# c_pgetD# c_putE# am_bulkE# am_closeE# am_del'E# am_destroy3E# am_get?E# am_putKE# am_writelockWE# flags#@DBCjCtCC tqe_nexttC# tqe_prevyC#C V __db_ilockC pgnoB/# fileidC# type#CDB_LOCK_ILOCK__dbc_internal DDBC_INTERNALD CDtC2D HD TD `D lD xD D D D D D D D D D D D E E  E ,E 8E DE PE@\E __cq_fqE tqh_first\E# tqh_lastaE# __cq_aqE tqh_first\E# tqh_lastaE# __cq_jqE tqh_first\E# tqh_lastaE#F lh_firstU@#@F le_nextU@# le_prevZ@# @F__db_foreign_infoLF~F lh_first`F# ~F F F F F FFF F F F F G G G *G 6G BG NG ZG fG rG ~GN%GGGG G G G G G G G-HHH H *H 6H BH NH ZH fH rH ~H H H H H H H H H H H I I I &I 2I >I JI VI bI nI zI IIII I I I I I I IIJ J J &J 2J >J JJ VJ bJ nJ zJ J J J J J J J J J J J  KA4DB*K*)Kmyopen0kmU L Lfname*type  flagsLretdb)r dbflags AllMllMlllevel 'LdbLLopen_btreem(mU uLzLfname flags Lret'uLopen_hash0mXmU LLfname flags Lret'Lmyclose`mmU 2MLdbr a)gettidm'oU MMmytidMtid wherer txnMM/myfetch0opU NLmydbNkey  keylenNdataNdatalenMmytid flags r k*d*db)tid/'N'NN fetch!p qU COLmydbHOkey  keylenWOdataNdatalenMmytid 'CO'MOROfetchlock) qSqU OLmydb%Okey&  keylen&Odata'Ndatalen'Mmytid('O'OOforeachI`qwU aRLmydbDprefixE  prefixlenERgoodpFRcbGrockGMmytidH r Jk*Kd*KcursortCLdb)Mtid/Nrdrrdrrdrrdrrdrrdrr ^@svLsvLsvtsOus(us(ussssssr zOuv]uv]uvluuluuluur vwvwvwvwvwvwr 'aR'kR RfR pR uRforeach_p R'R'R RR R Rforeach_cb RmystorewzU YTLmydb^Tkey  keylenhTdata datalenMmytid putflags  txnflags$r k*d*tid/db)`y'zly'zly'zly'ztyytyyr2 'YT'cTcreate-zzU TLdb)Tkey*  keylen*Tdata+ datalen+Mtid,'T'Tstore5z{U ULdb1Ukey2  keylen2Udata3 datalen3Mtid4'U'Ucreate_nosync= {V{U !VLdb9&Vkey:  keylen:0Vdata; datalen;Mtid<'!V'+Vstore_nosyncF`{{U VLdbBVkeyC  keylenCVdataD datalenDMtidE'V'VmydeleteM{H~U WLmydbJWkeyK  keylenKMmytidL txnflagsL forceLr Nk*Otid/Pdb)Q }}}}}}}}}}}}r2 q'WdeleteP~|~U oXLdbtXkey  keylenMtid force'oXdelete_nosync~~U XLdbXkey  keylenMtid force'Xmycommit~U rYLdbMtid  txnflagsr t/commit_txnU YLdbMtid commit_nosyncU YLdbMtid abort_txnhU ^ZLdbMtid r t/'^Z'hZ ZmZ rZ Z Z Z Z Z Z Z Z Z Z [ [ [ )[ 5[ cyrusdb_backendD Q\ namecZ# initZ# doneZ# syncZ# archiveZ# openZ# closeZ# fetchZ# fetchlockZ# foreachZ#$ createZ#( store[#, delete [#0 commit[#4 abort$[#8 dump0[#< consistent<[#@cyrusdb_berkeleyA[cyrusdb_berkeley_nosyncA[Dcyrusdb_berkeley_hashA[cyrusdb_berkeley_hash_nosyncA[0 dbenvN%a'] fatal%]] !cyrus_opt _CYRUSOPT_ZEROCYRUSOPT_AUTH_UNIX_GROUP_ENABLECYRUSOPT_USERNAME_TOLOWERCYRUSOPT_SKIPLIST_UNSAFECYRUSOPT_TEMP_PATHCYRUSOPT_PTS_CACHE_TIMEOUTCYRUSOPT_CONFIG_DIRCYRUSOPT_DB_INIT_FLAGSCYRUSOPT_FULLDIRHASHCYRUSOPT_PTSCACHE_DB CYRUSOPT_PTSCACHE_DB_PATH CYRUSOPT_PTLOADER_SOCK CYRUSOPT_VIRTDOMAINS CYRUSOPT_BERKELEY_CACHESIZE CYRUSOPT_AUTH_MECHCYRUSOPT_BERKELEY_LOCKS_MAXCYRUSOPT_BERKELEY_TXNS_MAXCYRUSOPT_DELETERIGHTCYRUSOPT_SQL_DATABASECYRUSOPT_SQL_ENGINECYRUSOPT_SQL_HOSTNAMESCYRUSOPT_SQL_USERCYRUSOPT_SQL_PASSWDCYRUSOPT_SQL_USESSLCYRUSOPT_SKIPLIST_ALWAYS_CHECKPOINTCYRUSOPT_LAST"libcyrus_config_getint _%]'_'_"cyrusdb_copyfile $`__'$`'.`"bsearch_ncompare k`)` 3` 'k`'u` assertionfailed`p` z` free` exit` #abort''`"strlcpya``'a"strrchr9aa '9a"strlen]a>a']a"strcpyaba'a'a"strcmp aaa"memseta {a{a"memcmp baa'b syslog;b b$"db_versioncbNNN8cb"db_env_create bhb"db_strerrorb "db_create bZ@cb"__posix_ttyname_r c "__posix_getlogin_r 3c '3c"unlink Wc8c'Wc"snprintf c\c$ 'c"_xmknod ccc99 'c"_lxstat ccc 'c"_xstat (dcc "_fxstat Rd(d VRd"__posix_ctime_rdWd tm$ e tm_sec # tm_min # tm_hour # tm_mday # tm_mon # tm_year # tm_wday # tm_yday # tm_isdst # de%__posix_asctime_r"eaE cyrusdb_sql.c /var/tmp/cyrus-imapd-2.4.17/lib /opt/solstudio12.2/prod/bin/cc -c -I.. -I/usr/local/include -I/usr/local/include -I/usr/local/mysql/include -I/usr/local/include -I/usr/local/include -I/usr/include/gssapi -I/usr/local/include -I/include -I/usr/local/include -I/usr/local/lib/include -DHAVE_CONFIG_H -g cyrusdb_sql.c -W0,-xp.XAKgoyLghuJRE63.Xa;g;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;G=.XAKgoyLghuJRE63.;backend;raw;cd;DBG_GEN 5.3.0<statxpU*_pathr_bufr intchar%unsigned long/dev_tlongL e L/ino_t/mode_t/nlink_tLuid_tLgid_tL LLoff_tLtime_t timespec tv_sec# tv_nsecL#timestruc_tLblksize_tLblkcnt_t@ LL Q L stat st_dev@# st_pad1T# st_inoe# st_modeq# st_nlink~# st_uid# st_gid# st_rdev@#$ st_pad2#( st_size#0 st_pad3L#4 st_atim#8 st_mtim#@ st_ctim#H st_blksize#P st_blocks #T st_fstype/#X st_pad4@#hQlstatU_path_buf fstatЀU _fd_buf mknodЀUY^_pathq_mode @_devY dbinit]xvoid 'sql_engine$ name}# binary_type# sql_open# sql_escape# sql_begin_txn# sql_commit_txn # sql_rollback_txn# sql_exec"# sql_close*# /sql_engine_t dbengine^_mysql_opengUhostdportd usesslduserepasswordedatabasef mysqlhst_vioViounsigned charmy_socketunsignedmy_boolNL_ Lst_netl vio# buff# buff_end# write_pos# read_pos# fd # remain_in_buf/# length/# buf_length/# where_b/#$ max_packet/#( max_packet_size/#, pkt_nr#0 compress_pkt_nr#4 write_timeout#8 read_timeout#< retry_count#@ fcntl#D return_status(#H reading_or_writing#L save_char#M unused1-#N unused2-#O compress-#P unused3-#Q unused#T last_errno#X error#\ unused4-#] unused5-#^ last_error;#_ sqlstateN# extension#_NETcharset_info_st enum_field_types MYSQL_TYPE_DECIMALMYSQL_TYPE_TINYMYSQL_TYPE_SHORTMYSQL_TYPE_LONGMYSQL_TYPE_FLOATMYSQL_TYPE_DOUBLEMYSQL_TYPE_NULLMYSQL_TYPE_TIMESTAMPMYSQL_TYPE_LONGLONGMYSQL_TYPE_INT24 MYSQL_TYPE_DATE MYSQL_TYPE_TIME MYSQL_TYPE_DATETIME MYSQL_TYPE_YEAR MYSQL_TYPE_NEWDATEMYSQL_TYPE_VARCHARMYSQL_TYPE_BITMYSQL_TYPE_NEWDECIMALMYSQL_TYPE_ENUMMYSQL_TYPE_SETMYSQL_TYPE_TINY_BLOBMYSQL_TYPE_MEDIUM_BLOBMYSQL_TYPE_LONG_BLOBMYSQL_TYPE_BLOBMYSQL_TYPE_VAR_STRINGMYSQL_TYPE_STRINGMYSQL_TYPE_GEOMETRY st_mysql_fieldT name# org_name# table# org_table# db# catalog# def# length/# max_length/# name_length#$ org_name_length#( table_length#, org_table_length#0 db_length#4 catalog_length#8 def_length#< flags#@ decimals#D charsetnr#H type #L extension#P MYSQL_FIELD st_used_mem  next# left# size#USED_MEM size_t st_mem_root  free # used # pre_alloc # min_malloc# block_size# block_num# first_block_usage# error_handler#$MEM_ROOT unsigned long longmy_ulonglongst_dynamic_arraymysql_optionMYSQL_OPT_CONNECT_TIMEOUTMYSQL_OPT_COMPRESSMYSQL_OPT_NAMED_PIPEMYSQL_INIT_COMMANDMYSQL_READ_DEFAULT_FILEMYSQL_READ_DEFAULT_GROUPMYSQL_SET_CHARSET_DIRMYSQL_SET_CHARSET_NAMEMYSQL_OPT_LOCAL_INFILEMYSQL_OPT_PROTOCOL MYSQL_SHARED_MEMORY_BASE_NAME MYSQL_OPT_READ_TIMEOUT MYSQL_OPT_WRITE_TIMEOUT MYSQL_OPT_USE_RESULT MYSQL_OPT_USE_REMOTE_CONNECTIONMYSQL_OPT_USE_EMBEDDED_CONNECTIONMYSQL_OPT_GUESS_CONNECTIONMYSQL_SET_CLIENT_IPMYSQL_SECURE_AUTHMYSQL_REPORT_DATA_TRUNCATIONMYSQL_OPT_RECONNECTMYSQL_OPT_SSL_VERIFY_SERVER_CERTMYSQL_PLUGIN_DIRMYSQL_DEFAULT_AUTH st_mysql_options_extention st_mysql_optionsE connect_timeout# read_timeout# write_timeout# port# protocol# client_flag/# host# user# password# unix_socket#$ db#( init_commands#, my_cnf_file#0 my_cnf_group#4 charset_dir#8 charset_name#< ssl_key#@ ssl_cert#D ssl_ca#H ssl_capath#L ssl_cipher#P shared_memory_base_name#T max_allowed_packet/#X use_ssl-#\ compress-#] named_pipe-#^ unused1-#_ unused2-#` unused3-#a unused4-#b methods_to_use#d client_ip#h secure_auth-#l report_data_truncation-#m local_infile_init#p local_infile_read#t local_infile_end#x local_infile_error#| local_infile_userdata# extension#mysql_statusMYSQL_STATUS_READYMYSQL_STATUS_GET_RESULTMYSQL_STATUS_USE_RESULTMYSQL_STATUS_STATEMENT_GET_RESULT L st_list  prev# next# data#LIST st_mysql_methods$7-st_mysqlu net # connector_fd# host# user# passwd# unix_socket# server_version# host_info# info# db# charset # fields# field_alloc# affected_rows# insert_id# extra_info# thread_id/# packet_length/# port# client_flag/# server_capabilities/# protocol_version# field_count# server_status# server_language# warning_count# options # statusE# free_me-# reconnect-# scramble# unused1-# unused2# unused3# unused4# unused5# stmts# methods<# thd# unbuffered_fetch_ownerA# info_buffer# extension#FMYSQLu_mysql_escapevUconnttot  fromufromlenu tolenw_mysql_execUconncmd =cbrock result row len ruTT lengthT 0 exec_cb0 st_mysql_rows  next# data# length/#BMYSQL_ROWBMYSQL_ROWSembedded_query_result st_mysql_data8> data# embedded_info# alloc# rows#( fields#0 extension#4MYSQL_DATA>/$Y st_mysql_resX row_count# fields# dataO# data_cursor# lengthsT# handle# methods^# row# current_row#$ field_alloc#( field_count#H current_field#L eof-#P unbuffered_fetch_cancelled-#Q extension#TcMYSQL_RES_mysql_begin_txnǃUconn_mysql_commit_txnЃUconn_mysql_rollback_txn'ULconn_mysql_close0CU}conn_pgsql_openPUC hostport usesslH userR password\ database connx  conninfo pC M W pg_conna PGconn k _pgsql_escapeU connto  fromfromlen tolen _pgsql_execU;"conn@"cmd =cbrock result`" row_count i r status.#hȇMȇMkeydatakeylendatalen;"pg_resultE"PGresult Q" .#PGRES_EMPTY_QUERYPGRES_COMMAND_OKPGRES_TUPLES_OKPGRES_COPY_OUTPGRES_COPY_INPGRES_BAD_RESPONSEPGRES_NONFATAL_ERRORPGRES_FATAL_ERRORPGRES_COPY_BOTHPGRES_SINGLE_TUPLE e"ExecStatusType _pgsql_begin_txn'U~#conn&_pgsql_commit_txn,U#conn+_pgsql_rollback_txn1U#conn0_pgsql_close6 3U+$conn5_sqlite_openE@U$host?port@ usesslA$userB$passwordC$databaseDrcFdb%G$$$sqlite3%sqlite3  %_sqlite_escapeTU%connRtoS %fromSfromlenStolenU%_sqlite_execeU&connd&cmdd =cbdrockdrcfrfstmt&gtail'h;key'ukeylenvdata'wdatalenx&sqlite3_stmt&sqlite3_stmt &' ''_sqlite_begin_txnU['conn_sqlite_commit_txnU'conn_sqlite_rollback_txnU'conn_sqlite_close 3U (conn ((!Lsql_engines(d (K( Lsql_engines:(dinit@^U ))dbdirflags engine_name)r)))errbuf) ))1)L"done`}U"mysyncUmyarchiveU))fnames)dirname )))myopen`UB+G+fnameflags +retdatabase+hostnames+user+passwd+host_ptrhostcur_hostcur_portusesslconnptablecmd+B+db+ conn# table# esc_key# esc_data# data#L++++Lmyclose;`1U++db:start_txnI@UR,(,+dbHtxnR, lastkey# keylen#(,select_cb^U,rock[,key\ keylen\-data]datalen]srock-_r`,- -- D----foreach_cb D-select_rock- found# tidR,# goodpU-# cbU-# rock#Z-fetch_cbU?.rock{D.key| keylen}N.data~datalen~frock.?.I.fetch_rock. data# datalenS.#X.fetch&U/+db/key keylen/dataS.datalen/tidcmd/esc_keyfrockX.srockZ-r#C///R,/Lforeach02U0+dbprefix prefixlen0goodpU-cbrock/tid cmd0esc_keysrockZ-r#C00 0000foreach_p 01Lmystore@U/2+db42key keylen>2datadatalen/tidoverwrite cmdC2esc_keyrҘ!!!srockZ-esc_data#C/292V2Lcreate-МU2+db)2key* keylen*2data+datalen+/tid,22store5МUm3+db1r3key2 keylen2|3data3datalen3/tid4m3w3delete=,U3+db93key: keylen:/tid;force<3finish_txnB0 U4+dbAR,tidA commitA6BBrcDcommit_txnU0U4+dbTR,tidT abort_txnZ0PU5+dbYR,tidY 5 5 -55525>5J5V5b5n5z555555555 cyrusdb_backendD 6 name5# init-5# done95# syncE5# archiveQ5# open]5# closei5# fetchu5# fetchlock5# foreach5#$ create5#( store5#, delete5#0 commit5#4 abort5#8 dump5#< consistent5#@$cyrusdb_sql5^&%sqlite3_finalize;77;7%sqlite3_column_text@7q77%sqlite3_column_bytes77%sqlite3_step77%7777%sqlite3_prepare877778%sqlite3_errmsg8D87D87%sqlite3_openx8I8N8%sqlite3_close878%PQescapeBytea88(8%PQunescapeBytea98(E"&PQclear99E"9%PQgetvalueN9!9E"N9%PQntuplesu9S9%PQresStatus9e"E"9%PQresultStatus.#99pg_conn99%PQexec`"999a 9%PQerrorMessage$:9a $: :CONNECTION_OKCONNECTION_BADCONNECTION_STARTEDCONNECTION_MADECONNECTION_AWAITING_RESPONSECONNECTION_AUTH_OKCONNECTION_SETENVCONNECTION_SSL_STARTUPCONNECTION_NEEDED.:ConnStatusType %PQstatus:$;):a &PQfinishA;$;A;%PQconnectdbx j;F;F&mysql_close;j;;%mysql_real_escape_string/;j;;/c%mysql_fetch_lengthsT;;c%mysql_fetch_row#<;&mysql_free_resultD<;F%mysql_store_resulto<D<o<%mysql_real_query<j;t</<<<<<%mysql_real_connect"=<<<<</%mysql_init@=@=%mysql_errorE=i=j;%mysql_field_count=j;=&fatal===%xstrdup==%xrealloc=%xzmalloc>cyrus_opt@CYRUSOPT_ZEROCYRUSOPT_AUTH_UNIX_GROUP_ENABLECYRUSOPT_USERNAME_TOLOWERCYRUSOPT_SKIPLIST_UNSAFECYRUSOPT_TEMP_PATHCYRUSOPT_PTS_CACHE_TIMEOUTCYRUSOPT_CONFIG_DIRCYRUSOPT_DB_INIT_FLAGSCYRUSOPT_FULLDIRHASHCYRUSOPT_PTSCACHE_DB CYRUSOPT_PTSCACHE_DB_PATH CYRUSOPT_PTLOADER_SOCK CYRUSOPT_VIRTDOMAINS CYRUSOPT_BERKELEY_CACHESIZE CYRUSOPT_AUTH_MECHCYRUSOPT_BERKELEY_LOCKS_MAXCYRUSOPT_BERKELEY_TXNS_MAXCYRUSOPT_DELETERIGHTCYRUSOPT_SQL_DATABASECYRUSOPT_SQL_ENGINECYRUSOPT_SQL_HOSTNAMESCYRUSOPT_SQL_USERCYRUSOPT_SQL_PASSWDCYRUSOPT_SQL_USESSLCYRUSOPT_SKIPLIST_ALWAYS_CHECKPOINTCYRUSOPT_LAST%libcyrus_config_getswitch@>@%libcyrus_config_getstring@A>A%snprintfAAA'AA%sprintflAFA'lA%printfAqA'%__posix_ttyname_rA%__posix_getlogin_rAA%strtoul/BA&free.B.B8B%strcasecmpeB3B=BeB%strrchrBjBB%strchrBBB%strlenBBB%memcpy CB CC%memcmpBCCCBCLC&__assertxCGCQCxC&syslogC}C'C%_xmknodCCC//C%_lxstat DCCD%_xstat>D DD%_fxstathD>DLhD%__posix_ctime_rDmD tm$3E tm_sec# tm_min# tm_hour# tm_mday# tm_mon# tm_year# tm_wday# tm_yday# tm_isdst# D3E(__posix_asctime_r8EA 1"bsearch.c /var/tmp/cyrus-imapd-2.4.17/lib /opt/solstudio12.2/prod/bin/cc -c -I.. -I/usr/local/include -I/usr/local/include -I/usr/local/mysql/include -I/usr/local/include -I/usr/local/include -I/usr/include/gssapi -I/usr/local/include -I/include -I/usr/local/include -I/usr/local/lib/include -DHAVE_CONFIG_H -g bsearch.c -W0,-xp.XAKgoyLbhuJR0l2.Xa;g;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;G=.XAKgoyLbhuJR0l2.;backend;raw;cd;DBG_GEN 5.3.0statxPpU"_pathrz_bufr intcharunsigned long'dev_tlongD ] D'ino_t'mode_t'nlink_tDuid_tDgid_tD DDoff_tDtime_t timespec tv_sec# tv_nsecD#timestruc_tDblksize_tDblkcnt_t8 DD I D statz st_dev8# st_pad1L# st_ino]# st_modei# st_nlinkv# st_uid# st_gid# st_rdev8#$ st_pad2#( st_size#0 st_pad3D#4 st_atim#8 st_mtim#@ st_ctim#H st_blksize#P st_blocks#T st_fstype'#X st_pad48#hIlstatpU_pathz_buf fstatU_fdz_buf mknod؞UQV_pathi_mode 8_devQunsigned char [ Dconvert_to_comparel8\bsearch_memmUwordgcaseSensitiveh basei'lenj'hintk linelenplfirstsearchnstart'oend'omid'ooffset'olinelen'pnDqcmprwordpsps'bsearch_compareǠ9Us1s2 cmpc2bsearch_ncompare@]U#s1l1 -s2l2mincmp(void2:unsigned2memchrPy?D~_xmknody''_lxstatz_xstat z_fxstatC  zDC __posix_ctime_rM z H M tm$ tm_sec# tm_min# tm_hour# tm_mday# tm_mon# tm_year# tm_wday# tm_yday# tm_isdst# z  __posix_asctime_rM  M h 2#retry.c /var/tmp/cyrus-imapd-2.4.17/lib /opt/solstudio12.2/prod/bin/cc -c -I.. -I/usr/local/include -I/usr/local/include -I/usr/local/mysql/include -I/usr/local/include -I/usr/local/include -I/usr/include/gssapi -I/usr/local/include -I/include -I/usr/local/include -I/usr/local/lib/include -DHAVE_CONFIG_H -g retry.c -W0,-xp.XAKgoyLbhuJREo2.Xa;g;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;G=.XAKgoyLbhuJREo2.;backend;raw;cd;DBG_GEN 5.3.0statx`U  _pathrv_bufr intcharunsigned long#dev_tlong@ Y @#ino_t#mode_t#nlink_t@uid_t@gid_t@ @@off_t@time_t timespec tv_sec# tv_nsec@#timestruc_t@blksize_t@blkcnt_t4 @@ E @ statv st_dev4# st_pad1H# st_inoY# st_modee# st_nlinkr# st_uid# st_gid# st_rdev4#$ st_pad2#( st_size#0 st_pad3@#4 st_atim#8 st_mtim#@ st_ctim#H st_blksize#P st_blocks#T st_fstype##X st_pad44#hElstatU _pathv_buf fstatU  _fdv_buf mknodU MR_pathe_mode 4_devM retry_read<U  fd;buf; nbyte; n = nread >voidunsignedsize_t retry_write\=U l fd[qbuf[ nbyte[ n ] written ^l retry_writev~@4U E fdzsrciovz  iovcntz n  i  written  iov baseiov iov_max \Ecaddr_t iovec iov_baseJ# iov_len@#Xxmallocfree__posix_ttyname_r  E__posix_getlogin_r E  ssize_t#writeP(readwPXwwritev| _xmknod ## _lxstat  v  _xstat E   v _fxstat o E  v@o __posix_ctime_rE t E tm$: tm_sec # tm_min # tm_hour # tm_mday # tm_mon # tm_year # tm_wday # tm_yday # tm_isdst #  : __posix_asctime_rE? E 1$lock_fcntl.c /var/tmp/cyrus-imapd-2.4.17/lib /opt/solstudio12.2/prod/bin/cc -c -I.. -I/usr/local/include -I/usr/local/include -I/usr/local/mysql/include -I/usr/local/include -I/usr/local/include -I/usr/include/gssapi -I/usr/local/include -I/include -I/usr/local/include -I/usr/local/lib/include -DHAVE_CONFIG_H -g lock_fcntl.c -W0,-xp.XAKgoyLfhuJRUm3.Xa;g;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;G=.XAKgoyLfhuJRUm3.;backend;raw;cd;DBG_GEN 5.3.0statx@`U(_pathr_bufr intchar#unsigned long-dev_tlongJ c J-ino_t-mode_t-nlink_tJuid_tJgid_tJ JJoff_tJtime_t timespec tv_sec# tv_nsecJ#timestruc_tJblksize_tJblkcnt_t> JJ O J stat st_dev># st_pad1R# st_inoc# st_modeo# st_nlink|# st_uid# st_gid# st_rdev>#$ st_pad2#( st_size#0 st_pad3J#4 st_atim#8 st_mtim#@ st_ctim#H st_blksize#P st_blocks#T st_fstype-#X st_pad4>#hOlstat`U_path_buf fstatU _fd_buf mknodȨUW\_patho_mode >_devWa lock_method_descf6` lock_reopenKШU^fdFcfilenameF sbufFrfailactionFrLflMsbuffileONsbufspareONnewfdO^hmshortJpid_tJ J flock$ l_typew# l_whencew# l_start# l_len# l_sysid# l_pid# l_pad# lock_blockingUmfdrfl lock_shared Ufdrfl lock_nonblockingUfdrfl lock_unlockiUtfdflrunsigned__posix_ttyname_rty__posix_getlogin_rtdup2close  open=  fcntl\ a _xmknod \ f -- _lxstat    _xstat   _fxstat&  J& __posix_ctime_rtX + t tm$ tm_sec# tm_min# tm_hour# tm_mday# tm_mon# tm_year# tm_wday# tm_yday# tm_isdst# X  __posix_asctime_rt tE6%hash.c /var/tmp/cyrus-imapd-2.4.17/lib /opt/solstudio12.2/prod/bin/cc -c -I.. -I/usr/local/include -I/usr/local/include -I/usr/local/mysql/include -I/usr/local/include -I/usr/local/include -I/usr/include/gssapi -I/usr/local/include -I/include -I/usr/local/include -I/usr/local/lib/include -DHAVE_CONFIG_H -g hash.c -W0,-xp.XAKgoyLahuJRkd2.Xa;g;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;G=.XAKgoyLahuJRkd2.;backend;raw;cd;DBG_GEN 5.3.0statxpU_pathrt_bufr intcharunsigned long!dev_tlong> W >!ino_t!mode_t!nlink_t>uid_t>gid_t> >>off_t>time_t timespec tv_sec# tv_nsec>#timestruc_t>blksize_t>blkcnt_t2 >> C > statt st_dev2# st_pad1F# st_inoW# st_modec# st_nlinkp# st_uid~# st_gid# st_rdev2#$ st_pad2#( st_size#0 st_pad3>#4 st_atim#8 st_mtim#@ st_ctim#H st_blksize#P st_blocks#T st_fstype!#X st_pad42#hClstatU_patht_buf fstatЬU_fdt_buf mknodЬUKP_pathc_mode 2_devK construct_hash_table+ڭUtable*size* use_mpool*unsignedsize_tvoid bucket  key# data# next#bucket) mpool3 hash_table { size# table.# pool;#@hash_table{ hash_insertNUkeyMdataM tableMvalOptr)Pnewptr)Pprev.Q ܯ ܯcmpresultn ܯ(H(Hold_dataq hash_lookupCULQkeytable valptr)̰7$$cmpresultL hash_delPU keytable valdataptr)last)cmpresultfree_hash_table˳U table func iptr)temp) hash_enumerate-гYU? table+B func+ rock,i.temp)/temp_next)/? G fatalk L k xstrdup p xmalloc  mpool_strdup ; mpool_malloc ;free_mpool ;new_mpool;6 6 strhash[ ; l > __sigbits[ #l  __posix_sigwait   __posix_ttyname_r __posix_getlogin_r free+ + 5 strcmp^ 0 : memset  _xmknod   !! _lxstat   t _xstat"   t_fxstatL " t>L __posix_ctime_r~ Q  tm$  tm_sec# tm_min# tm_hour# tm_mday# tm_mon# tm_year# tm_wday# tm_yday# tm_isdst# ~ __posix_asctime_r &mpool.c /var/tmp/cyrus-imapd-2.4.17/lib /opt/solstudio12.2/prod/bin/cc -c -I.. -I/usr/local/include -I/usr/local/include -I/usr/local/mysql/include -I/usr/local/include -I/usr/local/include -I/usr/include/gssapi -I/usr/local/include -I/include -I/usr/local/include -I/usr/local/lib/include -DHAVE_CONFIG_H -g mpool.c -W0,-xp.XAKgoyLahuJRUe2.Xa;g;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;G=.XAKgoyLahuJRUe2.;backend;raw;cd;DBG_GEN 5.3.0kstatx`U  _pathrv_bufr intcharunsigned long#dev_tlong@ Y @#ino_t#mode_t#nlink_t@uid_t@gid_t@ @@off_t@time_t timespec tv_sec# tv_nsec@#timestruc_t@blksize_t@blkcnt_t4 @@ E @ statv st_dev4# st_pad1H# st_inoY# st_modee# st_nlinkr# st_uid# st_gid# st_rdev4#$ st_pad2#( st_size#0 st_pad3@#4 st_atim#8 st_mtim#@ st_ctim#H st_blksize#P st_blocks#T st_fstype##X st_pad44#hElstatU _pathv_buf fstatU  _fdv_buf mknodU MR_pathe_mode 4_devMnew_mpool_blobNUUsizeM blobOunsignedsize_tunsigned char mpool_blob size# base# ptr# next# new_mpool\`U{asize[ ret{] mpool{ blob#afree_mpoolf#U{poole pg p_nextgmpool_malloc07U{poolsize ret p remain new_pool new_pool_sizevoidmpool_strndup@U{pool$str n retmpool_strdupU{poolstr lenfatal xmallocfree @ __sigbits#  __posix_sigwait ?   ? strncpyn D n strlen s __posix_ttyname_r   __posix_getlogin_r     _xmknod %   ## * _lxstat Y % / v ^ _xstat  Y c v _fxstat    v@ __posix_ctime_r   tm$ tm_sec # tm_min # tm_hour # tm_mday # tm_mon # tm_year # tm_wday # tm_yday # tm_isdst #   __posix_asctime_r O'strhash.c /var/tmp/cyrus-imapd-2.4.17/lib /opt/solstudio12.2/prod/bin/cc -c -I.. -I/usr/local/include -I/usr/local/include -I/usr/local/mysql/include -I/usr/local/include -I/usr/local/include -I/usr/include/gssapi -I/usr/local/include -I/include -I/usr/local/include -I/usr/local/lib/include -DHAVE_CONFIG_H -g strhash.c -W0,-xp.XAKgoyLbhuJR0f2.Xa;g;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;G=.XAKgoyLbhuJR0f2.;backend;raw;cd;DBG_GEN 5.3.0strhash=GU,,Estring<ret_val,>iJ?unsignedchar8@int?(assert.c /var/tmp/cyrus-imapd-2.4.17/lib /opt/solstudio12.2/prod/bin/cc -c -I.. -I/usr/local/include -I/usr/local/include -I/usr/local/mysql/include -I/usr/local/include -I/usr/local/include -I/usr/include/gssapi -I/usr/local/include -I/include -I/usr/local/include -I/usr/local/lib/include -DHAVE_CONFIG_H -g assert.c -W0,-xp.XAKgoyLbhuJREi2.Xa;g;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;G=.XAKgoyLbhuJREi2.;backend;raw;cd;DBG_GEN 5.3.0YstatxPpU   _pathrx_bufr intcharunsigned long%dev_tlongB [ B%ino_t%mode_t%nlink_tBuid_tBgid_tB BBoff_tBtime_t timespec tv_sec# tv_nsecB#timestruc_tBblksize_tBblkcnt_t6 BB G B statx st_dev6# st_pad1J# st_ino[# st_modeg# st_nlinkt# st_uid# st_gid# st_rdev6#$ st_pad2#( st_size#0 st_pad3B#4 st_atim#8 st_mtim#@ st_ctim#H st_blksize#P st_blocks#T st_fstype%#X st_pad46#hGlstatpU _pathx_buf fstatU  _fdx_buf mknodظU OT_pathg_mode 6_devO assertionfailed9nUfile5 line5 expr5 buf:Bfatal  unsignedsnprintf L   Q_xmknod LV%% _lxstat x _xstat x _fxstat  xB__posix_ctime_r H  tm$ tm_sec # tm_min # tm_hour # tm_mday # tm_mon # tm_year # tm_wday # tm_yday # tm_isdst # H__posix_asctime_r  [U /var/tmp/cyrus-imapd-2.4.17/perl/sieve/managesievemanagesieve.xs /var/tmp/cyrus-imapd-2.4.17/perl/sieve/lib/usr/include/sys/usr/local/include/sasl./../../../lib/usr/local/include/openssl/usr/local/include/usr/include/usr/include/netinet/usr/include/isoisieve.cstat_impl.hstat.htypes.htime_impl.htime.hsasl.hprot.hssl.hbio.hcrypto.hstack.hossl_typ.hbuffer.hssl2.hssl3.hevp.hdh.hbn.hec.hcomp.hdtls1.hpqueue.hx509.hasn1.hrsa.hdsa.hx509_vfy.hlhash.hpem.hzlib.hzconf.hisieve.hnetdb.hin.hsocket_impl.hlex.hmystring.hstdio_impl.hint_types.htime_iso.h + 06K PVk pv       , 03A O `fm        * 2 4 S X f my~         5 N U `fu              ( / N \ c       F Xi q        . = h       8 ` q {      V -& 5; @FM\ i         &< F T{        ,< R       F N \yd       7 H Oq     w  % @ cp      6SE0T \      06> LP Y \ e h tx     9K{  7 J w |       1 ^ `t}       / A T i q |    % - ; B _ k           $ 8L Ti w      % 6 @ G PY       A Q d l       , 8> PY      % 8 @ \ hn       $H N ' /var/tmp/cyrus-imapd-2.4.17/perl/sieve/lib/usr/include/sys./../../../lib/usr/local/include/sasl/usr/local/include/openssl/usr/local/include/usr/include/isolex.cstat_impl.hstat.htypes.htime_impl.htime.hlex.hmystring.hprot.hsasl.hssl.hbio.hcrypto.hstack.hossl_typ.hbuffer.hssl2.hssl3.hevp.hdh.hbn.hec.hcomp.hdtls1.hpqueue.hx509.hasn1.hrsa.hdsa.hx509_vfy.hlhash.hpem.hzlib.hzconf.htime_iso.h`f{     < \ |          ' 4 <D N T \ f t |        4 > L]         < U \ l        $ , D L x         <n    ~     # L \ h r               , 8 B H R \ f l v |  Z4(< Sm       $  H  L ~` h  /var/tmp/cyrus-imapd-2.4.17/perl/sieve/lib/usr/include/sys/usr/include/isomystring.cstat_impl.hstat.htypes.htime_impl.htime.hmystring.htime_iso.h          +  0 6 S  ` f =               -  3  @ C T  ` f            ~    & /  8  >  F  L m             {          0 6 G \  }         ~           @ L d u  o  c /var/tmp/cyrus-imapd-2.4.17/perl/sieve/lib/usr/include/sys./../../../lib/usr/local/include/sasl/usr/local/include/openssl/usr/local/include/usr/include/usr/include/isorequest.cstat_impl.hstat.htypes.htime_impl.htime.hprot.hsasl.hssl.hbio.hcrypto.hstack.hossl_typ.hbuffer.hssl2.hssl3.hevp.hdh.hbn.hec.hcomp.hdtls1.hpqueue.hx509.hasn1.hrsa.hdsa.hx509_vfy.hlhash.hpem.hzlib.hzconf.hmystring.hlex.hstdio_impl.hstdio_iso.hisieve.htime_iso.h   # 03D P `fm w         ' < K b q         , G[ j r {         &9 T^ mu ~        % 4 e z         ' - @F[ i |        ' 06=R g {        E PW `f       #1 J U _ p |        , 6 HRe w        ,l>O ] k |     K T[ `fm t         7 F \d         &- 4 E St         / K ` t      4G P X o       0 > F ] {          *  4 <  T  d  {              5!;! @!F!M!b! p! ! ! ! ! ! !!"  " " +" e" p"w"  /var/tmp/cyrus-imapd-2.4.17/lib/usr/include/sys/usr/include/usr/include/isoutil.cstat_impl.hstat.htypes.htime_impl.htime.hutil.hpwd.hint_types.hstdarg_iso.hgrp.htime_iso.h""" """ """ ""# ### (# ?# F#~R#X# `#f#l# x# # #~## ### # # # $ $ $+$v7$ B$ H$ P$V$n$ |$ $ $ $ $ $ $ % % %.% 6% @%F%% %%% &&& & "& )& ]& e& p& w&|&& &&& & & ' 5' >' E'}]'t'' '' ''' ' '' ( ( !(-( ;(G( U(a( o( ( ((( (( ( ( ) ) ().) @)I)O)m) x) ) ) ) ) ) ))v*  *  *&*H* Z* b* v* ** ** * ** + $+7+ b+ l+}++ + + +++ +++ ++, , K, P,V,d, s, , , , , ,,, , --- #- G- P-V-]- d- x-- - - - -|.. %. 6. =. P.V.]. d. x.. . . . .|// %/ 6/ =/ P/V/g/ z/ |/ / // / / // //0 0 &0 50>0 P0S0_0 k0 p0v00 000 0 000 0 0 0 1 1  1#1B1 P1S1a1 i1 y1 1 1 111 111 112 22'2 92 @2C2K2 [2 x2 2 2 222 2 2 333 '3 -3 X3 X3 `3 s3 y3 3 333 333 3 4+4 44 S4 [4 g4 z4 4 4 4 4 4 4 4 5q5%5 0565_5 f5 n5 5 5 5 5 5 55 555 5 5 5 66 6 6  6 )6 0636>6 O6 Y6 c6 m6 w6 666 6 6 6 6666 6 7 7 67 L7 r7 r777 7 7 7 7 8~'8'8 -8 H< /var/tmp/cyrus-imapd-2.4.17/lib/usr/include/sys/usr/local/include/sasl/usr/local/include/openssl/usr/local/include/usr/include/isoprot.cstat_impl.hstat.htypes.htime_impl.htime.hprot.hsasl.hssl.hbio.hcrypto.hstack.hossl_typ.hbuffer.hssl2.hssl3.hevp.hdh.hbn.hec.hcomp.hdtls1.hpqueue.hx509.hasn1.hrsa.hdsa.hx509_vfy.hlhash.hpem.hzlib.hzconf.hint_types.hselect.hutil.hstdarg_iso.hlibcyr_cfg.htime_iso.h@8F8[8 `8f8{8 888 888 888 8  9 9 9 (9 19 ;9 E9 M9 W9 ]9 p9v99 9 9 9 9 9 9 9 999 : : $: 5:@: `: q: : :: : ::: : ::: : ;;;%; ,; @;I;k;; ; ;< *< 4<<<E< P< Z<a< p<v<< < << < < < < <= = != ,=>= E=N= \= g= == === = = === ==> >>> ,> 8> D> N> Y> g> z> >> >> > >> >? ? [? d? p?? ? ? ???? ? @ /@ 8@ A@{L@S@ `@f@p@ w@ @@@ @ @ @ @@A $A +A 0A6AXA A A A AAA A A A AABB (B 1B :B DBRB `B lB B BB BBB B B B B~BC  C  C ,C :C @CFC\C tC C C CCC C D  D D  D *D 4D >D ED PD_DDD D DD D D  E $E EE iE E EE E EEEE E%F 2F HF FF F F F GG LGVGG GG G G G H H 0H YH}H HxH H H H I 5I GI }II I I I I IJ J 2J @J\JaJlJ J JJ J J K  K K#K HKTK ]KhKwK K KK KK K  L L L 7L SL XL`L iL rL zLL L L L LLM M1McMMM M MM MMM M MM N >NXN tN xN N N N N N NNN NN N N N O O+O QOtO O O OO O O  P P *P 3P EPTPxP P PP Q Q%Q .Q 5Q @QFQKQ VQ tQ QQ Q Q QQQ Q Q R(R 4R >R LRTR ^R lR R RR RR R S S S S 1SGS XS lS vS~S SS S SS S S S T  T T  T/TXT jT tT |T T TT TT TTT T U$U 6U @U HU kU pUxU U UUU U U U UVV 6V VV eV mV vV V VV V VVVW W6W LW ]W qW {WWWW W W WW WWW X 0X?X NX UX \X qX xX X XX XX X X YYY7Y IY UY aY kY YxY Y Y Y Y Z "Z )Z 0Z6Z SZ `ZfZ lZ Z Z Z Z Z ZZ Z [ 0[ 8[J[ e[ [ [[ [ [ [ [\ %\ D\ H\P\rp\t\|\Y\)\\ \ ]  ]] 9] X] `] h] z] ] ] ]] ] ^ ^^r0^8^J^ i^ p^^ ^ ^^ ^ ^ ^ ^_ _ <_ @_H_rh_l_t___`` ` @` G` ``f` t` ` ` ` ` `` ` a,a 3a a}aa aa bb $bHb xbb bb b bb b b  c c 7c Fc Uc dc sc yc cc c c ccc c c d 7dAd Hd ^ddd zd d d d d dd  e e )e|Ce me e ee e e e e2f =f FfQf Xf `f uf ff f f f fJf=fg =gKg Xg jgg g g gg gg #h -h 8h @h Jh`h oh |h h h h h h hh i i *im@iIi Oi `ifi lii i i i i i i j|)j N     Ȥ Τ      ) 8 D [ c ~      ¥        ; J X l     զ      7 ? f o  ɧ ѧ ڧ     &DV d r    Ĩ      9 Lg x  /var/tmp/cyrus-imapd-2.4.17/lib/usr/include/sys/usr/include/isoimparse.cstat_impl.hstat.htypes.htime_impl.htime.htime_iso.h ˩ Щ֩   &?2 U      Ī ̪ت  A I p x   ī Ы ܫ   7 > V~      ( L XIܭ9  ( /Į|ۮ     * 2 H |         L _ h o vm а װ   , ?F  /var/tmp/cyrus-imapd-2.4.17/lib/usr/include/sys/usr/include/isosignals.cstat_impl.hstat.htypes.htime_impl.htime.hsignal.hselect.hsignals.htime_iso.hPVk pv  ӱ ;    : I^ mv  Ѳ~ $ 0 4 @yT [  /var/tmp/cyrus-imapd-2.4.17/lib/usr/include/sys/usr/include/isononblock_fcntl.cstat_impl.hstat.htypes.htime_impl.htime.htime_iso.h`f{   Ƴ     ( 8C U  /var/tmp/cyrus-imapd-2.4.17/lib/usr/include/sys/usr/include/isomap_shared.cstat_impl.hstat.htypes.htime_impl.htime.htime_iso.h`f{   ƴ  !    ̵    . =   Ҷ ۶     /var/tmp/cyrus-imapd-2.4.17/lib/usr/include/sys/usr/include/netinet/usr/include/isoiptostring.cstat_impl.hstat.htypes.htime_impl.htime.hsocket_impl.hin.htime_iso.h &; @F[ `f{  ;Ϸ ٷ    > H T   ĸ Y /var/tmp/cyrus-imapd-2.4.17/lib/usr/include/sys/usr/include/isoxmalloc.cstat_impl.hstat.htypes.htime_impl.htime.htime_iso.hиָ   + 06S `f8w    ǹ Ϲ    M ` o v    ƺغ     /var/tmp/cyrus-imapd-2.4.17/lib/usr/include/sys/usr/include/isolibcyr_cfg.cstat_impl.hstat.htypes.htime_impl.htime.hlibcyr_cfg.htime_iso.h+ 06K PVk pv ͻ  ' ; @Fm  Ǽۼ   : g{  ׽    #J w   þ  D X `ch psx  /var/tmp/cyrus-imapd-2.4.17/lib/usr/include/sys/usr/include/usr/include/isocyrusdb.cstat_impl.hstat.htypes.htime_impl.htime.hcyrusdb.hstdio_impl.hstdio_iso.hint_types.hlibcyr_cfg.htime_iso.h  ƿۿ  + = S g }   |   !09R e t      2 = G L [ i w           & 4 ; @FL {        #> Yj {         , 6 DK PY` v  ~    /var/tmp/cyrus-imapd-2.4.17/lib/usr/include/sys/usr/include/isocyrusdb_flat.cstat_impl.hstat.htypes.htime_impl.htime.hcyrusdb.huio.htime_iso.h  &; @F[ `f      ! 7 >J m          ' 5 @FU _ i o      % 2G ]     y  5 P p      7 J [ i t }       , : A P_f        .Zc lx        " 3 N d py      0 C T y      ) 06=D K Y ` gn u |       $- 6B Q c w         p w         8 K _ m s     e G<       7 b j        ' < S d m    ( C \m         @L y   ! p p        @ b q    * ; W du        3 9 PV{    &/u         ' - % /var/tmp/cyrus-imapd-2.4.17/lib/usr/include/sys/usr/include/isocyrusdb_skiplist.cstat_impl.hstat.htypes.htime_impl.htime.hint_types.hcyrusdb.huio.hlibcyr_cfg.htime_iso.h@F[ `f{        / @CH Y c p      6 _       . P [ q         )A X k ~       y, 3 @L   0 @FM T] f        mRX `i   . 8? PVi z       ? J `{       4 ?` l    ( / O e l        J QW `f        ': R Z p |       /\ ~         A L Za p      & 4O e v          ' = F O Y          &M X }   , 7 F T _ p {         :B        6 A O \ r           # 1 <G U f n |          # 4 K m        % T^ o w           ' . @FN Uh n w~       &D K   ~       /;C U b t@ L~y+      ! *2 M \u    ! MUn x~       " A `s |      $ X     $ +I b u  ) 8 @ Y g t   l:AIW _ x     06 @[ e w     ? P\ `      1 @T   x    :} '  8  O          '  '  U            9  L  j                 z    ) 4  M  d k               !) /J Xa d    / 5 F^ f u   F L [ pv      6 X h l       " : Ov       $ , D] hx      -B ]    $ : : u  * ; j } -z@DV/E?   $= HXf p w      A k     % 0 F \ h t        2 Z m     }       ^ w       "  -  7  <  F d  o  y      !l3!!S!1! ! " '" 1" 4" >"\" g" q" t" ~"p"" " "# 3# =#H# R# k## # ## $ $$ *$ 6$ L$]$n$$ $ $ $ $ $  %,% B% P%X% f%~% && 0&<&J& V& e& q& & & & & & & & & & & & &q6'<'' ' ' 9( Y(h( p(( (( (m( )V)-&) -) @)F)Y) `)o)) ) ) .* :*F* f* * ** +  +,+ 8++ ++ + +e+ R,[^,(t, {, ,,, , ,, - -- F- T- `-- - -- - - -- . .:. A.W.. ... .//$/}6/I/ / / / // / / 0 0  0 '0?0 G0 N0 T0 [00l01 21 91A1 W1V1.1 1 11 1 1 2 2 02 72 <2 C2[2 c2 j2 l2 s2o222 23  3 +3 43 @3~a33 333 3 34"4 )4 04B4 H4 [4q4 z4 |4 4 4 4 4 4445 55 $5+5 E5 w5 5 55 6 ?6 6 66 6 67 7 88 8v889 (9B9J9h9 t9 9 9 9 99 99 ::3;; ;q;g< < < < F== =z$> )>?>~V>g>> > > >>? ?  ?(? L ^L fL vL LL L L L L LLL  M $M 4M JM QM `MiMsMM M M M MM N +N 0N6NHN dN }N N NN NNO +O >O POYOrO O O OOO O OOP $P5P UP hP P P P P P Q +Q 9Q HQ mQ Q QtQQiRZRkR R R R R R 5S@SISPS _S nSSS S S S SS !T +T>T XT pTzTT T T T U U *U AU PU vU UU Vz+V p Dp Kp Pp Xp kp up |p pp p pmpp ppq  q&qNq `qfqmq tq zq q q q q qr r r drrr r r s 's @sLs ts ss t t $t 3t:t @tt t t t t u uut,uOu]u eu luu v 3v 8v [v `v dv v vxvuvSvv ww $w +w 0w 8w Kw Uw \w `w hw {w w w w wlww wwwx ,x Sx kx x x x x x x x xx x  y y y 9y `y ly tyty y y y y yy yy z 'z/z 7z Jz Tz ^z hzz zz zzz zz{  {&{Q{ `{f{{ {{{{ { | | 0| @| F| L| T|z| | | | | | | }  } } } } >} R} Z} x} }} }} } }} } } } ~ ~6~ =~C~ P~V~w~ ~~~ ~~~ ~ ~     $ 3 : <Z a dutz       * 2 P \c YG /var/tmp/cyrus-imapd-2.4.17/lib/usr/include/sys/usr/local/mysql/include/usr/local/include/usr/include/isocyrusdb_sql.cstat_impl.hstat.htypes.htime_impl.htime.hmysql.hmysql_com.hmy_alloc.hmy_list.hlibpq-fe.hsqlite3.hcyrusdb.hlibcyr_cfg.htime_iso.hpv  ˀ Ѐր  , 8 ؁     3 D Z  ǂ ւ  ' T~u  ƒ Ѓփ " 03A PV] :k  ͅ  / L ] k ~   Ɔ݆ #4 < J X ` ~   ȇ 1 Muhv |  ƈ   #1 @FY a   ‰ ى ߉    'U ] {  Š ӊ   z; L T r |  Ƌ   #1 @IP    Ќ ݌~ )1 IS Y `fq x   ɍЍߍ     *[ g s   Ў?h t i  ʏ ؏ !Ef ϐ     (< H T [ `f  Ñ ߑ   % , @Fb x     ߒ  9 Cu{    ғ   : }    & O         0?I    *y  ՗     ' @OY  Ҙ ޘ 1 ߙ   f p |  6 d ؛ !@ K a   ˜ М֜ ' 06B       + 06K  /var/tmp/cyrus-imapd-2.4.17/lib/usr/include/sys/usr/include/isobsearch.cstat_impl.hstat.htypes.htime_impl.htime.htime_iso.hPVk pv  Ӟ      , L]e      ɟ ܟ      W ^ e~à   F M T~ ԡ ܡ     (/>P ` t    Ȣ      ' . 4 @Fd k   ǣ~ $ 8 L X b /var/tmp/cyrus-imapd-2.4.17/lib/usr/include/sys/usr/include/isoretry.cstat_impl.hstat.htypes.htime_impl.htime.huio.htime_iso.h`f{   Ƥ = + 3 <D \ hq      Х    $ - 6 8 @IPn }  ~Ŧ Φ զ~ - 5 I [ ` p w |    ԧ ا  y  & ,  /var/tmp/cyrus-imapd-2.4.17/lib/usr/include/sys/usr/include/isolock_fcntl.cstat_impl.hstat.htypes.htime_impl.htime.hfcntl.htime_iso.h@F[ `f{  è Ш٨      ' 4 H Tg        ֩    3 < E L S h t     Ȫ Ϫ ֪      &/ 8 ? F [ l x      ˫ ܫ      &; L X d  /var/tmp/cyrus-imapd-2.4.17/lib/usr/include/sys/usr/include/isohash.cstat_impl.hstat.htypes.htime_impl.htime.hhash.hselect.htime_iso.hpv  ˬ Ь֬ +  % 4 =Ee   ϭ խ   ! @ h    Ʈ      (1 : H T_ s     ǯ Я ܯj   8 G ] f p y  ° ̰      $z7> PVq x    ұ ޱ      % 0 9 K V g u   \ - Ʋݲ       ! 2 = N \xd}z     ɳ гֳ    5}; E{W F /var/tmp/cyrus-imapd-2.4.17/lib/usr/include/sys/usr/include/isompool.cstat_impl.hstat.htypes.htime_impl.htime.hselect.htime_iso.h`f{   ƴ   7 @ J P `fu     ʵ ̵յ ݵ     |! 06=P _ g nwֶ   , 2 @FX l     ɷ  = /var/tmp/cyrus-imapd-2.4.17/libstrhash.c=    ) 0{<B ^ /var/tmp/cyrus-imapd-2.4.17/lib/usr/include/sys/usr/include/isoassert.cstat_impl.hstat.htypes.htime_impl.htime.htime_iso.hPVk pv  Ӹ <[ l D DD% DD%. : ; @ ' ID I: ;  $> &III: I  !I/  :  I8 . : ; @ ' D  < ID ' ID I' D ' ID  :  :  : I !I/ : ' D  .?  : ; @ ' D .?  : ; @ ' ID 4I : ;   4I : ; .?  : ;@ ' ID !I: ; ". : ;@ ' ID # : $( %.? < ' D &.? < ' ID '( I8 ).? < ' ID  DD%. : ; @ ' ID I: ;  $> &III: I  !I/  :  I8 4I?  : ;  .?  : ; @ ' ID 4I : ;   4I : ;  : I !I/< ' ID I' D ' ID  :  :  : ' D .? < ' ID .? < ' ID  DD%. : ; @ ' ID I: ;  $> &III: I  !I/  :  I8 .?  : ; @ ' ID   : 4I : ;  .?  : ; @ ' D .? < ' ID I.? < ' D .? < ' ID  DD%. : ; @ ' ID I: ;  $> &III: I  !I/  :  I8 .?  : ; @ ' D  .?  : ; @ ' ID 4I : ;   < ' ID I' D ' ID  :  :  : I !I/ : ' D . : ;@ ' ID I: ; 4I : ; .?  : ;@ ' ID  I8 !.? < ' ID "#.? < ' D $.? < ' ID  DD%. : ; @ ' ID I: ;  $> &III: I  !I/  :  I8 I  !I/4I?  : ;  .?  : ; @ ' ID 4I : ;  ' ID .?  : ;@ ' ID I: ; 4I : ;   ( .?  : ;@ D .?  : ;@ ' D .?  : ;@ D D D .? < ' D I.? < ' ID  .? < ' ID !.? < ' ID  DD%. : ; @ ' ID I: ;  $> &III: I  !I/  :  I8 .?  : ; @ ' ID  4I : ;  < ' ID I' D ' ID  :  :  : I !I/ : ' D  .?  : ;@ ' D I: ; . : ;@ ' ID . : ;@ ' D .?  : ;@ ' ID  4I : ; ! "I#!I$%.? < ' D &.? < ' ID '.? < ' ID (.? < D ) : *( +.? < ' D ,.? < ' ID  DD%. : ; @ ' ID I: ;  $> &III: I  !I/  :  I8 I  !I/4I : ;  ID I!I.?  : ; @ ' ID ' D I < ' ID ' ID  :  : ' D  :  :  .?  : ;@ ' D  I: ; !4I : ; ".?  : ;@ ' ID #$D %. : ;@ ' ID &. : ;@ ' D ' ( )( *. : ;@ ' ID +.?  : ;@ ' ID ,.? < ' ID -.? < ' D ..? < ' ID /.? < ' D 0 I8 1.? < ' ID  DD%. : ; @ ' ID I: ;  $> &III: I  !I/  :  I8 .?  : ; @ ' ID  4I : ;  .? < ' ID I.? < ' ID  DD%. : ; @ ' ID I: ;  $> &III: I  !I/  :  I8 4I : ;  . : ; @ ' D I!I.?  : ; @ ' D D ' D  :  : ' D I.?  : ; @ ' ID .? < ' D .? < ' ID .? < ' ID  DD%. : ; @ ' ID I: ;  $> &III: I  !I/  :  I8 4I?  : ;  .?  : ; @ ' D 4I : ;  .? < ' D I.? < ' ID .? < ' ID  DD%. : ; @ ' ID I: ;  $> &III: I  !I/  :  I8 4I?  : ;  .?  : ; @ ' D 4I : ;  .? < ' D I.? < ' ID .? < ' ID  DD%. : ; @ ' ID I: ;  $> &III: I  !I/  :  I8 .?  : ; @ ' ID  4I : ;  I !I/.? < ' ID I.? < ' ID  DD%. : ; @ ' ID I: ;  $> &III: I  !I/  :  I8 .?  : ; @ ' ID  4I : ;  .? < ' D I.? < ' ID .? < ' ID  DD%. : ; @ ' ID I: ;  $> &III: I  !I/  :  I8  :  (  : I 4I?  : ;  .?  : ; @ ' ID .?  : ; @ ' D .?  : ; @ D .? < D .? < ' D I.? < ' ID .? < ' ID  DD%. : ; @ ' ID I: ;  $> &III: I  !I/  :  I8 ' ID  I' ID 4I?  : ;  .?  : ; @ D 4I : ;  I !I/.?  : ; @ ' ID <  .?  : ; @ ' D  I8  4I : ; .? < ' ID .? < ' D  : (  .? < ' ID  DD%. : ; @ ' ID I: ;  $> &III: I  !I/  :  I8 4I : ;   . : ; @ ' D . : ; @ ' ID I !I/ 4I : ; . : ;@ ' ID I: ; ' ID I' ID 4I?  : ; .? < ' ID .? < ' D .? < ' ID  DD%. : ; @ ' ID I: ;  $> &III: I  !I/  :  I8 4I : ;   ' ID I. : ; @ ' D I !I/. : ;@ ' ID . : ;@ ' ID I: ; 4I : ;  .?  : ;@ ' ID D D ' ID 4I?  : ; .? < ' ID .? < ' D  : ( !.? < ' ID ".? < ' D #.? < ' ID  DD%. : ; @ ' ID I: ;  $> &III: I  !I/  :  I8 4I : ;  . : ; @ ' D  . : ;@ ' D I: ; < ' ID I. : ;@ ' ID 4I : ; . : ;@ ' ID  I !I/ : ' ID 4I?  : ; .? < ' ID .? < ' D  :  ( !' D "#.? < ' ID  DD%. : ; @ ' ID I: ;  $> &III: I  !I/  :  I8 4I : ;  . : ; @ ' D < ' D I I8 ' D ' ID  : . : ;@ ' ID 4I : ; I: ; I !I/ : ( ' ID  :  4I?  : ; .? < ' D ! : ".? < ' ID #.? < ' D $%.? < ' ID  DD%. : ; @ ' ID I: ;  $> &III: I  !I/  :  I8 4I : ;  ' ID I' ID ' D  I< I !I/ :  : (  . : ; @ ' D 4I : ;  : . : ;@ ' ID I: ; . : ;@ ' D  I!!I". : ;@ ' ID #D D $4I?  : ; %.? < ' ID &.? < ' D '(.? < ' ID  DD%. : ; @ ' ID I: ;  $> &III: I  !I/  :  I8 I  !I/4I : ;  .?  : ; @ ' ID .? < ' ID I.? < ' ID  DD%. : ; @ ' ID I: ;  $> &III: I  !I/  :  I8 .?  : ; @ ' ID  4I : ;  .? < ' ID I.? < ' D .? < ' ID  DD%. : ; @ ' ID I: ;  $> &III: I  !I/  :  I8 4I?  : ;  .?  : ; @ ' ID 4I : ;  .? < ' ID I.? < ' ID  DD%. : ; @ ' ID I: ;  $> &III: I  !I/  :  I8 .?  : ; @ ' ID  < 4I : ;   .?  : ;@ ' D I: ; 4I : ; ' D .? < ' D I.? < ' ID  : .? < ' ID  DD%. : ; @ ' ID I: ;  $> &III: I  !I/  :  I8 4I : ;   .?  : ; @ ' ID .?  : ; @ ' D  .? < ' D I.? < ' ID  : .? < ' ID  DD%.?  : ; @ ' ID I: ;  4I : ;  $> &II DD%. : ; @ ' ID I: ;  $> &III: I  !I/  :  I8 .?  : ; @ ' D  4I : ;  I !I/.? < ' D I.? < ' ID .? < ' ID {TZsieve_free_netZinit_net]init_sasl_read_capability6adetect_mitm(cauth_saslqfdo_referraliisieve_logout?iisieve_put_fileiisieve_putjisieve_delete kisieve_listkisieve_activate\lisieve_get9}^lexer_statetoken_lookupyylexp string_allocate0string_copystring_freestring_compareGstring_compare_withstring_comparestrsafe_to_use_quotedjparseerrorhandle_response}ZdeleteascriptY[installdata\installafile_showlist`list_wcbbsetscriptactivecgetscriptdgetscriptvalueR!~convert_to_lowercaseconvert_to_uppercaselcase%ucasegbeautify_copybeautify_stringLstrcmpsafestrcasecmpsafekv_bsearchdir_hash_c cyrus_close_sock cyrus_reset_stdioF create_tempfile cyrus_mkdir\ become_cyrus timesubG cmdtime_settimer cmdtime_starttimer cmdtime_endtimer cmdtime_netstartcmdtime_netend<parseint32parseuint32buf_ensure^buf_cstringbuf_getmapbuf_len>buf_resetnbuf_truncatebuf_setcstr.buf_setmapbuf_copybuf_appendbuf_appendcstrhbuf_appendbit32buf_appendmap-buf_putcibuf_printfbuf_replace_all3buf_cmpbuf_initbuf_init_ro4buf_freecbuf_movestrconcat rtUprot_new Yprot_readmap~Yprot_freeYprot_setlogYprot_setisclient2Zprot_settlsvZprot_sasldecoded[prot_setsasl)\prot_unsetsasl\prot_setcompressS^prot_data_boundary^prot_settimeout^prot_resettimeout_prot_setflushonreada_prot_setreadcallback_prot_addwaiteventP`prot_removewaitevent`prot_erroraprot_rewind4aprot_fillycprot_flushfprot_flush_internalgprot_writehprot_putbuf!iprot_printf?kprot_printliteralkprot_printstring6lprot_printastringlprot_readlprot_selectoprot_fgetspprotgroup_newUpprotgroup_copypprotgroup_resetpprotgroup_freeqprotgroup_insertqprotgroup_deleteqprotgroup_getelement2rprot_getcdrprot_ungetcrprot_putcwt؆Nimclient_connectYimclient_closevZimclient_setflagsZimclient_clearflags[imclient_servernameW[imclient_addcallback4\imclient_sendn^imclient_writezaimclient_getselectinfoaimclient_processoneeventfinteractiongfillin_interactionsjimclient_authenticateqtls_start_clienttlssimclient_havetls.simclient_starttlsrL{L [imparse_wordimparse_astringNimparse_isatomimparse_issequenceimparse_isnumberQa signals_add_handlersssignals_set_shutdownsignals_poll4snonblock_method_descnonblock? kmap_method_descmap_refresh|map_free, aiptostringM [xmallocxzmallocxreallocPxstrdupxstrndup( cyrus_options libcyrus_config_getstringU libcyrus_config_getint libcyrus_config_getswitch libcyrus_config_setstring, libcyrus_config_setintu libcyrus_config_setswitch libcyrus_init libcyrus_doneMdcyrusdb_backendscyrusdb_init*cyrusdb_done]cyrusdb_copyfile2 cyrusdb_convert cyrusdb_detect cyrusdb_fromname%wcyrusdb_flatn4myclosemmyfetchmyforeachrandlvldmystoremydelete)cyrusdb_skiplist&(+cyrusdb_quotalegacyzGTOeQ\cyrusdb_berkeleyr\cyrusdb_berkeley_nosync\cyrusdb_berkeley_hash\cyrusdb_berkeley_hash_nosynceE6cyrusdb_sqlGE bsearch_membsearch_comparebsearch_ncompare>@ l Wretry_readretry_writevretry_writevz# klock_method_desclock_reopenlock_blockingmlock_sharedlock_nonblockinglock_unlock{IUconstruct_hash_tablehash_inserthash_lookupVhash_del free_hash_table hash_enumerate_- new_mpoolfree_mpoolmpool_mallocmpool_strndup)mpool_strdup8Sstrhash";Yassertionfailed}{statlstatfstatDmknodsieve_dispose\make_secpropsagetauthlineerefer_simple_cb5}^ statlstatfstat>mknod5p statlstat fstatHmknodbjstatlstat fstatFmknodV\getsievenamebviewafile5cwritefile5R!statylstatfstatmknodrtstatylstatfstatmknod\\zalloc\zfree]is_incompressiblecprot_flush_logdprot_flush_encode/fprot_flush_writebufferUt؆statlstatfstatmknod]imclient_writeastring^imclient_inputaimclient_eof\cauthresultjdtlsresultdmake_secpropshimclient_authenticate_sublimclient_decodebase64mimclient_writebase64nset_cert_stuffoverify_callbackotmp_rsa_cb0ptls_rand_initSptls_init_clientengine5L{L statlstatfstatmknodDa statlstatfstatmknodssighandler5statlstatfstatmknod5 statlstatfstat mknod5, statlstatfstat mknod5 statlstatfstatmknod5( statlstatfstat mknodFMstatlstatfstatmknod5 converter_cb %statlstatfstat mknodeabort_txnofree_dbnew_txninitdone0mysyncKmyarchiveKmyopen myclose/ starttxn_or_refetch; myfetch fetch fetchlockY foreachamystore\createstoredeletecommit_txn4statlstatfstatmknodgetsyncfdclosesyncfd#myinitmydonemysync myarchive LEVELv RECSIZE SAFE_TO_APPEND newtxn read_header write_headerW update_lock write_lockH read_lock unlock lock_or_refreshIdispose_db|myopen comparefind_nodesfetchfetchlockqcreatestoretmycommitmyabortmycheckpointk!dump!consistent!"myconsistentM#recovery(+statlstatfstatmknodsname_to_hashcharhash_quotaabort_subtxncommit_subtxn$free_db new_subtxn, inity done mysync myarchive myopen myclose" myfetch)fetchpath_to_qrcompar_qricompar_qr_mboxHscan_qr_dirforeachmystorecreatestore3deletetxn_proc%commit_txngabort_txnGTOestatlstatfstatmknoddb_panicS%db_err%db_msg&init 'done;'mysyncn'myarchive(mbox_compar3KmyopenLopen_btreeLopen_hashLmyclose2MgettidMmyfetchNfetch\OfetchlockOforeachRmystoremTcreateUstoreUcreate_nosync5Vstore_nosyncVmydeleteWdeleteyXdelete_nosyncXmycommitrYcommit_txnYcommit_nosyncYabort_txneEstatlstatfstat mknod"_mysql_open_mysql_escape_mysql_exec_mysql_begin_txn_mysql_commit_txn_mysql_rollback_txnL_mysql_close}_pgsql_open} _pgsql_escape!_pgsql_execC#_pgsql_begin_txn~#_pgsql_commit_txn#_pgsql_rollback_txn#_pgsql_close+$_sqlite_open%_sqlite_escape%_sqlite_exec'_sqlite_begin_txn['_sqlite_commit_txn'_sqlite_rollback_txn'_sqlite_closef(init1)doneK)mysyncg)myarchive)myopen+myclose+start_txnW,select_cb-fetch_cb.fetch/foreach1mystoreV2create2store3delete3finish_txn4commit_txn4abort_txn5E statlstatfstatmknod5@ l stat{lstatfstatmknod5# statlstatfstat mknod5IstatylstatfstatmknodH- stat{lstatfstatmknodWnew_mpool_blob5;stat}lstatfstatmknod {ydev_tino_tmode_tnlink_tuid_tgid_toff_ttime_ttimespec7timestruc_tIblksize_tYblkcnt_tstatsasl_conn_t sasl_callbackKsasl_callback_tessl_cipher_st'SSL_CIPHERyssl_method_stQ SSL_METHOD bio_method_st BIO_METHOD:stack_stSTACKcrypto_ex_data_stCRYPTO_EX_DATA bio_stBIO{buf_mem_stBUF_MEMssl2_state_stsize_tssl3_buffer_st=SSL3_BUFFERessl3_record_stSSL3_RECORDenv_md_stEVP_MDENGINEenv_md_ctx_st(EVP_MD_CTXnbignum_stBIGNUMbn_mont_ctx_st*BN_MONT_CTXdh_methodPDH_METHODjdh_st|DHEC_KEY evp_cipher_ctx_st!EVP_CIPHER_CTX!evp_cipher_stEVP_CIPHER"comp_ctx_stD#COMP_CTX#comp_method_st6$COMP_METHODH$ssl_comp_st$SSL_COMP$&ssl3_state_st*dtls1_bitmap_st*DTLS1_BITMAP#+pqueue0+record_pqueue_sta+record_pqueue+asn1_string_st%,ASN1_INTEGERG,asn1_object_st,ASN1_OBJECT,ASN1_BOOLEAN,ASN1_STRING,ASN1_ENUMERATED-ASN1_BIT_STRING!-ASN1_OCTET_STRING>-ASN1_PRINTABLESTRING^-ASN1_T61STRINGx-ASN1_IA5STRING-ASN1_GENERALSTRING-ASN1_BMPSTRING-ASN1_UNIVERSALSTRING-ASN1_UTCTIME.ASN1_GENERALIZEDTIME".ASN1_VISIBLESTRING@.ASN1_UTF8STRINGk.ASN1_VALUE.0asn1_type_st@0ASN1_TYPEU0X50