# PaCkAgE DaTaStReAm postgresql 1 93582 # end of header 070701000894c1000081a4000000000000000000000001505020dd0000012d000000b500010002ffffffffffffffff0000001300000000postgresql/pkginfoPKG=postgresql NAME=postgresql 9.2.0 i86pc Solaris 10 VERSION=9.2.0 PSTAMP=12th September 2012 VENDOR=PostgreSQL Global Development Group EMAIL=http://www.postgresql.org/ DESC=Open source object-relational database ARCH=i386 CATEGORY=utility CLASSES=none BASEDIR=/ ISTATES=S s 1 2 3 RSTATES=S s 1 2 3 070701000894c0000081a4000000000000000000000001505020dd00046849000000b500010002ffffffffffffffff0000001200000000postgresql/pkgmap: 1 93582 1 d none /usr ? ? ? 1 d none /usr/local ? ? ? 1 d none /usr/local/bin 0755 root root 1 f none /usr/local/bin/clusterdb 0755 root root 82768 42542 1347419725 1 f none /usr/local/bin/createdb 0755 root root 83420 3917 1347419724 1 f none /usr/local/bin/createlang 0755 root root 87456 38443 1347419724 1 f none /usr/local/bin/createuser 0755 root root 85060 59590 1347419725 1 f none /usr/local/bin/dropdb 0755 root root 81396 17940 1347419724 1 f none /usr/local/bin/droplang 0755 root root 87296 36858 1347419725 1 f none /usr/local/bin/dropuser 0755 root root 81372 14203 1347419725 1 f none /usr/local/bin/ecpg 0755 root root 825676 5393 1347419724 1 f none /usr/local/bin/initdb 0755 root root 132780 5677 1347419724 1 f none /usr/local/bin/oid2name 0755 root root 39880 17056 1347419727 1 f none /usr/local/bin/pg_archivecleanup 0755 root root 30924 47513 1347419727 1 f none /usr/local/bin/pg_basebackup 0755 root root 86776 5261 1347419725 1 f none /usr/local/bin/pg_config 0755 root root 38116 31241 1347419725 1 f none /usr/local/bin/pg_controldata 0755 root root 39884 22664 1347419725 1 f none /usr/local/bin/pg_ctl 0755 root root 53304 9736 1347419724 1 f none /usr/local/bin/pg_dump 0755 root root 377960 10649 1347419724 1 f none /usr/local/bin/pg_dumpall 0755 root root 103592 58118 1347419724 1 f none /usr/local/bin/pg_receivexlog 0755 root root 63640 47045 1347419725 1 f none /usr/local/bin/pg_resetxlog 0755 root root 52096 28512 1347419725 1 f none /usr/local/bin/pg_restore 0755 root root 181116 55732 1347419724 1 f none /usr/local/bin/pg_standby 0755 root root 40184 49244 1347419727 1 f none /usr/local/bin/pg_test_fsync 0755 root root 30552 37835 1347419727 1 f none /usr/local/bin/pg_test_timing 0755 root root 24732 39083 1347419727 1 f none /usr/local/bin/pg_upgrade 0755 root root 172972 54524 1347419727 1 f none /usr/local/bin/pgbench 0755 root root 73552 9822 1347419727 1 f none /usr/local/bin/pltcl_delmod 0755 root root 2219 44861 1347419725 1 f none /usr/local/bin/pltcl_listmod 0755 root root 2377 56553 1347419725 1 f none /usr/local/bin/pltcl_loadmod 0755 root root 11455 4231 1347419725 1 f none /usr/local/bin/postgres 0755 root root 7378380 56196 1347419721 1 s none /usr/local/bin/postmaster=postgres 1 f none /usr/local/bin/psql 0755 root root 516736 51706 1347419724 1 f none /usr/local/bin/reindexdb 0755 root root 84092 44922 1347419725 1 f none /usr/local/bin/vacuumdb 0755 root root 49876 38665 1347419725 1 f none /usr/local/bin/vacuumlo 0755 root root 39792 20443 1347419728 1 d none /usr/local/include 0755 root root 1 f none /usr/local/include/ecpg_config.h 0644 root root 714 57266 1347419724 1 f none /usr/local/include/ecpg_informix.h 0644 root root 2758 29110 1347419724 1 f none /usr/local/include/ecpgerrno.h 0644 root root 2540 60981 1347419724 1 f none /usr/local/include/ecpglib.h 0644 root root 2601 15719 1347419724 1 f none /usr/local/include/ecpgtype.h 0644 root root 2621 18076 1347419724 1 d none /usr/local/include/libpq 0755 root root 1 f none /usr/local/include/libpq-events.h 0644 root root 2211 49429 1347419723 1 f none /usr/local/include/libpq-fe.h 0644 root root 20649 29784 1347419723 1 f none /usr/local/include/libpq/libpq-fs.h 0644 root root 633 44679 1347419723 1 f none /usr/local/include/pg_config.h 0644 root root 26316 5454 1347419723 1 f none /usr/local/include/pg_config_manual.h 0644 root root 9261 50041 1347419723 1 f none /usr/local/include/pg_config_os.h 0644 root root 1041 19956 1347419723 1 f none /usr/local/include/pgtypes_date.h 0644 root root 766 65439 1347419724 1 f none /usr/local/include/pgtypes_error.h 0644 root root 530 39306 1347419724 1 f none /usr/local/include/pgtypes_interval.h 0644 root root 1143 28859 1347419724 1 f none /usr/local/include/pgtypes_numeric.h 0644 root root 2227 44302 1347419724 1 f none /usr/local/include/pgtypes_timestamp.h 0644 root root 1010 23484 1347419724 1 f none /usr/local/include/postgres_ext.h 0644 root root 1778 8903 1347419723 1 d none /usr/local/include/postgresql 0755 root root 1 d none /usr/local/include/postgresql/informix 0755 root root 1 d none /usr/local/include/postgresql/informix/esql 0755 root root 1 f none /usr/local/include/postgresql/informix/esql/datetime.h 0644 root root 338 27003 1347419724 1 f none /usr/local/include/postgresql/informix/esql/decimal.h 0644 root root 301 23254 1347419724 1 f none /usr/local/include/postgresql/informix/esql/sqltypes.h 0644 root root 1435 45823 1347419724 1 d none /usr/local/include/postgresql/internal 0755 root root 1 f none /usr/local/include/postgresql/internal/c.h 0644 root root 24689 44709 1347419723 1 d none /usr/local/include/postgresql/internal/libpq 0755 root root 1 f none /usr/local/include/postgresql/internal/libpq-int.h 0644 root root 22813 53598 1347419723 1 f none /usr/local/include/postgresql/internal/libpq/pqcomm.h 0644 root root 5800 11746 1347419723 1 f none /usr/local/include/postgresql/internal/port.h 0644 root root 13841 61945 1347419723 1 f none /usr/local/include/postgresql/internal/postgres_fe.h 0644 root root 730 54063 1347419723 1 f none /usr/local/include/postgresql/internal/pqexpbuffer.h 0644 root root 6527 5186 1347419723 1 d none /usr/local/include/postgresql/server 0755 root root 1 d none /usr/local/include/postgresql/server/access 0755 root root 1 f none /usr/local/include/postgresql/server/access/attnum.h 0644 root root 1553 56964 1347419723 1 f none /usr/local/include/postgresql/server/access/clog.h 0644 root root 1508 62296 1347419723 1 f none /usr/local/include/postgresql/server/access/genam.h 0644 root root 7470 58296 1347419723 1 f none /usr/local/include/postgresql/server/access/gin.h 0644 root root 1664 65164 1347419723 1 f none /usr/local/include/postgresql/server/access/gin_private.h 0644 root root 23313 11499 1347419723 1 f none /usr/local/include/postgresql/server/access/gist.h 0644 root root 5562 59338 1347419723 1 f none /usr/local/include/postgresql/server/access/gist_private.h 0644 root root 18682 60890 1347419723 1 f none /usr/local/include/postgresql/server/access/gistscan.h 0644 root root 718 53420 1347419723 1 f none /usr/local/include/postgresql/server/access/hash.h 0644 root root 13177 63527 1347419723 1 f none /usr/local/include/postgresql/server/access/heapam.h 0644 root root 6344 29310 1347419723 1 f none /usr/local/include/postgresql/server/access/hio.h 0644 root root 1280 35802 1347419723 1 f none /usr/local/include/postgresql/server/access/htup.h 0644 root root 32708 34557 1347419723 1 f none /usr/local/include/postgresql/server/access/itup.h 0644 root root 4404 25058 1347419723 1 f none /usr/local/include/postgresql/server/access/multixact.h 0644 root root 2810 46471 1347419723 1 f none /usr/local/include/postgresql/server/access/nbtree.h 0644 root root 27906 5562 1347419723 1 f none /usr/local/include/postgresql/server/access/printtup.h 0644 root root 1051 18880 1347419723 1 f none /usr/local/include/postgresql/server/access/reloptions.h 0644 root root 8813 55753 1347419723 1 f none /usr/local/include/postgresql/server/access/relscan.h 0644 root root 4168 17731 1347419723 1 f none /usr/local/include/postgresql/server/access/rewriteheap.h 0644 root root 1016 16149 1347419723 1 f none /usr/local/include/postgresql/server/access/rmgr.h 0644 root root 804 58096 1347419723 1 f none /usr/local/include/postgresql/server/access/sdir.h 0644 root root 1466 50616 1347419723 1 f none /usr/local/include/postgresql/server/access/skey.h 0644 root root 7033 60969 1347419723 1 f none /usr/local/include/postgresql/server/access/slru.h 0644 root root 5278 46117 1347419723 1 f none /usr/local/include/postgresql/server/access/spgist.h 0644 root root 6391 59800 1347419723 1 f none /usr/local/include/postgresql/server/access/spgist_private.h 0644 root root 22659 43385 1347419723 1 f none /usr/local/include/postgresql/server/access/subtrans.h 0644 root root 973 19627 1347419723 1 f none /usr/local/include/postgresql/server/access/sysattr.h 0644 root root 891 2124 1347419723 1 f none /usr/local/include/postgresql/server/access/transam.h 0644 root root 6161 59536 1347419723 1 f none /usr/local/include/postgresql/server/access/tupconvert.h 0644 root root 1287 37028 1347419723 1 f none /usr/local/include/postgresql/server/access/tupdesc.h 0644 root root 4241 32279 1347419723 1 f none /usr/local/include/postgresql/server/access/tupmacs.h 0644 root root 7326 56488 1347419723 1 f none /usr/local/include/postgresql/server/access/tuptoaster.h 0644 root root 5821 13150 1347419723 1 f none /usr/local/include/postgresql/server/access/twophase.h 0644 root root 1716 15073 1347419723 1 f none /usr/local/include/postgresql/server/access/twophase_rmgr.h 0644 root root 1272 34879 1347419723 1 f none /usr/local/include/postgresql/server/access/valid.h 0644 root root 1437 37032 1347419723 1 f none /usr/local/include/postgresql/server/access/visibilitymap.h 0644 root root 1178 30998 1347419723 1 f none /usr/local/include/postgresql/server/access/xact.h 0644 root root 8646 13793 1347419723 1 f none /usr/local/include/postgresql/server/access/xlog.h 0644 root root 12301 61077 1347419723 1 f none /usr/local/include/postgresql/server/access/xlog_internal.h 0644 root root 9567 7477 1347419723 1 f none /usr/local/include/postgresql/server/access/xlogdefs.h 0644 root root 4597 41837 1347419723 1 f none /usr/local/include/postgresql/server/access/xlogutils.h 0644 root root 956 18495 1347419723 1 d none /usr/local/include/postgresql/server/bootstrap 0755 root root 1 f none /usr/local/include/postgresql/server/bootstrap/bootstrap.h 0644 root root 1573 61655 1347419723 1 f none /usr/local/include/postgresql/server/c.h 0644 root root 24689 44709 1347419723 1 d none /usr/local/include/postgresql/server/catalog 0755 root root 1 f none /usr/local/include/postgresql/server/catalog/catalog.h 0644 root root 2099 42876 1347419723 1 f none /usr/local/include/postgresql/server/catalog/catversion.h 0644 root root 2586 22604 1347419723 1 f none /usr/local/include/postgresql/server/catalog/dependency.h 0644 root root 9669 16852 1347419723 1 f none /usr/local/include/postgresql/server/catalog/genbki.h 0644 root root 1794 14046 1347419723 1 f none /usr/local/include/postgresql/server/catalog/heap.h 0644 root root 3899 57913 1347419723 1 f none /usr/local/include/postgresql/server/catalog/index.h 0644 root root 2845 28723 1347419723 1 f none /usr/local/include/postgresql/server/catalog/indexing.h 0644 root root 16686 18284 1347419723 1 f none /usr/local/include/postgresql/server/catalog/namespace.h 0644 root root 5769 42170 1347419723 1 f none /usr/local/include/postgresql/server/catalog/objectaccess.h 0644 root root 1654 1004 1347419723 1 f none /usr/local/include/postgresql/server/catalog/objectaddress.h 0644 root root 1236 31185 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_aggregate.h 0644 root root 10609 43944 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_am.h 0644 root root 5941 33137 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_amop.h 0644 root root 25108 20608 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_amproc.h 0644 root root 14345 10564 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_attrdef.h 0644 root root 1670 63088 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_attribute.h 0644 root root 6949 55282 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_auth_members.h 0644 root root 1791 8636 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_authid.h 0644 root root 3270 3767 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_cast.h 0644 root root 11759 13768 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_class.h 0644 root root 6070 18629 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_collation.h 0644 root root 2284 43221 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_collation_fn.h 0644 root root 735 55497 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_constraint.h 0644 root root 8149 17531 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_control.h 0644 root root 8166 24816 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_conversion.h 0644 root root 2175 38551 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_conversion_fn.h 0644 root root 833 64411 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_database.h 0644 root root 2689 16061 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_db_role_setting.h 0644 root root 2008 28577 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_default_acl.h 0644 root root 2150 33859 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_depend.h 0644 root root 2796 27834 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_description.h 0644 root root 2985 46833 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_enum.h 0644 root root 1859 12008 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_extension.h 0644 root root 2136 37516 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_foreign_data_wrapper.h 0644 root root 2066 35018 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_foreign_server.h 0644 root root 1914 21633 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_foreign_table.h 0644 root root 1628 60303 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_index.h 0644 root root 3421 14992 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_inherits.h 0644 root root 1499 47948 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_inherits_fn.h 0644 root root 850 822 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_language.h 0644 root root 2442 57657 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_largeobject.h 0644 root root 1829 12311 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_largeobject_metadata.h 0644 root root 1714 4788 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_namespace.h 0644 root root 2282 40965 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_opclass.h 0644 root root 11699 44490 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_operator.h 0644 root root 98031 1469 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_opfamily.h 0644 root root 6493 63238 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_pltemplate.h 0644 root root 3185 64381 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_proc.h 0644 root root 461504 12506 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_proc_fn.h 0644 root root 1169 23528 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_range.h 0644 root root 2595 4977 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_rewrite.h 0644 root root 1893 18512 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_seclabel.h 0644 root root 1363 37456 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_shdepend.h 0644 root root 2815 28366 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_shdescription.h 0644 root root 2444 64232 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_shseclabel.h 0644 root root 1343 36227 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_statistic.h 0644 root root 11373 57274 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_tablespace.h 0644 root root 1891 14850 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_trigger.h 0644 root root 5746 56772 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_ts_config.h 0644 root root 1645 59783 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_ts_config_map.h 0644 root root 2334 38328 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_ts_dict.h 0644 root root 1822 9954 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_ts_parser.h 0644 root root 1993 26851 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_ts_template.h 0644 root root 2152 40685 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_type.h 0644 root root 42313 24492 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_type_fn.h 0644 root root 2126 30879 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_user_mapping.h 0644 root root 1624 60121 1347419723 1 f none /usr/local/include/postgresql/server/catalog/schemapg.h 0644 root root 16154 34939 1347419723 1 f none /usr/local/include/postgresql/server/catalog/storage.h 0644 root root 1366 48541 1347419723 1 f none /usr/local/include/postgresql/server/catalog/toasting.h 0644 root root 1954 25184 1347419723 1 d none /usr/local/include/postgresql/server/commands 0755 root root 1 f none /usr/local/include/postgresql/server/commands/alter.h 0644 root root 942 8016 1347419723 1 f none /usr/local/include/postgresql/server/commands/async.h 0644 root root 1832 23595 1347419723 1 f none /usr/local/include/postgresql/server/commands/cluster.h 0644 root root 1167 27997 1347419723 1 f none /usr/local/include/postgresql/server/commands/collationcmds.h 0644 root root 919 7441 1347419723 1 f none /usr/local/include/postgresql/server/commands/comment.h 0644 root root 1364 38947 1347419723 1 f none /usr/local/include/postgresql/server/commands/conversioncmds.h 0644 root root 941 10217 1347419723 1 f none /usr/local/include/postgresql/server/commands/copy.h 0644 root root 1241 35297 1347419723 1 f none /usr/local/include/postgresql/server/commands/createas.h 0644 root root 801 61384 1347419723 1 f none /usr/local/include/postgresql/server/commands/dbcommands.h 0644 root root 2117 44688 1347419723 1 f none /usr/local/include/postgresql/server/commands/defrem.h 0644 root root 7701 31234 1347419723 1 f none /usr/local/include/postgresql/server/commands/discard.h 0644 root root 471 32118 1347419723 1 f none /usr/local/include/postgresql/server/commands/explain.h 0644 root root 2994 49722 1347419723 1 f none /usr/local/include/postgresql/server/commands/extension.h 0644 root root 1566 779 1347419723 1 f none /usr/local/include/postgresql/server/commands/lockcmds.h 0644 root root 559 39242 1347419723 1 f none /usr/local/include/postgresql/server/commands/portalcmds.h 0644 root root 896 4600 1347419723 1 f none /usr/local/include/postgresql/server/commands/prepare.h 0644 root root 2078 41852 1347419723 1 f none /usr/local/include/postgresql/server/commands/proclang.h 0644 root root 784 61944 1347419723 1 f none /usr/local/include/postgresql/server/commands/schemacmds.h 0644 root root 843 65332 1347419723 1 f none /usr/local/include/postgresql/server/commands/seclabel.h 0644 root root 970 16689 1347419723 1 f none /usr/local/include/postgresql/server/commands/sequence.h 0644 root root 1997 26269 1347419723 1 f none /usr/local/include/postgresql/server/commands/tablecmds.h 0644 root root 2339 735 1347419723 1 f none /usr/local/include/postgresql/server/commands/tablespace.h 0644 root root 1803 19133 1347419723 1 f none /usr/local/include/postgresql/server/commands/trigger.h 0644 root root 6780 25096 1347419723 1 f none /usr/local/include/postgresql/server/commands/typecmds.h 0644 root root 1917 30630 1347419723 1 f none /usr/local/include/postgresql/server/commands/user.h 0644 root root 1105 25135 1347419723 1 f none /usr/local/include/postgresql/server/commands/vacuum.h 0644 root root 6877 59395 1347419723 1 f none /usr/local/include/postgresql/server/commands/variable.h 0644 root root 1881 39127 1347419723 1 f none /usr/local/include/postgresql/server/commands/view.h 0644 root root 510 35677 1347419723 1 d none /usr/local/include/postgresql/server/datatype 0755 root root 1 f none /usr/local/include/postgresql/server/datatype/timestamp.h 0644 root root 5629 47604 1347419723 1 f none /usr/local/include/postgresql/server/dynloader.h 0644 root root 1053 15161 1347419723 1 d none /usr/local/include/postgresql/server/executor 0755 root root 1 f none /usr/local/include/postgresql/server/executor/execdebug.h 0644 root root 4426 64137 1347419723 1 f none /usr/local/include/postgresql/server/executor/execdesc.h 0644 root root 2384 61582 1347419723 1 f none /usr/local/include/postgresql/server/executor/executor.h 0644 root root 14798 50206 1347419723 1 f none /usr/local/include/postgresql/server/executor/functions.h 0644 root root 1150 26343 1347419723 1 f none /usr/local/include/postgresql/server/executor/hashjoin.h 0644 root root 7353 30831 1347419723 1 f none /usr/local/include/postgresql/server/executor/instrument.h 0644 root root 2857 37851 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeAgg.h 0644 root root 782 59303 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeAppend.h 0644 root root 701 52560 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeBitmapAnd.h 0644 root root 738 55773 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeBitmapHeapscan.h 0644 root root 813 62912 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeBitmapIndexscan.h 0644 root root 822 64009 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeBitmapOr.h 0644 root root 724 54721 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeCtescan.h 0644 root root 715 53646 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeForeignscan.h 0644 root root 771 59282 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeFunctionscan.h 0644 root root 785 60922 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeGroup.h 0644 root root 716 54291 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeHash.h 0644 root root 1926 27070 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeHashjoin.h 0644 root root 890 3738 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeIndexonlyscan.h 0644 root root 920 8044 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeIndexscan.h 0644 root root 1558 62898 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeLimit.h 0644 root root 687 51410 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeLockRows.h 0644 root root 729 55544 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeMaterial.h 0644 root root 838 54 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeMergeAppend.h 0644 root root 771 59120 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeMergejoin.h 0644 root root 743 56576 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeModifyTable.h 0644 root root 768 59148 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeNestloop.h 0644 root root 729 55608 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeRecursiveunion.h 0644 root root 813 64174 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeResult.h 0644 root root 802 62613 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeSeqscan.h 0644 root root 812 62745 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeSetOp.h 0644 root root 687 51226 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeSort.h 0644 root root 766 58935 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeSubplan.h 0644 root root 812 63210 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeSubqueryscan.h 0644 root root 785 61286 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeTidscan.h 0644 root root 812 62601 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeUnique.h 0644 root root 701 52994 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeValuesscan.h 0644 root root 866 2808 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeWindowAgg.h 0644 root root 776 59673 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeWorktablescan.h 0644 root root 799 61952 1347419723 1 f none /usr/local/include/postgresql/server/executor/spi.h 0644 root root 5543 6791 1347419723 1 f none /usr/local/include/postgresql/server/executor/spi_priv.h 0644 root root 3318 17303 1347419723 1 f none /usr/local/include/postgresql/server/executor/tstoreReceiver.h 0644 root root 767 57546 1347419723 1 f none /usr/local/include/postgresql/server/executor/tuptable.h 0644 root root 8591 32493 1347419723 1 f none /usr/local/include/postgresql/server/fmgr.h 0644 root root 30065 54957 1347419723 1 d none /usr/local/include/postgresql/server/foreign 0755 root root 1 f none /usr/local/include/postgresql/server/foreign/fdwapi.h 0644 root root 3083 51822 1347419723 1 f none /usr/local/include/postgresql/server/foreign/foreign.h 0644 root root 2606 12795 1347419723 1 f none /usr/local/include/postgresql/server/funcapi.h 0644 root root 10324 7657 1347419723 1 f none /usr/local/include/postgresql/server/getaddrinfo.h 0644 root root 3936 50846 1347419723 1 f none /usr/local/include/postgresql/server/getopt_long.h 0644 root root 827 2276 1347419723 1 d none /usr/local/include/postgresql/server/lib 0755 root root 1 f none /usr/local/include/postgresql/server/lib/dllist.h 0644 root root 2871 31329 1347419723 1 f none /usr/local/include/postgresql/server/lib/stringinfo.h 0644 root root 5489 56620 1347419723 1 d none /usr/local/include/postgresql/server/libpq 0755 root root 1 f none /usr/local/include/postgresql/server/libpq/auth.h 0644 root root 903 6942 1347419723 1 f none /usr/local/include/postgresql/server/libpq/be-fsstubs.h 0644 root root 1610 63743 1347419723 1 f none /usr/local/include/postgresql/server/libpq/crypt.h 0644 root root 550 39406 1347419723 1 f none /usr/local/include/postgresql/server/libpq/hba.h 0644 root root 1780 10147 1347419723 1 f none /usr/local/include/postgresql/server/libpq/ip.h 0644 root root 1704 5168 1347419723 1 f none /usr/local/include/postgresql/server/libpq/libpq-be.h 0644 root root 5584 61607 1347419723 1 f none /usr/local/include/postgresql/server/libpq/libpq-fs.h 0644 root root 633 44679 1347419723 1 f none /usr/local/include/postgresql/server/libpq/libpq.h 0644 root root 2453 10988 1347419723 1 f none /usr/local/include/postgresql/server/libpq/md5.h 0644 root root 901 2480 1347419723 1 f none /usr/local/include/postgresql/server/libpq/pqcomm.h 0644 root root 5800 11746 1347419723 1 f none /usr/local/include/postgresql/server/libpq/pqformat.h 0644 root root 1997 42679 1347419723 1 f none /usr/local/include/postgresql/server/libpq/pqsignal.h 0644 root root 1300 33631 1347419723 1 d none /usr/local/include/postgresql/server/mb 0755 root root 1 f none /usr/local/include/postgresql/server/mb/pg_wchar.h 0644 root root 17249 36233 1347419723 1 f none /usr/local/include/postgresql/server/miscadmin.h 0644 root root 15125 8175 1347419723 1 d none /usr/local/include/postgresql/server/nodes 0755 root root 1 f none /usr/local/include/postgresql/server/nodes/bitmapset.h 0644 root root 3440 28053 1347419723 1 f none /usr/local/include/postgresql/server/nodes/execnodes.h 0644 root root 66161 1017 1347419723 1 f none /usr/local/include/postgresql/server/nodes/makefuncs.h 0644 root root 2380 147 1347419723 1 f none /usr/local/include/postgresql/server/nodes/memnodes.h 0644 root root 2614 20900 1347419723 1 f none /usr/local/include/postgresql/server/nodes/nodeFuncs.h 0644 root root 2510 3312 1347419723 1 f none /usr/local/include/postgresql/server/nodes/nodes.h 0644 root root 13865 21195 1347419723 1 f none /usr/local/include/postgresql/server/nodes/params.h 0644 root root 3776 47449 1347419723 1 f none /usr/local/include/postgresql/server/nodes/parsenodes.h 0644 root root 88399 53169 1347419723 1 f none /usr/local/include/postgresql/server/nodes/pg_list.h 0644 root root 11367 37318 1347419723 1 f none /usr/local/include/postgresql/server/nodes/plannodes.h 0644 root root 28122 7204 1347419723 1 f none /usr/local/include/postgresql/server/nodes/primnodes.h 0644 root root 50383 64749 1347419723 1 f none /usr/local/include/postgresql/server/nodes/print.h 0644 root root 1070 21166 1347419723 1 f none /usr/local/include/postgresql/server/nodes/readfuncs.h 0644 root root 897 3910 1347419723 1 f none /usr/local/include/postgresql/server/nodes/relation.h 0644 root root 69030 9115 1347419723 1 f none /usr/local/include/postgresql/server/nodes/replnodes.h 0644 root root 1053 8745 1347419723 1 f none /usr/local/include/postgresql/server/nodes/tidbitmap.h 0644 root root 2238 54195 1347419723 1 f none /usr/local/include/postgresql/server/nodes/value.h 0644 root root 1798 10409 1347419723 1 d none /usr/local/include/postgresql/server/optimizer 0755 root root 1 f none /usr/local/include/postgresql/server/optimizer/clauses.h 0644 root root 2999 64034 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/cost.h 0644 root root 7502 46997 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/geqo.h 0644 root root 2173 34361 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/geqo_copy.h 0644 root root 966 2865 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/geqo_gene.h 0644 root root 1114 13818 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/geqo_misc.h 0644 root root 1124 15692 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/geqo_mutation.h 0644 root root 959 2185 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/geqo_pool.h 0644 root root 1317 35034 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/geqo_random.h 0644 root root 1312 31647 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/geqo_recombination.h 0644 root root 2644 13745 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/geqo_selection.h 0644 root root 1015 6141 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/joininfo.h 0644 root root 836 63227 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/pathnode.h 0644 root root 5513 62611 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/paths.h 0644 root root 6734 36713 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/placeholder.h 0644 root root 1233 35170 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/plancat.h 0644 root root 1691 3782 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/planmain.h 0644 root root 4974 30890 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/planner.h 0644 root root 1363 43470 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/predtest.h 0644 root root 668 49780 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/prep.h 0644 root root 1657 8058 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/restrictinfo.h 0644 root root 1754 13971 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/subselect.h 0644 root root 1417 49691 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/tlist.h 0644 root root 1594 3728 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/var.h 0644 root root 1534 59450 1347419723 1 d none /usr/local/include/postgresql/server/parser 0755 root root 1 f none /usr/local/include/postgresql/server/parser/analyze.h 0644 root root 1465 54867 1347419723 1 f none /usr/local/include/postgresql/server/parser/gram.h 0644 root root 11350 22875 1347419723 1 f none /usr/local/include/postgresql/server/parser/gramparse.h 0644 root root 2149 44822 1347419723 1 f none /usr/local/include/postgresql/server/parser/keywords.h 0644 root root 1055 14503 1347419723 1 f none /usr/local/include/postgresql/server/parser/kwlist.h 0644 root root 20745 37109 1347419723 1 f none /usr/local/include/postgresql/server/parser/parse_agg.h 0644 root root 1152 23815 1347419723 1 f none /usr/local/include/postgresql/server/parser/parse_clause.h 0644 root root 1772 15441 1347419723 1 f none /usr/local/include/postgresql/server/parser/parse_coerce.h 0644 root root 3116 57264 1347419723 1 f none /usr/local/include/postgresql/server/parser/parse_collate.h 0644 root root 829 65444 1347419723 1 f none /usr/local/include/postgresql/server/parser/parse_cte.h 0644 root root 694 51806 1347419723 1 f none /usr/local/include/postgresql/server/parser/parse_expr.h 0644 root root 619 45566 1347419723 1 f none /usr/local/include/postgresql/server/parser/parse_func.h 0644 root root 2672 18426 1347419723 1 f none /usr/local/include/postgresql/server/parser/parse_node.h 0644 root root 6244 11590 1347419723 1 f none /usr/local/include/postgresql/server/parser/parse_oper.h 0644 root root 2497 9498 1347419723 1 f none /usr/local/include/postgresql/server/parser/parse_param.h 0644 root root 776 59320 1347419723 1 f none /usr/local/include/postgresql/server/parser/parse_relation.h 0644 root root 3544 24362 1347419723 1 f none /usr/local/include/postgresql/server/parser/parse_target.h 0644 root root 1425 48194 1347419723 1 f none /usr/local/include/postgresql/server/parser/parse_type.h 0644 root root 1710 11912 1347419723 1 f none /usr/local/include/postgresql/server/parser/parse_utilcmd.h 0644 root root 953 10432 1347419723 1 f none /usr/local/include/postgresql/server/parser/parser.h 0644 root root 1146 25345 1347419723 1 f none /usr/local/include/postgresql/server/parser/parsetree.h 0644 root root 2069 32621 1347419723 1 f none /usr/local/include/postgresql/server/parser/scanner.h 0644 root root 4199 25390 1347419723 1 f none /usr/local/include/postgresql/server/parser/scansup.h 0644 root root 752 57084 1347419723 1 f none /usr/local/include/postgresql/server/pg_config.h 0644 root root 26316 5454 1347419723 1 f none /usr/local/include/postgresql/server/pg_config_manual.h 0644 root root 9261 50041 1347419723 1 f none /usr/local/include/postgresql/server/pg_config_os.h 0644 root root 1041 19956 1347419723 1 f none /usr/local/include/postgresql/server/pg_trace.h 0644 root root 316 23828 1347419723 1 f none /usr/local/include/postgresql/server/pgstat.h 0644 root root 24463 41272 1347419723 1 f none /usr/local/include/postgresql/server/pgtime.h 0644 root root 2056 38441 1347419723 1 f none /usr/local/include/postgresql/server/plpgsql.h 0644 root root 26354 20318 1347419725 1 d none /usr/local/include/postgresql/server/port 0755 root root 1 f none /usr/local/include/postgresql/server/port.h 0644 root root 13841 61945 1347419723 1 f none /usr/local/include/postgresql/server/port/aix.h 0644 root root 82 6256 1347419723 1 f none /usr/local/include/postgresql/server/port/cygwin.h 0644 root root 436 35069 1347419723 1 f none /usr/local/include/postgresql/server/port/darwin.h 0644 root root 157 12088 1347419723 1 f none /usr/local/include/postgresql/server/port/freebsd.h 0644 root root 33 2795 1347419723 1 f none /usr/local/include/postgresql/server/port/hpux.h 0644 root root 52 4183 1347419723 1 f none /usr/local/include/postgresql/server/port/irix.h 0644 root root 191 15025 1347419723 1 f none /usr/local/include/postgresql/server/port/linux.h 0644 root root 1051 25270 1347419723 1 f none /usr/local/include/postgresql/server/port/netbsd.h 0644 root root 32 2704 1347419723 1 f none /usr/local/include/postgresql/server/port/openbsd.h 0644 root root 33 2811 1347419723 1 f none /usr/local/include/postgresql/server/port/osf.h 0644 root root 73 5705 1347419723 1 f none /usr/local/include/postgresql/server/port/sco.h 0644 root root 115 9040 1347419723 1 f none /usr/local/include/postgresql/server/port/solaris.h 0644 root root 1041 19956 1347419723 1 f none /usr/local/include/postgresql/server/port/unixware.h 0644 root root 279 19440 1347419723 1 d none /usr/local/include/postgresql/server/port/win32 0755 root root 1 f none /usr/local/include/postgresql/server/port/win32.h 0644 root root 12891 6721 1347419723 1 d none /usr/local/include/postgresql/server/port/win32/arpa 0755 root root 1 f none /usr/local/include/postgresql/server/port/win32/arpa/inet.h 0644 root root 66 5591 1347419723 1 f none /usr/local/include/postgresql/server/port/win32/dlfcn.h 0644 root root 37 3065 1347419723 1 f none /usr/local/include/postgresql/server/port/win32/grp.h 0644 root root 35 2875 1347419723 1 f none /usr/local/include/postgresql/server/port/win32/netdb.h 0644 root root 37 3071 1347419723 1 d none /usr/local/include/postgresql/server/port/win32/netinet 0755 root root 1 f none /usr/local/include/postgresql/server/port/win32/netinet/in.h 0644 root root 67 5713 1347419723 1 f none /usr/local/include/postgresql/server/port/win32/pwd.h 0644 root root 39 2971 1347419723 1 d none /usr/local/include/postgresql/server/port/win32/sys 0755 root root 1 f none /usr/local/include/postgresql/server/port/win32/sys/socket.h 0644 root root 696 57001 1347419723 1 f none /usr/local/include/postgresql/server/port/win32/sys/wait.h 0644 root root 44 3475 1347419723 1 d none /usr/local/include/postgresql/server/port/win32_msvc 0755 root root 1 f none /usr/local/include/postgresql/server/port/win32_msvc/dirent.h 0644 root root 411 33794 1347419723 1 d none /usr/local/include/postgresql/server/port/win32_msvc/sys 0755 root root 1 f none /usr/local/include/postgresql/server/port/win32_msvc/sys/file.h 0644 root root 45 3896 1347419723 1 f none /usr/local/include/postgresql/server/port/win32_msvc/sys/param.h 0644 root root 46 4009 1347419723 1 f none /usr/local/include/postgresql/server/port/win32_msvc/sys/time.h 0644 root root 45 3911 1347419723 1 f none /usr/local/include/postgresql/server/port/win32_msvc/unistd.h 0644 root root 43 3745 1347419723 1 f none /usr/local/include/postgresql/server/port/win32_msvc/utime.h 0644 root root 42 3630 1347419723 1 d none /usr/local/include/postgresql/server/portability 0755 root root 1 f none /usr/local/include/postgresql/server/portability/instr_time.h 0644 root root 4262 61224 1347419723 1 f none /usr/local/include/postgresql/server/postgres.h 0644 root root 20550 48738 1347419723 1 f none /usr/local/include/postgresql/server/postgres_ext.h 0644 root root 1778 8903 1347419723 1 f none /usr/local/include/postgresql/server/postgres_fe.h 0644 root root 730 54063 1347419723 1 d none /usr/local/include/postgresql/server/postmaster 0755 root root 1 f none /usr/local/include/postgresql/server/postmaster/autovacuum.h 0644 root root 1965 40205 1347419723 1 f none /usr/local/include/postgresql/server/postmaster/bgwriter.h 0644 root root 1239 37701 1347419723 1 f none /usr/local/include/postgresql/server/postmaster/fork_process.h 0644 root root 447 30691 1347419723 1 f none /usr/local/include/postgresql/server/postmaster/pgarch.h 0644 root root 641 45645 1347419723 1 f none /usr/local/include/postgresql/server/postmaster/postmaster.h 0644 root root 1765 17711 1347419723 1 f none /usr/local/include/postgresql/server/postmaster/startup.h 0644 root root 635 48878 1347419723 1 f none /usr/local/include/postgresql/server/postmaster/syslogger.h 0644 root root 2571 10401 1347419723 1 f none /usr/local/include/postgresql/server/postmaster/walwriter.h 0644 root root 487 33996 1347419723 1 d none /usr/local/include/postgresql/server/regex 0755 root root 1 f none /usr/local/include/postgresql/server/regex/regcustom.h 0644 root root 2892 31982 1347419723 1 f none /usr/local/include/postgresql/server/regex/regerrs.h 0644 root root 1214 25525 1347419723 1 f none /usr/local/include/postgresql/server/regex/regex.h 0644 root root 6595 52283 1347419723 1 f none /usr/local/include/postgresql/server/regex/regguts.h 0644 root root 15392 50306 1347419723 1 d none /usr/local/include/postgresql/server/replication 0755 root root 1 f none /usr/local/include/postgresql/server/replication/basebackup.h 0644 root root 494 34341 1347419723 1 f none /usr/local/include/postgresql/server/replication/syncrep.h 0644 root root 1518 55943 1347419723 1 f none /usr/local/include/postgresql/server/replication/walprotocol.h 0644 root root 3366 17716 1347419723 1 f none /usr/local/include/postgresql/server/replication/walreceiver.h 0644 root root 3884 981 1347419723 1 f none /usr/local/include/postgresql/server/replication/walsender.h 0644 root root 1001 16364 1347419723 1 f none /usr/local/include/postgresql/server/replication/walsender_private.h 0644 root root 3036 53296 1347419723 1 d none /usr/local/include/postgresql/server/rewrite 0755 root root 1 f none /usr/local/include/postgresql/server/rewrite/prs2lock.h 0644 root root 1070 16122 1347419723 1 f none /usr/local/include/postgresql/server/rewrite/rewriteDefine.h 0644 root root 1143 20696 1347419723 1 f none /usr/local/include/postgresql/server/rewrite/rewriteHandler.h 0644 root root 744 57214 1347419723 1 f none /usr/local/include/postgresql/server/rewrite/rewriteManip.h 0644 root root 2764 37971 1347419723 1 f none /usr/local/include/postgresql/server/rewrite/rewriteRemove.h 0644 root root 537 38035 1347419723 1 f none /usr/local/include/postgresql/server/rewrite/rewriteSupport.h 0644 root root 911 5157 1347419723 1 f none /usr/local/include/postgresql/server/rusagestub.h 0644 root root 843 61889 1347419723 1 d none /usr/local/include/postgresql/server/snowball 0755 root root 1 f none /usr/local/include/postgresql/server/snowball/header.h 0644 root root 1690 5770 1347419723 1 d none /usr/local/include/postgresql/server/snowball/libstemmer 0755 root root 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/api.h 0644 root root 763 64946 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/header.h 0644 root root 2487 16389 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_danish.h 0644 root root 325 28045 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_dutch.h 0644 root root 322 27760 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_english.h 0644 root root 328 28390 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_finnish.h 0644 root root 328 28405 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_french.h 0644 root root 325 28042 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_german.h 0644 root root 325 28054 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_hungarian.h 0644 root root 334 29023 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_italian.h 0644 root root 328 28366 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_norwegian.h 0644 root root 334 29062 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_porter.h 0644 root root 325 28156 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_portuguese.h 0644 root root 337 29473 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_spanish.h 0644 root root 328 28426 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_swedish.h 0644 root root 328 28429 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_2_romanian.h 0644 root root 331 28714 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_KOI8_R_russian.h 0644 root root 316 27763 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_danish.h 0644 root root 310 27127 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_dutch.h 0644 root root 307 26842 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_english.h 0644 root root 313 27472 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_finnish.h 0644 root root 313 27487 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_french.h 0644 root root 310 27124 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_german.h 0644 root root 310 27136 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_hungarian.h 0644 root root 319 28105 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_italian.h 0644 root root 313 27448 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_norwegian.h 0644 root root 319 28144 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_porter.h 0644 root root 310 27238 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_portuguese.h 0644 root root 322 28555 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_romanian.h 0644 root root 316 27793 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_russian.h 0644 root root 313 27553 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_spanish.h 0644 root root 313 27508 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_swedish.h 0644 root root 313 27511 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_turkish.h 0644 root root 313 27568 1347419723 1 d none /usr/local/include/postgresql/server/storage 0755 root root 1 f none /usr/local/include/postgresql/server/storage/backendid.h 0644 root root 730 51005 1347419723 1 f none /usr/local/include/postgresql/server/storage/barrier.h 0644 root root 6445 25044 1347419723 1 f none /usr/local/include/postgresql/server/storage/block.h 0644 root root 3281 1187 1347419723 1 f none /usr/local/include/postgresql/server/storage/buf.h 0644 root root 1082 17129 1347419723 1 f none /usr/local/include/postgresql/server/storage/buf_internals.h 0644 root root 7963 13200 1347419723 1 f none /usr/local/include/postgresql/server/storage/buffile.h 0644 root root 1714 12012 1347419723 1 f none /usr/local/include/postgresql/server/storage/bufmgr.h 0644 root root 6950 62401 1347419723 1 f none /usr/local/include/postgresql/server/storage/bufpage.h 0644 root root 13193 12038 1347419723 1 f none /usr/local/include/postgresql/server/storage/copydir.h 0644 root root 561 40290 1347419723 1 f none /usr/local/include/postgresql/server/storage/fd.h 0644 root root 3423 24352 1347419723 1 f none /usr/local/include/postgresql/server/storage/freespace.h 0644 root root 1264 35691 1347419723 1 f none /usr/local/include/postgresql/server/storage/fsm_internals.h 0644 root root 2296 57945 1347419723 1 f none /usr/local/include/postgresql/server/storage/indexfsm.h 0644 root root 795 61420 1347419723 1 f none /usr/local/include/postgresql/server/storage/ipc.h 0644 root root 2600 18517 1347419723 1 f none /usr/local/include/postgresql/server/storage/item.h 0644 root root 469 31708 1347419723 1 f none /usr/local/include/postgresql/server/storage/itemid.h 0644 root root 4341 14322 1347419723 1 f none /usr/local/include/postgresql/server/storage/itemptr.h 0644 root root 3812 54502 1347419723 1 f none /usr/local/include/postgresql/server/storage/large_object.h 0644 root root 2964 48730 1347419723 1 f none /usr/local/include/postgresql/server/storage/latch.h 0644 root root 5399 2495 1347419723 1 f none /usr/local/include/postgresql/server/storage/lmgr.h 0644 root root 3224 12313 1347419723 1 f none /usr/local/include/postgresql/server/storage/lock.h 0644 root root 20611 64853 1347419723 1 f none /usr/local/include/postgresql/server/storage/lwlock.h 0644 root root 3665 42202 1347419723 1 f none /usr/local/include/postgresql/server/storage/off.h 0644 root root 1618 60679 1347419723 1 f none /usr/local/include/postgresql/server/storage/pg_sema.h 0644 root root 2469 10863 1347419723 1 f none /usr/local/include/postgresql/server/storage/pg_shmem.h 0644 root root 1956 27391 1347419723 1 f none /usr/local/include/postgresql/server/storage/pmsignal.h 0644 root root 2080 41129 1347419723 1 f none /usr/local/include/postgresql/server/storage/pos.h 0644 root root 1592 60695 1347419723 1 f none /usr/local/include/postgresql/server/storage/predicate.h 0644 root root 2623 32119 1347419723 1 f none /usr/local/include/postgresql/server/storage/predicate_internals.h 0644 root root 17906 55412 1347419723 1 f none /usr/local/include/postgresql/server/storage/proc.h 0644 root root 9801 33810 1347419723 1 f none /usr/local/include/postgresql/server/storage/procarray.h 0644 root root 2958 62117 1347419723 1 f none /usr/local/include/postgresql/server/storage/procsignal.h 0644 root root 1798 13394 1347419723 1 f none /usr/local/include/postgresql/server/storage/reinit.h 0644 root root 588 41139 1347419723 1 f none /usr/local/include/postgresql/server/storage/relfilenode.h 0644 root root 4416 41241 1347419723 1 f none /usr/local/include/postgresql/server/storage/s_lock.h 0644 root root 26285 63248 1347419723 1 f none /usr/local/include/postgresql/server/storage/shmem.h 0644 root root 2694 26282 1347419723 1 f none /usr/local/include/postgresql/server/storage/sinval.h 0644 root root 5089 33061 1347419723 1 f none /usr/local/include/postgresql/server/storage/sinvaladt.h 0644 root root 1522 61336 1347419723 1 f none /usr/local/include/postgresql/server/storage/smgr.h 0644 root root 5583 30862 1347419723 1 f none /usr/local/include/postgresql/server/storage/spin.h 0644 root root 2568 16803 1347419723 1 f none /usr/local/include/postgresql/server/storage/standby.h 0644 root root 4085 26198 1347419723 1 d none /usr/local/include/postgresql/server/tcop 0755 root root 1 f none /usr/local/include/postgresql/server/tcop/dest.h 0644 root root 5670 24127 1347419723 1 f none /usr/local/include/postgresql/server/tcop/fastpath.h 0644 root root 509 35675 1347419723 1 f none /usr/local/include/postgresql/server/tcop/pquery.h 0644 root root 1161 27113 1347419723 1 f none /usr/local/include/postgresql/server/tcop/tcopdebug.h 0644 root root 1316 21742 1347419723 1 f none /usr/local/include/postgresql/server/tcop/tcopprot.h 0644 root root 2996 55912 1347419723 1 f none /usr/local/include/postgresql/server/tcop/utility.h 0644 root root 1514 59783 1347419723 1 d none /usr/local/include/postgresql/server/tsearch 0755 root root 1 d none /usr/local/include/postgresql/server/tsearch/dicts 0755 root root 1 f none /usr/local/include/postgresql/server/tsearch/dicts/regis.h 0644 root root 915 1629 1347419723 1 f none /usr/local/include/postgresql/server/tsearch/dicts/spell.h 0644 root root 3697 26849 1347419723 1 f none /usr/local/include/postgresql/server/tsearch/ts_cache.h 0644 root root 2109 38292 1347419723 1 f none /usr/local/include/postgresql/server/tsearch/ts_locale.h 0644 root root 2055 33086 1347419723 1 f none /usr/local/include/postgresql/server/tsearch/ts_public.h 0644 root root 2809 21524 1347419723 1 f none /usr/local/include/postgresql/server/tsearch/ts_type.h 0644 root root 8812 55356 1347419723 1 f none /usr/local/include/postgresql/server/tsearch/ts_utils.h 0644 root root 7829 4582 1347419723 1 d none /usr/local/include/postgresql/server/utils 0755 root root 1 f none /usr/local/include/postgresql/server/utils/acl.h 0644 root root 13098 31821 1347419723 1 f none /usr/local/include/postgresql/server/utils/array.h 0644 root root 10863 57414 1347419723 1 f none /usr/local/include/postgresql/server/utils/ascii.h 0644 root root 579 42025 1347419723 1 f none /usr/local/include/postgresql/server/utils/attoptcache.h 0644 root root 716 53471 1347419723 1 f none /usr/local/include/postgresql/server/utils/builtins.h 0644 root root 48719 42868 1347419723 1 f none /usr/local/include/postgresql/server/utils/bytea.h 0644 root root 1615 64112 1347419723 1 f none /usr/local/include/postgresql/server/utils/cash.h 0644 root root 2118 45533 1347419723 1 f none /usr/local/include/postgresql/server/utils/catcache.h 0644 root root 7734 43523 1347419723 1 f none /usr/local/include/postgresql/server/utils/combocid.h 0644 root root 698 52060 1347419723 1 f none /usr/local/include/postgresql/server/utils/date.h 0644 root root 7919 4881 1347419723 1 f none /usr/local/include/postgresql/server/utils/datetime.h 0644 root root 8757 23248 1347419723 1 f none /usr/local/include/postgresql/server/utils/datum.h 0644 root root 1520 57061 1347419723 1 f none /usr/local/include/postgresql/server/utils/dynahash.h 0644 root root 498 34232 1347419723 1 f none /usr/local/include/postgresql/server/utils/dynamic_loader.h 0644 root root 648 47623 1347419723 1 f none /usr/local/include/postgresql/server/utils/elog.h 0644 root root 12857 14027 1347419723 1 f none /usr/local/include/postgresql/server/utils/errcodes.h 0644 root root 20079 65175 1347419723 1 f none /usr/local/include/postgresql/server/utils/fmgroids.h 0644 root root 62560 44991 1347419723 1 f none /usr/local/include/postgresql/server/utils/fmgrtab.h 0644 root root 1181 25590 1347419723 1 f none /usr/local/include/postgresql/server/utils/formatting.h 0644 root root 1261 35536 1347419723 1 f none /usr/local/include/postgresql/server/utils/geo_decls.h 0644 root root 16242 60062 1347419723 1 f none /usr/local/include/postgresql/server/utils/guc.h 0644 root root 13503 20197 1347419723 1 f none /usr/local/include/postgresql/server/utils/guc_tables.h 0644 root root 7319 12077 1347419723 1 f none /usr/local/include/postgresql/server/utils/help_config.h 0644 root root 432 29084 1347419723 1 f none /usr/local/include/postgresql/server/utils/hsearch.h 0644 root root 5639 8050 1347419723 1 f none /usr/local/include/postgresql/server/utils/inet.h 0644 root root 2722 23333 1347419723 1 f none /usr/local/include/postgresql/server/utils/int8.h 0644 root root 4130 8792 1347419723 1 f none /usr/local/include/postgresql/server/utils/inval.h 0644 root root 1849 23057 1347419723 1 f none /usr/local/include/postgresql/server/utils/json.h 0644 root root 916 5604 1347419723 1 f none /usr/local/include/postgresql/server/utils/logtape.h 0644 root root 1539 62057 1347419723 1 f none /usr/local/include/postgresql/server/utils/lsyscache.h 0644 root root 6663 64530 1347419723 1 f none /usr/local/include/postgresql/server/utils/memutils.h 0644 root root 5037 38397 1347419723 1 f none /usr/local/include/postgresql/server/utils/nabstime.h 0644 root root 5927 24841 1347419723 1 f none /usr/local/include/postgresql/server/utils/numeric.h 0644 root root 1833 13366 1347419723 1 f none /usr/local/include/postgresql/server/utils/palloc.h 0644 root root 4006 20054 1347419723 1 f none /usr/local/include/postgresql/server/utils/pg_crc.h 0644 root root 4465 22267 1347419723 1 f none /usr/local/include/postgresql/server/utils/pg_crc_tables.h 0644 root root 20203 47300 1347419723 1 f none /usr/local/include/postgresql/server/utils/pg_locale.h 0644 root root 2614 29074 1347419723 1 f none /usr/local/include/postgresql/server/utils/pg_lzcompress.h 0644 root root 3045 45929 1347419723 1 f none /usr/local/include/postgresql/server/utils/pg_rusage.h 0644 root root 847 65424 1347419723 1 f none /usr/local/include/postgresql/server/utils/plancache.h 0644 root root 7347 35915 1347419723 1 f none /usr/local/include/postgresql/server/utils/portal.h 0644 root root 8911 37494 1347419723 1 f none /usr/local/include/postgresql/server/utils/probes.h 0644 root root 6654 33176 1347419723 1 f none /usr/local/include/postgresql/server/utils/ps_status.h 0644 root root 668 51504 1347419723 1 f none /usr/local/include/postgresql/server/utils/rangetypes.h 0644 root root 7577 38449 1347419723 1 f none /usr/local/include/postgresql/server/utils/rbtree.h 0644 root root 2312 55775 1347419723 1 f none /usr/local/include/postgresql/server/utils/rel.h 0644 root root 12658 16510 1347419723 1 f none /usr/local/include/postgresql/server/utils/relcache.h 0644 root root 3241 11100 1347419723 1 f none /usr/local/include/postgresql/server/utils/relmapper.h 0644 root root 1719 8149 1347419723 1 f none /usr/local/include/postgresql/server/utils/reltrigger.h 0644 root root 1999 33515 1347419723 1 f none /usr/local/include/postgresql/server/utils/resowner.h 0644 root root 4960 36572 1347419723 1 f none /usr/local/include/postgresql/server/utils/selfuncs.h 0644 root root 7533 40605 1347419723 1 f none /usr/local/include/postgresql/server/utils/snapmgr.h 0644 root root 1625 10656 1347419723 1 f none /usr/local/include/postgresql/server/utils/snapshot.h 0644 root root 2653 19559 1347419723 1 f none /usr/local/include/postgresql/server/utils/sortsupport.h 0644 root root 5427 64487 1347419723 1 f none /usr/local/include/postgresql/server/utils/spccache.h 0644 root root 556 39333 1347419723 1 f none /usr/local/include/postgresql/server/utils/syscache.h 0644 root root 5593 50252 1347419723 1 f none /usr/local/include/postgresql/server/utils/timestamp.h 0644 root root 9731 51308 1347419723 1 f none /usr/local/include/postgresql/server/utils/tqual.h 0644 root root 3507 34041 1347419723 1 f none /usr/local/include/postgresql/server/utils/tuplesort.h 0644 root root 4726 19377 1347419723 1 f none /usr/local/include/postgresql/server/utils/tuplestore.h 0644 root root 3213 21407 1347419723 1 f none /usr/local/include/postgresql/server/utils/typcache.h 0644 root root 4361 31294 1347419723 1 f none /usr/local/include/postgresql/server/utils/tzparser.h 0644 root root 993 10973 1347419723 1 f none /usr/local/include/postgresql/server/utils/uuid.h 0644 root root 861 63449 1347419723 1 f none /usr/local/include/postgresql/server/utils/varbit.h 0644 root root 4159 7206 1347419723 1 f none /usr/local/include/postgresql/server/utils/xml.h 0644 root root 3986 15516 1347419723 1 f none /usr/local/include/postgresql/server/windowapi.h 0644 root root 2379 2298 1347419723 1 f none /usr/local/include/sql3types.h 0644 root root 834 59470 1347419724 1 f none /usr/local/include/sqlca.h 0644 root root 1267 26312 1347419724 1 f none /usr/local/include/sqlda-compat.h 0644 root root 1583 59559 1347419724 1 f none /usr/local/include/sqlda-native.h 0644 root root 820 2805 1347419724 1 f none /usr/local/include/sqlda.h 0644 root root 315 27403 1347419724 1 d none /usr/local/lib 0755 root root 1 f none /usr/local/lib/libecpg.a 0644 root root 948876 28827 1347419724 1 s none /usr/local/lib/libecpg.so=libecpg.so.6.4 1 s none /usr/local/lib/libecpg.so.6=libecpg.so.6.4 1 f none /usr/local/lib/libecpg.so.6.4 0755 root root 921184 50384 1347419724 1 f none /usr/local/lib/libecpg_compat.a 0644 root root 18920 55024 1347419724 1 s none /usr/local/lib/libecpg_compat.so=libecpg_compat.so.3.4 1 s none /usr/local/lib/libecpg_compat.so.3=libecpg_compat.so.3.4 1 f none /usr/local/lib/libecpg_compat.so.3.4 0755 root root 22208 8423 1347419724 1 f none /usr/local/lib/libpgport.a 0644 root root 115128 4264 1347419720 1 f none /usr/local/lib/libpgtypes.a 0644 root root 113020 23569 1347419724 1 s none /usr/local/lib/libpgtypes.so=libpgtypes.so.3.3 1 s none /usr/local/lib/libpgtypes.so.3=libpgtypes.so.3.3 1 f none /usr/local/lib/libpgtypes.so.3.3 0755 root root 98484 55983 1347419724 1 f none /usr/local/lib/libpq.a 0644 root root 327000 20320 1347419723 1 s none /usr/local/lib/libpq.so=libpq.so.5.5 1 s none /usr/local/lib/libpq.so.5=libpq.so.5.5 1 f none /usr/local/lib/libpq.so.5.5 0755 root root 277820 14018 1347419723 1 d none /usr/local/lib/postgresql 0755 root root 1 f none /usr/local/lib/postgresql/_int.so 0755 root root 67900 38306 1347419726 1 f none /usr/local/lib/postgresql/adminpack.so 0755 root root 16384 11957 1347419725 1 f none /usr/local/lib/postgresql/ascii_and_mic.so 0755 root root 7228 33198 1347419722 1 f none /usr/local/lib/postgresql/auth_delay.so 0755 root root 7652 49165 1347419725 1 f none /usr/local/lib/postgresql/auto_explain.so 0755 root root 13308 2614 1347419725 1 f none /usr/local/lib/postgresql/autoinc.so 0755 root root 10072 1401 1347419728 1 f none /usr/local/lib/postgresql/btree_gin.so 0755 root root 43660 29810 1347419725 1 f none /usr/local/lib/postgresql/btree_gist.so 0755 root root 151180 53955 1347419726 1 f none /usr/local/lib/postgresql/chkpass.so 0755 root root 9468 48554 1347419726 1 f none /usr/local/lib/postgresql/citext.so 0755 root root 11012 27767 1347419726 1 f none /usr/local/lib/postgresql/cube.so 0755 root root 56224 5981 1347419726 1 f none /usr/local/lib/postgresql/cyrillic_and_mic.so 0755 root root 15284 18374 1347419722 1 f none /usr/local/lib/postgresql/dblink.so 0755 root root 49308 58649 1347419726 1 f none /usr/local/lib/postgresql/dict_int.so 0755 root root 8424 44549 1347419726 1 f none /usr/local/lib/postgresql/dict_snowball.so 0755 root root 479852 27376 1347419723 1 f none /usr/local/lib/postgresql/dict_xsyn.so 0755 root root 11472 53746 1347419726 1 f none /usr/local/lib/postgresql/dummy_seclabel.so 0755 root root 7672 7943 1347419726 1 f none /usr/local/lib/postgresql/earthdistance.so 0755 root root 8300 63016 1347419726 1 f none /usr/local/lib/postgresql/euc2004_sjis2004.so 0755 root root 9208 42811 1347419722 1 f none /usr/local/lib/postgresql/euc_cn_and_mic.so 0755 root root 7772 16682 1347419722 1 f none /usr/local/lib/postgresql/euc_jp_and_sjis.so 0755 root root 15408 59117 1347419722 1 f none /usr/local/lib/postgresql/euc_kr_and_mic.so 0755 root root 7892 30052 1347419722 1 f none /usr/local/lib/postgresql/euc_tw_and_big5.so 0755 root root 15588 35501 1347419722 1 f none /usr/local/lib/postgresql/file_fdw.so 0755 root root 19584 18142 1347419726 1 f none /usr/local/lib/postgresql/fuzzystrmatch.so 0755 root root 42632 10841 1347419726 1 f none /usr/local/lib/postgresql/hstore.so 0755 root root 72676 38981 1347419726 1 f none /usr/local/lib/postgresql/insert_username.so 0755 root root 9476 12582 1347419728 1 f none /usr/local/lib/postgresql/isn.so 0755 root root 63568 36404 1347419727 1 f none /usr/local/lib/postgresql/latin2_and_win1250.so 0755 root root 9824 41660 1347419722 1 f none /usr/local/lib/postgresql/latin_and_mic.so 0755 root root 8956 25646 1347419722 1 f none /usr/local/lib/postgresql/libpqwalreceiver.so 0755 root root 14248 57681 1347419724 1 f none /usr/local/lib/postgresql/lo.so 0755 root root 8240 31695 1347419727 1 f none /usr/local/lib/postgresql/ltree.so 0755 root root 96188 23538 1347419727 1 f none /usr/local/lib/postgresql/moddatetime.so 0755 root root 9588 25641 1347419728 1 f none /usr/local/lib/postgresql/pageinspect.so 0755 root root 31604 6369 1347419727 1 f none /usr/local/lib/postgresql/passwordcheck.so 0755 root root 8680 24542 1347419727 1 f none /usr/local/lib/postgresql/pg_buffercache.so 0755 root root 10256 10790 1347419727 1 f none /usr/local/lib/postgresql/pg_freespacemap.so 0755 root root 7784 406 1347419727 1 f none /usr/local/lib/postgresql/pg_stat_statements.so 0755 root root 32844 16326 1347419727 1 f none /usr/local/lib/postgresql/pg_trgm.so 0755 root root 35320 62379 1347419727 1 f none /usr/local/lib/postgresql/pg_upgrade_support.so 0755 root root 11084 32011 1347419727 1 f none /usr/local/lib/postgresql/pgcrypto.so 0755 root root 214288 42872 1347419727 1 f none /usr/local/lib/postgresql/pgrowlocks.so 0755 root root 12148 35835 1347419727 1 f none /usr/local/lib/postgresql/pgstattuple.so 0755 root root 23372 18740 1347419728 1 f none /usr/local/lib/postgresql/pgxml.so 0755 root root 28916 16171 1347419728 1 d none /usr/local/lib/postgresql/pgxs 0755 root root 1 d none /usr/local/lib/postgresql/pgxs/config 0755 root root 1 f none /usr/local/lib/postgresql/pgxs/config/install-sh 0755 root root 13901 20906 1347419725 1 d none /usr/local/lib/postgresql/pgxs/src 0755 root root 1 f none /usr/local/lib/postgresql/pgxs/src/Makefile.global 0644 root root 23116 49190 1347419725 1 f none /usr/local/lib/postgresql/pgxs/src/Makefile.port 0644 root root 484 35873 1347419725 1 f none /usr/local/lib/postgresql/pgxs/src/Makefile.shlib 0644 root root 14858 31014 1347419725 1 d none /usr/local/lib/postgresql/pgxs/src/makefiles 0755 root root 1 f none /usr/local/lib/postgresql/pgxs/src/makefiles/pgxs.mk 0644 root root 7947 39936 1347419725 1 f none /usr/local/lib/postgresql/pgxs/src/nls-global.mk 0644 root root 5971 12498 1347419725 1 d none /usr/local/lib/postgresql/pgxs/src/test 0755 root root 1 d none /usr/local/lib/postgresql/pgxs/src/test/regress 0755 root root 1 f none /usr/local/lib/postgresql/pgxs/src/test/regress/pg_regress 0755 root root 75224 15448 1347419725 1 f none /usr/local/lib/postgresql/plpgsql.so 0755 root root 189220 46169 1347419725 1 f none /usr/local/lib/postgresql/pltcl.so 0755 root root 38992 43713 1347419725 1 f none /usr/local/lib/postgresql/refint.so 0755 root root 18676 26063 1347419728 1 f none /usr/local/lib/postgresql/seg.so 0755 root root 41696 43256 1347419728 1 f none /usr/local/lib/postgresql/sslinfo.so 0755 root root 14488 4003 1347419728 1 f none /usr/local/lib/postgresql/tablefunc.so 0755 root root 27356 12286 1347419728 1 f none /usr/local/lib/postgresql/tcn.so 0755 root root 10288 41059 1347419728 1 f none /usr/local/lib/postgresql/test_parser.so 0755 root root 8172 19020 1347419728 1 f none /usr/local/lib/postgresql/timetravel.so 0755 root root 15972 55256 1347419728 1 f none /usr/local/lib/postgresql/tsearch2.so 0755 root root 26492 41143 1347419728 1 f none /usr/local/lib/postgresql/unaccent.so 0755 root root 13432 21233 1347419728 1 f none /usr/local/lib/postgresql/utf8_and_ascii.so 0755 root root 7236 34300 1347419722 1 f none /usr/local/lib/postgresql/utf8_and_big5.so 0755 root root 226736 25243 1347419722 1 f none /usr/local/lib/postgresql/utf8_and_cyrillic.so 0755 root root 12100 10481 1347419722 1 f none /usr/local/lib/postgresql/utf8_and_euc2004.so 0755 root root 190988 58476 1347419722 1 f none /usr/local/lib/postgresql/utf8_and_euc_cn.so 0755 root root 126452 33270 1347419722 1 f none /usr/local/lib/postgresql/utf8_and_euc_jp.so 0755 root root 218308 12881 1347419722 1 f none /usr/local/lib/postgresql/utf8_and_euc_kr.so 0755 root root 138964 43214 1347419722 1 f none /usr/local/lib/postgresql/utf8_and_euc_tw.so 0755 root root 337620 5637 1347419722 1 f none /usr/local/lib/postgresql/utf8_and_gb18030.so 0755 root root 1021104 12878 1347419722 1 f none /usr/local/lib/postgresql/utf8_and_gbk.so 0755 root root 355964 16694 1347419722 1 f none /usr/local/lib/postgresql/utf8_and_iso8859.so 0755 root root 34580 37918 1347419722 1 f none /usr/local/lib/postgresql/utf8_and_iso8859_1.so 0755 root root 8068 49906 1347419722 1 f none /usr/local/lib/postgresql/utf8_and_johab.so 0755 root root 280104 62558 1347419722 1 f none /usr/local/lib/postgresql/utf8_and_sjis.so 0755 root root 128792 49117 1347419722 1 f none /usr/local/lib/postgresql/utf8_and_sjis2004.so 0755 root root 190492 38382 1347419722 1 f none /usr/local/lib/postgresql/utf8_and_uhc.so 0755 root root 283084 43240 1347419722 1 f none /usr/local/lib/postgresql/utf8_and_win.so 0755 root root 29856 46064 1347419722 1 d none /usr/local/share 0755 root root 1 d none /usr/local/share/doc 0755 root root 1 d none /usr/local/share/doc/postgresql 0755 root root 1 d none /usr/local/share/doc/postgresql/extension 0755 root root 1 f none /usr/local/share/doc/postgresql/extension/autoinc.example 0644 root root 798 56417 1347419728 1 f none /usr/local/share/doc/postgresql/extension/insert_username.example 0644 root root 560 44401 1347419728 1 f none /usr/local/share/doc/postgresql/extension/moddatetime.example 0644 root root 493 34473 1347419728 1 f none /usr/local/share/doc/postgresql/extension/refint.example 0644 root root 2105 24710 1347419728 1 f none /usr/local/share/doc/postgresql/extension/timetravel.example 0644 root root 2372 6310 1347419728 1 d none /usr/local/share/doc/postgresql/html 0755 root root 1 f none /usr/local/share/doc/postgresql/html/LEGALNOTICE.html 0644 root root 2679 62344 1347419719 1 f none /usr/local/share/doc/postgresql/html/acronyms.html 0644 root root 16281 41487 1347419718 1 f none /usr/local/share/doc/postgresql/html/admin.html 0644 root root 12497 39709 1347419718 1 f none /usr/local/share/doc/postgresql/html/adminpack.html 0644 root root 3412 63159 1347419719 1 f none /usr/local/share/doc/postgresql/html/app-clusterdb.html 0644 root root 10600 41712 1347419719 1 f none /usr/local/share/doc/postgresql/html/app-createdb.html 0644 root root 12854 11824 1347419719 1 f none /usr/local/share/doc/postgresql/html/app-createlang.html 0644 root root 9905 55548 1347419719 1 f none /usr/local/share/doc/postgresql/html/app-createuser.html 0644 root root 15638 28555 1347419719 1 f none /usr/local/share/doc/postgresql/html/app-dropdb.html 0644 root root 9640 41596 1347419719 1 f none /usr/local/share/doc/postgresql/html/app-droplang.html 0644 root root 9636 32496 1347419719 1 f none /usr/local/share/doc/postgresql/html/app-dropuser.html 0644 root root 9594 39048 1347419718 1 f none /usr/local/share/doc/postgresql/html/app-ecpg.html 0644 root root 8917 62646 1347419718 1 f none /usr/local/share/doc/postgresql/html/app-initdb.html 0644 root root 15228 19815 1347419719 1 f none /usr/local/share/doc/postgresql/html/app-pg-ctl.html 0644 root root 22127 50394 1347419719 1 f none /usr/local/share/doc/postgresql/html/app-pg-dumpall.html 0644 root root 20079 62364 1347419719 1 f none /usr/local/share/doc/postgresql/html/app-pgbasebackup.html 0644 root root 19816 60387 1347419719 1 f none /usr/local/share/doc/postgresql/html/app-pgconfig.html 0644 root root 11091 34210 1347419719 1 f none /usr/local/share/doc/postgresql/html/app-pgcontroldata.html 0644 root root 3977 29152 1347419719 1 f none /usr/local/share/doc/postgresql/html/app-pgdump.html 0644 root root 42955 48967 1347419719 1 f none /usr/local/share/doc/postgresql/html/app-pgreceivexlog.html 0644 root root 11055 45383 1347419719 1 f none /usr/local/share/doc/postgresql/html/app-pgresetxlog.html 0644 root root 11456 31731 1347419719 1 f none /usr/local/share/doc/postgresql/html/app-pgrestore.html 0644 root root 29944 11035 1347419719 1 f none /usr/local/share/doc/postgresql/html/app-postgres.html 0644 root root 31484 57185 1347419719 1 f none /usr/local/share/doc/postgresql/html/app-postmaster.html 0644 root root 3003 16004 1347419718 1 f none /usr/local/share/doc/postgresql/html/app-psql.html 0644 root root 135001 52252 1347419718 1 f none /usr/local/share/doc/postgresql/html/app-reindexdb.html 0644 root root 11279 16440 1347419719 1 f none /usr/local/share/doc/postgresql/html/app-vacuumdb.html 0644 root root 12614 51902 1347419718 1 f none /usr/local/share/doc/postgresql/html/appendixes.html 0644 root root 21640 36021 1347419719 1 f none /usr/local/share/doc/postgresql/html/applevel-consistency.html 0644 root root 10358 49597 1347419718 1 f none /usr/local/share/doc/postgresql/html/archive-recovery-settings.html 0644 root root 7336 41415 1347419718 1 f none /usr/local/share/doc/postgresql/html/arrays.html 0644 root root 26891 22375 1347419719 1 f none /usr/local/share/doc/postgresql/html/auth-delay.html 0644 root root 3778 18745 1347419718 1 f none /usr/local/share/doc/postgresql/html/auth-methods.html 0644 root root 34495 62877 1347419718 1 f none /usr/local/share/doc/postgresql/html/auth-pg-hba-conf.html 0644 root root 29511 62934 1347419718 1 f none /usr/local/share/doc/postgresql/html/auth-username-maps.html 0644 root root 8595 8467 1347419719 1 f none /usr/local/share/doc/postgresql/html/auto-explain.html 0644 root root 8731 6699 1347419719 1 f none /usr/local/share/doc/postgresql/html/backup-dump.html 0644 root root 15925 53150 1347419719 1 f none /usr/local/share/doc/postgresql/html/backup-file.html 0644 root root 7994 53207 1347419718 1 f none /usr/local/share/doc/postgresql/html/backup.html 0644 root root 4483 3753 1347419719 1 f none /usr/local/share/doc/postgresql/html/biblio.html 0644 root root 11547 37197 1347419718 1 f none /usr/local/share/doc/postgresql/html/bki-commands.html 0644 root root 9644 27707 1347419719 1 f none /usr/local/share/doc/postgresql/html/bki-example.html 0644 root root 3047 25416 1347419719 1 f none /usr/local/share/doc/postgresql/html/bki-format.html 0644 root root 3461 59037 1347419718 1 f none /usr/local/share/doc/postgresql/html/bki-structure.html 0644 root root 4318 46948 1347419719 1 f none /usr/local/share/doc/postgresql/html/bki.html 0644 root root 4328 59268 1347419718 1 f none /usr/local/share/doc/postgresql/html/bookindex.html 0644 root root 241543 4032 1347419719 1 f none /usr/local/share/doc/postgresql/html/btree-gin.html 0644 root root 4598 12803 1347419719 1 f none /usr/local/share/doc/postgresql/html/btree-gist.html 0644 root root 6883 56616 1347419719 1 f none /usr/local/share/doc/postgresql/html/bug-reporting.html 0644 root root 18642 2304 1347419718 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-aggregate.html 0644 root root 5500 12266 1347419718 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-am.html 0644 root root 10545 43757 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-amop.html 0644 root root 7591 42402 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-amproc.html 0644 root root 4883 31933 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-attrdef.html 0644 root root 4362 57213 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-attribute.html 0644 root root 10285 40900 1347419718 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-auth-members.html 0644 root root 4253 43905 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-authid.html 0644 root root 6813 47946 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-cast.html 0644 root root 6953 2178 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-class.html 0644 root root 12659 61309 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-collation.html 0644 root root 5895 46581 1347419718 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-constraint.html 0644 root root 11574 61380 1347419718 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-conversion.html 0644 root root 4428 55363 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-database.html 0644 root root 7025 53443 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-db-role-setting.html 0644 root root 4066 35795 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-default-acl.html 0644 root root 5221 57099 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-depend.html 0644 root root 8633 53056 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-description.html 0644 root root 4476 65077 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-enum.html 0644 root root 4714 26295 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-extension.html 0644 root root 5280 60841 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-foreign-data-wrapper.html 0644 root root 4943 34151 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-foreign-server.html 0644 root root 4686 12983 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-foreign-table.html 0644 root root 4034 31619 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-index.html 0644 root root 8783 56030 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-inherits.html 0644 root root 3886 17136 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-language.html 0644 root root 5950 42266 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-largeobject-metadata.html 0644 root root 3628 64076 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-largeobject.html 0644 root root 5152 56700 1347419718 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-namespace.html 0644 root root 3749 7979 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-opclass.html 0644 root root 5861 39228 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-operator.html 0644 root root 6643 16823 1347419718 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-opfamily.html 0644 root root 4809 27571 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-pltemplate.html 0644 root root 5362 4885 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-proc.html 0644 root root 13401 7268 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-range.html 0644 root root 5180 49192 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-rewrite.html 0644 root root 5391 52125 1347419718 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-seclabel.html 0644 root root 4513 873 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-shdepend.html 0644 root root 7041 63424 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-shdescription.html 0644 root root 4245 50284 1347419718 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-shseclabel.html 0644 root root 4402 61922 1347419718 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-statistic.html 0644 root root 9487 61999 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-tablespace.html 0644 root root 4156 37978 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-trigger.html 0644 root root 8285 19924 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-ts-config-map.html 0644 root root 4191 42147 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-ts-config.html 0644 root root 4479 490 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-ts-dict.html 0644 root root 4714 20646 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-ts-parser.html 0644 root root 5080 41813 1347419718 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-ts-template.html 0644 root root 4256 47689 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-type.html 0644 root root 19903 10119 1347419718 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-user-mapping.html 0644 root root 3845 14862 1347419718 1 f none /usr/local/share/doc/postgresql/html/catalogs-overview.html 0644 root root 10429 7457 1347419718 1 f none /usr/local/share/doc/postgresql/html/catalogs.html 0644 root root 10385 47073 1347419719 1 f none /usr/local/share/doc/postgresql/html/charset.html 0644 root root 4160 42323 1347419719 1 f none /usr/local/share/doc/postgresql/html/chkpass.html 0644 root root 4389 6520 1347419719 1 f none /usr/local/share/doc/postgresql/html/citext.html 0644 root root 11067 51544 1347419719 1 f none /usr/local/share/doc/postgresql/html/client-authentication-problems.html 0644 root root 4222 61941 1347419718 1 f none /usr/local/share/doc/postgresql/html/client-authentication.html 0644 root root 5912 62842 1347419718 1 f none /usr/local/share/doc/postgresql/html/client-interfaces.html 0644 root root 13715 56270 1347419718 1 f none /usr/local/share/doc/postgresql/html/collation.html 0644 root root 14220 13137 1347419719 1 f none /usr/local/share/doc/postgresql/html/config-setting.html 0644 root root 11144 21158 1347419719 1 f none /usr/local/share/doc/postgresql/html/connect-estab.html 0644 root root 4313 780 1347419719 1 f none /usr/local/share/doc/postgresql/html/continuous-archiving.html 0644 root root 49828 27905 1347419719 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-build-sql-delete.html 0644 root root 5449 9666 1347419719 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-build-sql-insert.html 0644 root root 6050 57453 1347419719 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-build-sql-update.html 0644 root root 6279 8843 1347419719 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-cancel-query.html 0644 root root 3817 18926 1347419719 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-close.html 0644 root root 4647 12124 1347419719 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-connect-u.html 0644 root root 4480 17507 1347419719 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-connect.html 0644 root root 7322 30195 1347419719 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-disconnect.html 0644 root root 3715 7521 1347419718 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-error-message.html 0644 root root 3505 59507 1347419719 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-exec.html 0644 root root 5463 11085 1347419719 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-fetch.html 0644 root root 5976 56717 1347419718 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-function.html 0644 root root 8627 10270 1347419719 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-get-connections.html 0644 root root 3204 37625 1347419719 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-get-notify.html 0644 root root 4165 43401 1347419718 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-get-pkey.html 0644 root root 4496 3375 1347419719 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-get-result.html 0644 root root 6956 614 1347419719 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-is-busy.html 0644 root root 3487 55869 1347419719 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-open.html 0644 root root 5461 7861 1347419719 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-send-query.html 0644 root root 4167 45398 1347419719 1 f none /usr/local/share/doc/postgresql/html/contrib-prog-client.html 0644 root root 3432 57231 1347419719 1 f none /usr/local/share/doc/postgresql/html/contrib-prog-server.html 0644 root root 3835 24165 1347419718 1 f none /usr/local/share/doc/postgresql/html/contrib-prog.html 0644 root root 3318 49965 1347419718 1 f none /usr/local/share/doc/postgresql/html/contrib-spi.html 0644 root root 11234 40034 1347419719 1 f none /usr/local/share/doc/postgresql/html/contrib.html 0644 root root 8902 27116 1347419718 1 f none /usr/local/share/doc/postgresql/html/creating-cluster.html 0644 root root 10596 51326 1347419719 1 f none /usr/local/share/doc/postgresql/html/cube.html 0644 root root 15939 63423 1347419719 1 f none /usr/local/share/doc/postgresql/html/database-roles.html 0644 root root 6090 18532 1347419719 1 f none /usr/local/share/doc/postgresql/html/datatype-binary.html 0644 root root 12891 8592 1347419719 1 f none /usr/local/share/doc/postgresql/html/datatype-bit.html 0644 root root 5094 46557 1347419719 1 f none /usr/local/share/doc/postgresql/html/datatype-boolean.html 0644 root root 5265 37817 1347419719 1 f none /usr/local/share/doc/postgresql/html/datatype-character.html 0644 root root 11891 47501 1347419719 1 f none /usr/local/share/doc/postgresql/html/datatype-datetime.html 0644 root root 49768 36313 1347419718 1 f none /usr/local/share/doc/postgresql/html/datatype-enum.html 0644 root root 6431 26182 1347419718 1 f none /usr/local/share/doc/postgresql/html/datatype-geometric.html 0644 root root 12501 8577 1347419718 1 f none /usr/local/share/doc/postgresql/html/datatype-json.html 0644 root root 3437 58197 1347419719 1 f none /usr/local/share/doc/postgresql/html/datatype-money.html 0644 root root 5050 51908 1347419718 1 f none /usr/local/share/doc/postgresql/html/datatype-net-types.html 0644 root root 10421 18397 1347419719 1 f none /usr/local/share/doc/postgresql/html/datatype-numeric.html 0644 root root 21774 26175 1347419719 1 f none /usr/local/share/doc/postgresql/html/datatype-oid.html 0644 root root 9684 21941 1347419719 1 f none /usr/local/share/doc/postgresql/html/datatype-pseudo.html 0644 root root 7283 32210 1347419719 1 f none /usr/local/share/doc/postgresql/html/datatype-textsearch.html 0644 root root 10031 20419 1347419719 1 f none /usr/local/share/doc/postgresql/html/datatype-uuid.html 0644 root root 4558 22456 1347419718 1 f none /usr/local/share/doc/postgresql/html/datatype-xml.html 0644 root root 11332 31454 1347419719 1 f none /usr/local/share/doc/postgresql/html/datatype.html 0644 root root 16481 14858 1347419719 1 f none /usr/local/share/doc/postgresql/html/datetime-appendix.html 0644 root root 3523 5135 1347419719 1 f none /usr/local/share/doc/postgresql/html/datetime-config-files.html 0644 root root 7705 8230 1347419719 1 f none /usr/local/share/doc/postgresql/html/datetime-input-rules.html 0644 root root 6761 27690 1347419719 1 f none /usr/local/share/doc/postgresql/html/datetime-keywords.html 0644 root root 5094 32747 1347419718 1 f none /usr/local/share/doc/postgresql/html/datetime-units-history.html 0644 root root 7632 10430 1347419719 1 f none /usr/local/share/doc/postgresql/html/dblink.html 0644 root root 5320 31223 1347419718 1 f none /usr/local/share/doc/postgresql/html/ddl-alter.html 0644 root root 10412 18193 1347419718 1 f none /usr/local/share/doc/postgresql/html/ddl-basics.html 0644 root root 7814 36594 1347419719 1 f none /usr/local/share/doc/postgresql/html/ddl-constraints.html 0644 root root 22383 25109 1347419719 1 f none /usr/local/share/doc/postgresql/html/ddl-default.html 0644 root root 4538 15232 1347419719 1 f none /usr/local/share/doc/postgresql/html/ddl-depend.html 0644 root root 5247 8571 1347419719 1 f none /usr/local/share/doc/postgresql/html/ddl-foreign-data.html 0644 root root 4483 18410 1347419719 1 f none /usr/local/share/doc/postgresql/html/ddl-inherit.html 0644 root root 15171 12329 1347419718 1 f none /usr/local/share/doc/postgresql/html/ddl-others.html 0644 root root 3078 29115 1347419719 1 f none /usr/local/share/doc/postgresql/html/ddl-partitioning.html 0644 root root 27761 62472 1347419718 1 f none /usr/local/share/doc/postgresql/html/ddl-priv.html 0644 root root 6064 3345 1347419718 1 f none /usr/local/share/doc/postgresql/html/ddl-schemas.html 0644 root root 18044 50485 1347419719 1 f none /usr/local/share/doc/postgresql/html/ddl-system-columns.html 0644 root root 8047 31236 1347419719 1 f none /usr/local/share/doc/postgresql/html/ddl.html 0644 root root 6222 3598 1347419719 1 f none /usr/local/share/doc/postgresql/html/dict-int.html 0644 root root 4791 33919 1347419719 1 f none /usr/local/share/doc/postgresql/html/dict-xsyn.html 0644 root root 6479 24063 1347419719 1 f none /usr/local/share/doc/postgresql/html/different-replication-solutions.html 0644 root root 14790 58665 1347419718 1 f none /usr/local/share/doc/postgresql/html/disk-full.html 0644 root root 3515 5910 1347419719 1 f none /usr/local/share/doc/postgresql/html/disk-usage.html 0644 root root 5659 30483 1347419719 1 f none /usr/local/share/doc/postgresql/html/diskusage.html 0644 root root 2666 60845 1347419718 1 f none /usr/local/share/doc/postgresql/html/dml-delete.html 0644 root root 3467 63548 1347419719 1 f none /usr/local/share/doc/postgresql/html/dml-insert.html 0644 root root 5367 15740 1347419718 1 f none /usr/local/share/doc/postgresql/html/dml-update.html 0644 root root 5554 34625 1347419719 1 f none /usr/local/share/doc/postgresql/html/dml.html 0644 root root 2858 12169 1347419719 1 f none /usr/local/share/doc/postgresql/html/docguide-authoring.html 0644 root root 6755 53625 1347419719 1 f none /usr/local/share/doc/postgresql/html/docguide-build.html 0644 root root 15797 50481 1347419719 1 f none /usr/local/share/doc/postgresql/html/docguide-docbook.html 0644 root root 3851 31764 1347419719 1 f none /usr/local/share/doc/postgresql/html/docguide-style.html 0644 root root 7427 54569 1347419718 1 f none /usr/local/share/doc/postgresql/html/docguide-toolsets.html 0644 root root 20670 50370 1347419719 1 f none /usr/local/share/doc/postgresql/html/docguide.html 0644 root root 3622 3070 1347419718 1 f none /usr/local/share/doc/postgresql/html/dummy-seclabel.html 0644 root root 4356 62424 1347419719 1 f none /usr/local/share/doc/postgresql/html/dynamic-trace.html 0644 root root 27232 22052 1347419719 1 f none /usr/local/share/doc/postgresql/html/earthdistance.html 0644 root root 8808 20292 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-commands.html 0644 root root 9525 46434 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-concept.html 0644 root root 4977 51238 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-connect.html 0644 root root 10874 26161 1347419718 1 f none /usr/local/share/doc/postgresql/html/ecpg-cpp.html 0644 root root 9623 4026 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-descriptors.html 0644 root root 34904 61899 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-develop.html 0644 root root 7962 2461 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-dynamic.html 0644 root root 6513 22690 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-errors.html 0644 root root 25735 3805 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-informix-compat.html 0644 root root 52757 50983 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-library.html 0644 root root 5796 37521 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-lo.html 0644 root root 5525 6736 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-pgtypes.html 0644 root root 54455 61511 1347419718 1 f none /usr/local/share/doc/postgresql/html/ecpg-preproc.html 0644 root root 8983 59454 1347419718 1 f none /usr/local/share/doc/postgresql/html/ecpg-process.html 0644 root root 5384 15551 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-allocate-descriptor.html 0644 root root 3981 19073 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-commands.html 0644 root root 4696 28092 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-connect.html 0644 root root 9383 22336 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-deallocate-descriptor.html 0644 root root 3771 1260 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-declare.html 0644 root root 5395 56651 1347419718 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-describe.html 0644 root root 4593 62165 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-disconnect.html 0644 root root 4731 2607 1347419718 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-execute-immediate.html 0644 root root 3875 11383 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-get-descriptor.html 0644 root root 7707 36308 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-open.html 0644 root root 4640 506 1347419718 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-prepare.html 0644 root root 4175 32331 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-set-autocommit.html 0644 root root 3331 42661 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-set-connection.html 0644 root root 3927 13044 1347419718 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-set-descriptor.html 0644 root root 5503 64400 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-type.html 0644 root root 5024 23620 1347419718 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-var.html 0644 root root 3496 45517 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-whenever.html 0644 root root 4684 6135 1347419718 1 f none /usr/local/share/doc/postgresql/html/ecpg-variables.html 0644 root root 40692 13486 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg.html 0644 root root 10342 56555 1347419719 1 f none /usr/local/share/doc/postgresql/html/encryption-options.html 0644 root root 7493 14418 1347419718 1 f none /usr/local/share/doc/postgresql/html/errcodes-appendix.html 0644 root root 36962 54129 1347419718 1 f none /usr/local/share/doc/postgresql/html/error-message-reporting.html 0644 root root 14122 51893 1347419718 1 f none /usr/local/share/doc/postgresql/html/error-style-guide.html 0644 root root 16767 16343 1347419718 1 f none /usr/local/share/doc/postgresql/html/event-log-registration.html 0644 root root 4186 46312 1347419719 1 f none /usr/local/share/doc/postgresql/html/executor.html 0644 root root 6610 59293 1347419718 1 f none /usr/local/share/doc/postgresql/html/explicit-joins.html 0644 root root 11017 34463 1347419719 1 f none /usr/local/share/doc/postgresql/html/explicit-locking.html 0644 root root 25071 7541 1347419718 1 f none /usr/local/share/doc/postgresql/html/extend-extensions.html 0644 root root 30976 29531 1347419719 1 f none /usr/local/share/doc/postgresql/html/extend-how.html 0644 root root 4550 19370 1347419719 1 f none /usr/local/share/doc/postgresql/html/extend-pgxs.html 0644 root root 11759 16607 1347419719 1 f none /usr/local/share/doc/postgresql/html/extend-type-system.html 0644 root root 10091 8272 1347419719 1 f none /usr/local/share/doc/postgresql/html/extend.html 0644 root root 9962 9826 1347419719 1 f none /usr/local/share/doc/postgresql/html/external-admin-tools.html 0644 root root 2720 3004 1347419718 1 f none /usr/local/share/doc/postgresql/html/external-extensions.html 0644 root root 3265 48261 1347419718 1 f none /usr/local/share/doc/postgresql/html/external-interfaces.html 0644 root root 5034 49972 1347419718 1 f none /usr/local/share/doc/postgresql/html/external-pl.html 0644 root root 4684 27128 1347419719 1 f none /usr/local/share/doc/postgresql/html/external-projects.html 0644 root root 3002 23635 1347419719 1 f none /usr/local/share/doc/postgresql/html/fdw-callbacks.html 0644 root root 12903 27799 1347419718 1 f none /usr/local/share/doc/postgresql/html/fdw-functions.html 0644 root root 4494 19533 1347419719 1 f none /usr/local/share/doc/postgresql/html/fdw-helpers.html 0644 root root 5991 4452 1347419719 1 f none /usr/local/share/doc/postgresql/html/fdw-planning.html 0644 root root 9778 47332 1347419719 1 f none /usr/local/share/doc/postgresql/html/fdwhandler.html 0644 root root 3988 41385 1347419718 1 f none /usr/local/share/doc/postgresql/html/features-sql-standard.html 0644 root root 39103 14481 1347419719 1 f none /usr/local/share/doc/postgresql/html/features.html 0644 root root 7564 9625 1347419718 1 f none /usr/local/share/doc/postgresql/html/file-fdw.html 0644 root root 7712 58087 1347419719 1 f none /usr/local/share/doc/postgresql/html/functions-admin.html 0644 root root 49493 36162 1347419718 1 f none /usr/local/share/doc/postgresql/html/functions-aggregate.html 0644 root root 21859 13759 1347419719 1 f none /usr/local/share/doc/postgresql/html/functions-array.html 0644 root root 13519 45754 1347419718 1 f none /usr/local/share/doc/postgresql/html/functions-binarystring.html 0644 root root 12398 12560 1347419719 1 f none /usr/local/share/doc/postgresql/html/functions-bitstring.html 0644 root root 6784 22860 1347419718 1 f none /usr/local/share/doc/postgresql/html/functions-comparison.html 0644 root root 10613 57307 1347419719 1 f none /usr/local/share/doc/postgresql/html/functions-comparisons.html 0644 root root 13529 58586 1347419718 1 f none /usr/local/share/doc/postgresql/html/functions-conditional.html 0644 root root 10304 32310 1347419719 1 f none /usr/local/share/doc/postgresql/html/functions-datetime.html 0644 root root 47937 53236 1347419719 1 f none /usr/local/share/doc/postgresql/html/functions-enum.html 0644 root root 5489 20297 1347419719 1 f none /usr/local/share/doc/postgresql/html/functions-formatting.html 0644 root root 32857 32734 1347419719 1 f none /usr/local/share/doc/postgresql/html/functions-geometry.html 0644 root root 20333 63933 1347419718 1 f none /usr/local/share/doc/postgresql/html/functions-info.html 0644 root root 56697 53931 1347419718 1 f none /usr/local/share/doc/postgresql/html/functions-json.html 0644 root root 3812 13080 1347419719 1 f none /usr/local/share/doc/postgresql/html/functions-logical.html 0644 root root 4663 60054 1347419718 1 f none /usr/local/share/doc/postgresql/html/functions-matching.html 0644 root root 72431 51062 1347419719 1 f none /usr/local/share/doc/postgresql/html/functions-math.html 0644 root root 19762 13875 1347419718 1 f none /usr/local/share/doc/postgresql/html/functions-net.html 0644 root root 13500 9178 1347419719 1 f none /usr/local/share/doc/postgresql/html/functions-range.html 0644 root root 10855 35465 1347419719 1 f none /usr/local/share/doc/postgresql/html/functions-sequence.html 0644 root root 12974 6610 1347419719 1 f none /usr/local/share/doc/postgresql/html/functions-srf.html 0644 root root 8838 42184 1347419719 1 f none /usr/local/share/doc/postgresql/html/functions-string.html 0644 root root 58886 5516 1347419719 1 f none /usr/local/share/doc/postgresql/html/functions-subquery.html 0644 root root 16379 38152 1347419719 1 f none /usr/local/share/doc/postgresql/html/functions-textsearch.html 0644 root root 20486 54268 1347419719 1 f none /usr/local/share/doc/postgresql/html/functions-trigger.html 0644 root root 4546 26651 1347419718 1 f none /usr/local/share/doc/postgresql/html/functions-window.html 0644 root root 11863 2448 1347419719 1 f none /usr/local/share/doc/postgresql/html/functions-xml.html 0644 root root 32167 12340 1347419719 1 f none /usr/local/share/doc/postgresql/html/functions.html 0644 root root 9937 28693 1347419718 1 f none /usr/local/share/doc/postgresql/html/fuzzystrmatch.html 0644 root root 8059 30085 1347419719 1 f none /usr/local/share/doc/postgresql/html/geqo-biblio.html 0644 root root 3457 56106 1347419719 1 f none /usr/local/share/doc/postgresql/html/geqo-intro.html 0644 root root 4413 13599 1347419719 1 f none /usr/local/share/doc/postgresql/html/geqo-intro2.html 0644 root root 5625 11761 1347419718 1 f none /usr/local/share/doc/postgresql/html/geqo-pg-intro.html 0644 root root 8783 33494 1347419718 1 f none /usr/local/share/doc/postgresql/html/geqo.html 0644 root root 3614 2769 1347419719 1 f none /usr/local/share/doc/postgresql/html/gin-examples.html 0644 root root 3320 44018 1347419719 1 f none /usr/local/share/doc/postgresql/html/gin-extensibility.html 0644 root root 14400 5995 1347419718 1 f none /usr/local/share/doc/postgresql/html/gin-implementation.html 0644 root root 6562 57976 1347419719 1 f none /usr/local/share/doc/postgresql/html/gin-intro.html 0644 root root 4660 30600 1347419719 1 f none /usr/local/share/doc/postgresql/html/gin-limit.html 0644 root root 2815 9420 1347419719 1 f none /usr/local/share/doc/postgresql/html/gin-tips.html 0644 root root 5711 46617 1347419719 1 f none /usr/local/share/doc/postgresql/html/gin.html 0644 root root 2927 13426 1347419718 1 f none /usr/local/share/doc/postgresql/html/gist-examples.html 0644 root root 3750 13009 1347419719 1 f none /usr/local/share/doc/postgresql/html/gist-extensibility.html 0644 root root 24352 48602 1347419719 1 f none /usr/local/share/doc/postgresql/html/gist-implementation.html 0644 root root 4099 56141 1347419719 1 f none /usr/local/share/doc/postgresql/html/gist-intro.html 0644 root root 3614 10519 1347419718 1 f none /usr/local/share/doc/postgresql/html/gist.html 0644 root root 2677 62929 1347419719 1 f none /usr/local/share/doc/postgresql/html/git.html 0644 root root 4560 16401 1347419719 1 f none /usr/local/share/doc/postgresql/html/high-availability.html 0644 root root 7805 41316 1347419718 1 f none /usr/local/share/doc/postgresql/html/history.html 0644 root root 11916 57230 1347419719 1 f none /usr/local/share/doc/postgresql/html/hot-standby.html 0644 root root 36067 40101 1347419718 1 f none /usr/local/share/doc/postgresql/html/hstore.html 0644 root root 22627 59773 1347419718 1 f none /usr/local/share/doc/postgresql/html/index-catalog.html 0644 root root 7994 50917 1347419719 1 f none /usr/local/share/doc/postgresql/html/index-cost-estimation.html 0644 root root 9989 3066 1347419718 1 f none /usr/local/share/doc/postgresql/html/index-functions.html 0644 root root 19112 24480 1347419718 1 f none /usr/local/share/doc/postgresql/html/index-locking.html 0644 root root 8047 59264 1347419718 1 f none /usr/local/share/doc/postgresql/html/index-scanning.html 0644 root root 10705 13228 1347419719 1 f none /usr/local/share/doc/postgresql/html/index-unique-checks.html 0644 root root 9190 19093 1347419719 1 f none /usr/local/share/doc/postgresql/html/index.html 0644 root root 8069 9966 1347419718 1 f none /usr/local/share/doc/postgresql/html/indexam.html 0644 root root 5245 18834 1347419719 1 f none /usr/local/share/doc/postgresql/html/indexes-bitmap-scans.html 0644 root root 6578 63228 1347419719 1 f none /usr/local/share/doc/postgresql/html/indexes-collations.html 0644 root root 3638 10565 1347419719 1 f none /usr/local/share/doc/postgresql/html/indexes-examine.html 0644 root root 7159 45831 1347419718 1 f none /usr/local/share/doc/postgresql/html/indexes-expressional.html 0644 root root 4811 45369 1347419718 1 f none /usr/local/share/doc/postgresql/html/indexes-intro.html 0644 root root 6311 36733 1347419719 1 f none /usr/local/share/doc/postgresql/html/indexes-multicolumn.html 0644 root root 6296 36601 1347419719 1 f none /usr/local/share/doc/postgresql/html/indexes-opclass.html 0644 root root 7334 45520 1347419719 1 f none /usr/local/share/doc/postgresql/html/indexes-ordering.html 0644 root root 6478 42167 1347419719 1 f none /usr/local/share/doc/postgresql/html/indexes-partial.html 0644 root root 11810 33444 1347419719 1 f none /usr/local/share/doc/postgresql/html/indexes-types.html 0644 root root 10075 41424 1347419719 1 f none /usr/local/share/doc/postgresql/html/indexes-unique.html 0644 root root 4000 42738 1347419719 1 f none /usr/local/share/doc/postgresql/html/indexes.html 0644 root root 3617 5642 1347419719 1 f none /usr/local/share/doc/postgresql/html/information-schema.html 0644 root root 11175 8620 1347419718 1 f none /usr/local/share/doc/postgresql/html/infoschema-administrable-role-authorizations.html 0644 root root 3749 15714 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-applicable-roles.html 0644 root root 3968 32621 1347419718 1 f none /usr/local/share/doc/postgresql/html/infoschema-attributes.html 0644 root root 12805 57623 1347419718 1 f none /usr/local/share/doc/postgresql/html/infoschema-character-sets.html 0644 root root 7048 12874 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-check-constraint-routine-usage.html 0644 root root 4347 62462 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-check-constraints.html 0644 root root 3874 26607 1347419718 1 f none /usr/local/share/doc/postgresql/html/infoschema-collation-character-set-applicab.html 0644 root root 4423 5684 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-collations.html 0644 root root 3883 24865 1347419718 1 f none /usr/local/share/doc/postgresql/html/infoschema-column-domain-usage.html 0644 root root 4320 59814 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-column-options.html 0644 root root 4107 42303 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-column-privileges.html 0644 root root 5027 42711 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-column-udt-usage.html 0644 root root 4581 10125 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-columns.html 0644 root root 17623 36921 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-constraint-column-usage.html 0644 root root 4871 39769 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-constraint-table-usage.html 0644 root root 4772 35319 1347419718 1 f none /usr/local/share/doc/postgresql/html/infoschema-data-type-privileges.html 0644 root root 5087 61687 1347419718 1 f none /usr/local/share/doc/postgresql/html/infoschema-datatypes.html 0644 root root 4227 55379 1347419718 1 f none /usr/local/share/doc/postgresql/html/infoschema-domain-constraints.html 0644 root root 4662 19431 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-domain-udt-usage.html 0644 root root 4169 45635 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-domains.html 0644 root root 11365 11653 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-element-types.html 0644 root root 11372 12813 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-enabled-roles.html 0644 root root 3778 20722 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-foreign-data-wrapper-options.html 0644 root root 3908 29633 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-foreign-data-wrappers.html 0644 root root 4225 58014 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-foreign-server-options.html 0644 root root 3851 24815 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-foreign-servers.html 0644 root root 4569 18820 1347419718 1 f none /usr/local/share/doc/postgresql/html/infoschema-foreign-table-options.html 0644 root root 4345 61703 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-foreign-tables.html 0644 root root 4070 41660 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-information-schema-catalog-name.html 0644 root root 3355 53876 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-key-column-usage.html 0644 root root 5183 60818 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-parameters.html 0644 root root 10797 30414 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-referential-constraints.html 0644 root root 5662 22898 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-role-column-grants.html 0644 root root 5015 45521 1347419718 1 f none /usr/local/share/doc/postgresql/html/infoschema-role-routine-grants.html 0644 root root 5358 8199 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-role-table-grants.html 0644 root root 5425 4616 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-role-udt-grants.html 0644 root root 4779 27252 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-role-usage-grants.html 0644 root root 5008 41909 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-routine-privileges.html 0644 root root 5030 45839 1347419718 1 f none /usr/local/share/doc/postgresql/html/infoschema-routines.html 0644 root root 23050 34943 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-schema.html 0644 root root 3178 44529 1347419718 1 f none /usr/local/share/doc/postgresql/html/infoschema-schemata.html 0644 root root 4246 47900 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-sequences.html 0644 root root 6109 60560 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-sql-features.html 0644 root root 4706 22139 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-sql-implementation-info.html 0644 root root 4501 11723 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-sql-languages.html 0644 root root 5092 47020 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-sql-packages.html 0644 root root 4176 43129 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-sql-parts.html 0644 root root 4078 34192 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-sql-sizing-profiles.html 0644 root root 4175 47302 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-sql-sizing.html 0644 root root 4099 43401 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-table-constraints.html 0644 root root 4912 33315 1347419718 1 f none /usr/local/share/doc/postgresql/html/infoschema-table-privileges.html 0644 root root 5095 41865 1347419718 1 f none /usr/local/share/doc/postgresql/html/infoschema-tables.html 0644 root root 5955 46037 1347419718 1 f none /usr/local/share/doc/postgresql/html/infoschema-triggered-update-columns.html 0644 root root 4552 10443 1347419718 1 f none /usr/local/share/doc/postgresql/html/infoschema-triggers.html 0644 root root 9445 58764 1347419718 1 f none /usr/local/share/doc/postgresql/html/infoschema-udt-privileges.html 0644 root root 4509 4659 1347419718 1 f none /usr/local/share/doc/postgresql/html/infoschema-usage-privileges.html 0644 root root 5510 16156 1347419718 1 f none /usr/local/share/doc/postgresql/html/infoschema-user-defined-types.html 0644 root root 9751 12358 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-user-mapping-options.html 0644 root root 4447 6842 1347419718 1 f none /usr/local/share/doc/postgresql/html/infoschema-user-mappings.html 0644 root root 3831 23756 1347419718 1 f none /usr/local/share/doc/postgresql/html/infoschema-view-column-usage.html 0644 root root 4726 22243 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-view-routine-usage.html 0644 root root 4366 61771 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-view-table-usage.html 0644 root root 4387 58862 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-views.html 0644 root root 5527 3259 1347419719 1 f none /usr/local/share/doc/postgresql/html/install-getsource.html 0644 root root 3473 64928 1347419719 1 f none /usr/local/share/doc/postgresql/html/install-post.html 0644 root root 8068 20979 1347419719 1 f none /usr/local/share/doc/postgresql/html/install-procedure.html 0644 root root 45024 63785 1347419719 1 f none /usr/local/share/doc/postgresql/html/install-requirements.html 0644 root root 14392 39522 1347419718 1 f none /usr/local/share/doc/postgresql/html/install-short.html 0644 root root 2868 18122 1347419719 1 f none /usr/local/share/doc/postgresql/html/install-windows-full.html 0644 root root 18981 34755 1347419719 1 f none /usr/local/share/doc/postgresql/html/install-windows-libpq.html 0644 root root 6281 13266 1347419719 1 f none /usr/local/share/doc/postgresql/html/install-windows.html 0644 root root 6620 46278 1347419719 1 f none /usr/local/share/doc/postgresql/html/installation-platform-notes.html 0644 root root 39366 53400 1347419718 1 f none /usr/local/share/doc/postgresql/html/installation.html 0644 root root 4158 46609 1347419718 1 f none /usr/local/share/doc/postgresql/html/intagg.html 0644 root root 6252 22527 1347419719 1 f none /usr/local/share/doc/postgresql/html/intarray.html 0644 root root 13751 34439 1347419719 1 f none /usr/local/share/doc/postgresql/html/internals.html 0644 root root 15544 34175 1347419719 1 f none /usr/local/share/doc/postgresql/html/intro-whatis.html 0644 root root 4009 32997 1347419719 1 f none /usr/local/share/doc/postgresql/html/isn.html 0644 root root 13354 22377 1347419719 1 f none /usr/local/share/doc/postgresql/html/kernel-resources.html 0644 root root 37936 61251 1347419718 1 f none /usr/local/share/doc/postgresql/html/largeobjects.html 0644 root root 4673 22851 1347419719 1 f none /usr/local/share/doc/postgresql/html/libpq-async.html 0644 root root 20513 50045 1347419719 1 f none /usr/local/share/doc/postgresql/html/libpq-build.html 0644 root root 6367 22860 1347419718 1 f none /usr/local/share/doc/postgresql/html/libpq-cancel.html 0644 root root 6775 44727 1347419719 1 f none /usr/local/share/doc/postgresql/html/libpq-connect.html 0644 root root 51022 1143 1347419719 1 f none /usr/local/share/doc/postgresql/html/libpq-control.html 0644 root root 6278 8328 1347419719 1 f none /usr/local/share/doc/postgresql/html/libpq-copy.html 0644 root root 22440 60308 1347419718 1 f none /usr/local/share/doc/postgresql/html/libpq-envars.html 0644 root root 10176 25815 1347419719 1 f none /usr/local/share/doc/postgresql/html/libpq-events.html 0644 root root 23091 39346 1347419719 1 f none /usr/local/share/doc/postgresql/html/libpq-example.html 0644 root root 16022 59905 1347419719 1 f none /usr/local/share/doc/postgresql/html/libpq-exec.html 0644 root root 64802 23972 1347419719 1 f none /usr/local/share/doc/postgresql/html/libpq-fastpath.html 0644 root root 5654 39060 1347419719 1 f none /usr/local/share/doc/postgresql/html/libpq-ldap.html 0644 root root 5504 28999 1347419718 1 f none /usr/local/share/doc/postgresql/html/libpq-misc.html 0644 root root 13813 3094 1347419718 1 f none /usr/local/share/doc/postgresql/html/libpq-notice-processing.html 0644 root root 6282 36285 1347419718 1 f none /usr/local/share/doc/postgresql/html/libpq-notify.html 0644 root root 6713 54290 1347419719 1 f none /usr/local/share/doc/postgresql/html/libpq-pgpass.html 0644 root root 4859 42499 1347419719 1 f none /usr/local/share/doc/postgresql/html/libpq-pgservice.html 0644 root root 3882 31953 1347419719 1 f none /usr/local/share/doc/postgresql/html/libpq-single-row-mode.html 0644 root root 6351 28724 1347419718 1 f none /usr/local/share/doc/postgresql/html/libpq-ssl.html 0644 root root 19969 48565 1347419719 1 f none /usr/local/share/doc/postgresql/html/libpq-status.html 0644 root root 17693 21816 1347419719 1 f none /usr/local/share/doc/postgresql/html/libpq-threading.html 0644 root root 5542 27026 1347419719 1 f none /usr/local/share/doc/postgresql/html/libpq.html 0644 root root 7916 4769 1347419718 1 f none /usr/local/share/doc/postgresql/html/lo-examplesect.html 0644 root root 8694 29565 1347419718 1 f none /usr/local/share/doc/postgresql/html/lo-funcs.html 0644 root root 4219 57571 1347419719 1 f none /usr/local/share/doc/postgresql/html/lo-implementation.html 0644 root root 3351 52804 1347419718 1 f none /usr/local/share/doc/postgresql/html/lo-interfaces.html 0644 root root 15153 27811 1347419719 1 f none /usr/local/share/doc/postgresql/html/lo-intro.html 0644 root root 3204 41975 1347419719 1 f none /usr/local/share/doc/postgresql/html/lo.html 0644 root root 6625 45931 1347419718 1 f none /usr/local/share/doc/postgresql/html/locale.html 0644 root root 13689 24185 1347419718 1 f none /usr/local/share/doc/postgresql/html/locking-indexes.html 0644 root root 4495 17132 1347419719 1 f none /usr/local/share/doc/postgresql/html/log-shipping-alternative.html 0644 root root 11055 39202 1347419719 1 f none /usr/local/share/doc/postgresql/html/logfile-maintenance.html 0644 root root 7144 36285 1347419718 1 f none /usr/local/share/doc/postgresql/html/ltree.html 0644 root root 27293 8462 1347419719 1 f none /usr/local/share/doc/postgresql/html/maintenance.html 0644 root root 5539 35988 1347419719 1 f none /usr/local/share/doc/postgresql/html/manage-ag-config.html 0644 root root 3744 20458 1347419718 1 f none /usr/local/share/doc/postgresql/html/manage-ag-createdb.html 0644 root root 6308 22091 1347419719 1 f none /usr/local/share/doc/postgresql/html/manage-ag-dropdb.html 0644 root root 3603 5981 1347419719 1 f none /usr/local/share/doc/postgresql/html/manage-ag-overview.html 0644 root root 5142 4927 1347419718 1 f none /usr/local/share/doc/postgresql/html/manage-ag-tablespaces.html 0644 root root 9156 14126 1347419718 1 f none /usr/local/share/doc/postgresql/html/manage-ag-templatedbs.html 0644 root root 8160 44006 1347419719 1 f none /usr/local/share/doc/postgresql/html/managing-databases.html 0644 root root 3271 44618 1347419719 1 f none /usr/local/share/doc/postgresql/html/monitoring-locks.html 0644 root root 3671 14216 1347419718 1 f none /usr/local/share/doc/postgresql/html/monitoring-ps.html 0644 root root 6780 61275 1347419719 1 f none /usr/local/share/doc/postgresql/html/monitoring-stats.html 0644 root root 58061 37060 1347419718 1 f none /usr/local/share/doc/postgresql/html/monitoring.html 0644 root root 4456 6630 1347419719 1 f none /usr/local/share/doc/postgresql/html/multibyte.html 0644 root root 32225 45488 1347419719 1 f none /usr/local/share/doc/postgresql/html/mvcc-intro.html 0644 root root 4550 26454 1347419719 1 f none /usr/local/share/doc/postgresql/html/mvcc.html 0644 root root 4242 55528 1347419719 1 f none /usr/local/share/doc/postgresql/html/nls-programmer.html 0644 root root 10076 47254 1347419719 1 f none /usr/local/share/doc/postgresql/html/nls-translator.html 0644 root root 14528 41982 1347419718 1 f none /usr/local/share/doc/postgresql/html/nls.html 0644 root root 3132 30388 1347419719 1 f none /usr/local/share/doc/postgresql/html/non-durability.html 0644 root root 4483 12023 1347419718 1 f none /usr/local/share/doc/postgresql/html/notation.html 0644 root root 4413 8982 1347419718 1 f none /usr/local/share/doc/postgresql/html/oid2name.html 0644 root root 11960 8478 1347419718 1 f none /usr/local/share/doc/postgresql/html/overview.html 0644 root root 4091 44521 1347419718 1 f none /usr/local/share/doc/postgresql/html/pageinspect.html 0644 root root 8046 59655 1347419719 1 f none /usr/local/share/doc/postgresql/html/parser-stage.html 0644 root root 8115 31206 1347419719 1 f none /usr/local/share/doc/postgresql/html/passwordcheck.html 0644 root root 4786 42384 1347419719 1 f none /usr/local/share/doc/postgresql/html/performance-tips.html 0644 root root 4499 64617 1347419719 1 f none /usr/local/share/doc/postgresql/html/perm-functions.html 0644 root root 3348 59492 1347419719 1 f none /usr/local/share/doc/postgresql/html/pgarchivecleanup.html 0644 root root 9153 32166 1347419718 1 f none /usr/local/share/doc/postgresql/html/pgbench.html 0644 root root 30830 20817 1347419719 1 f none /usr/local/share/doc/postgresql/html/pgbuffercache.html 0644 root root 7633 34911 1347419719 1 f none /usr/local/share/doc/postgresql/html/pgcrypto.html 0644 root root 38487 31742 1347419719 1 f none /usr/local/share/doc/postgresql/html/pgfreespacemap.html 0644 root root 5228 53380 1347419719 1 f none /usr/local/share/doc/postgresql/html/pgrowlocks.html 0644 root root 6076 49410 1347419718 1 f none /usr/local/share/doc/postgresql/html/pgstandby.html 0644 root root 15202 38310 1347419718 1 f none /usr/local/share/doc/postgresql/html/pgstatstatements.html 0644 root root 16066 48547 1347419719 1 f none /usr/local/share/doc/postgresql/html/pgstattuple.html 0644 root root 8654 40398 1347419718 1 f none /usr/local/share/doc/postgresql/html/pgtestfsync.html 0644 root root 5252 54958 1347419718 1 f none /usr/local/share/doc/postgresql/html/pgtesttiming.html 0644 root root 12474 62936 1347419719 1 f none /usr/local/share/doc/postgresql/html/pgtrgm.html 0644 root root 12331 22245 1347419719 1 f none /usr/local/share/doc/postgresql/html/pgupgrade.html 0644 root root 24293 33768 1347419719 1 f none /usr/local/share/doc/postgresql/html/planner-optimizer.html 0644 root root 9394 33298 1347419718 1 f none /usr/local/share/doc/postgresql/html/planner-stats-details.html 0644 root root 3024 31396 1347419719 1 f none /usr/local/share/doc/postgresql/html/planner-stats.html 0644 root root 9056 20122 1347419719 1 f none /usr/local/share/doc/postgresql/html/plhandler.html 0644 root root 12836 50845 1347419719 1 f none /usr/local/share/doc/postgresql/html/plperl-builtins.html 0644 root root 18274 40619 1347419719 1 f none /usr/local/share/doc/postgresql/html/plperl-data.html 0644 root root 2876 15594 1347419719 1 f none /usr/local/share/doc/postgresql/html/plperl-funcs.html 0644 root root 13367 58177 1347419719 1 f none /usr/local/share/doc/postgresql/html/plperl-global.html 0644 root root 5065 56645 1347419719 1 f none /usr/local/share/doc/postgresql/html/plperl-triggers.html 0644 root root 6444 64627 1347419719 1 f none /usr/local/share/doc/postgresql/html/plperl-trusted.html 0644 root root 6710 62670 1347419719 1 f none /usr/local/share/doc/postgresql/html/plperl-under-the-hood.html 0644 root root 8989 39328 1347419719 1 f none /usr/local/share/doc/postgresql/html/plperl.html 0644 root root 4928 43554 1347419718 1 f none /usr/local/share/doc/postgresql/html/plpgsql-control-structures.html 0644 root root 46184 30959 1347419719 1 f none /usr/local/share/doc/postgresql/html/plpgsql-cursors.html 0644 root root 25584 59790 1347419719 1 f none /usr/local/share/doc/postgresql/html/plpgsql-declarations.html 0644 root root 21731 29608 1347419718 1 f none /usr/local/share/doc/postgresql/html/plpgsql-development-tips.html 0644 root root 9509 7499 1347419718 1 f none /usr/local/share/doc/postgresql/html/plpgsql-errors-and-messages.html 0644 root root 10092 23678 1347419718 1 f none /usr/local/share/doc/postgresql/html/plpgsql-expressions.html 0644 root root 4660 18503 1347419719 1 f none /usr/local/share/doc/postgresql/html/plpgsql-implementation.html 0644 root root 18041 49004 1347419718 1 f none /usr/local/share/doc/postgresql/html/plpgsql-overview.html 0644 root root 9030 33993 1347419718 1 f none /usr/local/share/doc/postgresql/html/plpgsql-porting.html 0644 root root 27092 22236 1347419718 1 f none /usr/local/share/doc/postgresql/html/plpgsql-statements.html 0644 root root 32219 23055 1347419719 1 f none /usr/local/share/doc/postgresql/html/plpgsql-structure.html 0644 root root 7372 31104 1347419718 1 f none /usr/local/share/doc/postgresql/html/plpgsql-trigger.html 0644 root root 22320 60092 1347419719 1 f none /usr/local/share/doc/postgresql/html/plpgsql.html 0644 root root 6963 61431 1347419719 1 f none /usr/local/share/doc/postgresql/html/plpython-data.html 0644 root root 14646 63134 1347419719 1 f none /usr/local/share/doc/postgresql/html/plpython-database.html 0644 root root 15347 4877 1347419719 1 f none /usr/local/share/doc/postgresql/html/plpython-do.html 0644 root root 2769 6934 1347419718 1 f none /usr/local/share/doc/postgresql/html/plpython-envar.html 0644 root root 3883 24959 1347419718 1 f none /usr/local/share/doc/postgresql/html/plpython-funcs.html 0644 root root 5476 24342 1347419718 1 f none /usr/local/share/doc/postgresql/html/plpython-python23.html 0644 root root 7205 40471 1347419719 1 f none /usr/local/share/doc/postgresql/html/plpython-sharing.html 0644 root root 3030 26970 1347419719 1 f none /usr/local/share/doc/postgresql/html/plpython-subtransaction.html 0644 root root 7886 32353 1347419718 1 f none /usr/local/share/doc/postgresql/html/plpython-trigger.html 0644 root root 5067 30321 1347419719 1 f none /usr/local/share/doc/postgresql/html/plpython-util.html 0644 root root 5102 54240 1347419718 1 f none /usr/local/share/doc/postgresql/html/plpython.html 0644 root root 6065 2245 1347419719 1 f none /usr/local/share/doc/postgresql/html/pltcl-data.html 0644 root root 2904 16638 1347419719 1 f none /usr/local/share/doc/postgresql/html/pltcl-dbaccess.html 0644 root root 13579 18915 1347419719 1 f none /usr/local/share/doc/postgresql/html/pltcl-functions.html 0644 root root 6175 4328 1347419719 1 f none /usr/local/share/doc/postgresql/html/pltcl-global.html 0644 root root 5064 63960 1347419719 1 f none /usr/local/share/doc/postgresql/html/pltcl-overview.html 0644 root root 5284 12177 1347419718 1 f none /usr/local/share/doc/postgresql/html/pltcl-procnames.html 0644 root root 3220 43397 1347419719 1 f none /usr/local/share/doc/postgresql/html/pltcl-trigger.html 0644 root root 8738 50578 1347419718 1 f none /usr/local/share/doc/postgresql/html/pltcl-unknown.html 0644 root root 5073 57673 1347419719 1 f none /usr/local/share/doc/postgresql/html/pltcl.html 0644 root root 3398 52290 1347419719 1 f none /usr/local/share/doc/postgresql/html/populate.html 0644 root root 17112 23059 1347419719 1 f none /usr/local/share/doc/postgresql/html/postgres-user.html 0644 root root 3312 52082 1347419718 1 f none /usr/local/share/doc/postgresql/html/preface.html 0644 root root 5065 53060 1347419719 1 f none /usr/local/share/doc/postgresql/html/preventing-server-spoofing.html 0644 root root 4598 32846 1347419719 1 f none /usr/local/share/doc/postgresql/html/protocol-changes.html 0644 root root 6648 20146 1347419719 1 f none /usr/local/share/doc/postgresql/html/protocol-error-fields.html 0644 root root 6129 5619 1347419719 1 f none /usr/local/share/doc/postgresql/html/protocol-flow.html 0644 root root 46200 36869 1347419719 1 f none /usr/local/share/doc/postgresql/html/protocol-message-formats.html 0644 root root 40842 51631 1347419719 1 f none /usr/local/share/doc/postgresql/html/protocol-message-types.html 0644 root root 4931 25761 1347419718 1 f none /usr/local/share/doc/postgresql/html/protocol-overview.html 0644 root root 9668 9077 1347419718 1 f none /usr/local/share/doc/postgresql/html/protocol-replication.html 0644 root root 14262 22077 1347419718 1 f none /usr/local/share/doc/postgresql/html/protocol.html 0644 root root 5650 38271 1347419719 1 f none /usr/local/share/doc/postgresql/html/queries-limit.html 0644 root root 5333 2072 1347419719 1 f none /usr/local/share/doc/postgresql/html/queries-order.html 0644 root root 7367 26762 1347419718 1 f none /usr/local/share/doc/postgresql/html/queries-overview.html 0644 root root 5066 56278 1347419719 1 f none /usr/local/share/doc/postgresql/html/queries-select-lists.html 0644 root root 9216 53254 1347419718 1 f none /usr/local/share/doc/postgresql/html/queries-table-expressions.html 0644 root root 36620 34313 1347419719 1 f none /usr/local/share/doc/postgresql/html/queries-union.html 0644 root root 5112 45989 1347419718 1 f none /usr/local/share/doc/postgresql/html/queries-values.html 0644 root root 4928 36021 1347419719 1 f none /usr/local/share/doc/postgresql/html/queries-with.html 0644 root root 20819 39895 1347419719 1 f none /usr/local/share/doc/postgresql/html/queries.html 0644 root root 4347 52593 1347419719 1 f none /usr/local/share/doc/postgresql/html/query-path.html 0644 root root 5468 20161 1347419718 1 f none /usr/local/share/doc/postgresql/html/querytree.html 0644 root root 11134 4033 1347419718 1 f none /usr/local/share/doc/postgresql/html/rangetypes.html 0644 root root 22687 25382 1347419719 1 f none /usr/local/share/doc/postgresql/html/recovery-config.html 0644 root root 3548 1950 1347419719 1 f none /usr/local/share/doc/postgresql/html/recovery-target-settings.html 0644 root root 7760 7853 1347419718 1 f none /usr/local/share/doc/postgresql/html/reference-client.html 0644 root root 6100 1481 1347419719 1 f none /usr/local/share/doc/postgresql/html/reference-server.html 0644 root root 3962 30986 1347419719 1 f none /usr/local/share/doc/postgresql/html/reference.html 0644 root root 23160 2318 1347419719 1 f none /usr/local/share/doc/postgresql/html/regress-coverage.html 0644 root root 3323 52205 1347419719 1 f none /usr/local/share/doc/postgresql/html/regress-evaluation.html 0644 root root 11604 11110 1347419718 1 f none /usr/local/share/doc/postgresql/html/regress-run.html 0644 root root 12226 188 1347419719 1 f none /usr/local/share/doc/postgresql/html/regress-variant.html 0644 root root 7175 41158 1347419718 1 f none /usr/local/share/doc/postgresql/html/regress.html 0644 root root 4100 38612 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-0-01.html 0644 root root 2587 51644 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-0-02.html 0644 root root 4323 61994 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-0-03.html 0644 root root 7830 33307 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-1-0.html 0644 root root 4261 60988 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-1-01.html 0644 root root 9378 20962 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-1-02.html 0644 root root 6521 40750 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-1-09.html 0644 root root 2557 48014 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-6-0.html 0644 root root 7952 2794 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-6-1-1.html 0644 root root 3751 21175 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-6-1.html 0644 root root 9059 27582 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-6-2-1.html 0644 root root 4437 7259 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-6-2.html 0644 root root 8915 5084 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-6-3-1.html 0644 root root 4476 14574 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-6-3-2.html 0644 root root 4189 54647 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-6-3.html 0644 root root 16344 40850 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-6-4-1.html 0644 root root 4093 46925 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-6-4-2.html 0644 root root 2940 8890 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-6-4.html 0644 root root 14765 5239 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-6-5-1.html 0644 root root 3874 25241 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-6-5-2.html 0644 root root 4134 48685 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-6-5-3.html 0644 root root 3085 18900 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-6-5.html 0644 root root 17419 56598 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-0-1.html 0644 root root 3952 31008 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-0-2.html 0644 root root 2919 5086 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-7-0-3.html 0644 root root 4688 30216 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-7-0.html 0644 root root 23136 25041 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-7-1-1.html 0644 root root 3294 37433 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-7-1-2.html 0644 root root 3007 13119 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-1-3.html 0644 root root 3171 27581 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-1.html 0644 root root 13049 27112 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-7-2-1.html 0644 root root 4043 31682 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-2-2.html 0644 root root 3825 11351 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-2-3.html 0644 root root 3396 44903 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-7-2-4.html 0644 root root 3619 64971 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-2-5.html 0644 root root 3778 13693 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-2-6.html 0644 root root 3656 6039 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-2-7.html 0644 root root 3758 13926 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-7-2-8.html 0644 root root 3980 30556 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-2.html 0644 root root 27130 38107 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-3-1.html 0644 root root 4200 44473 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-7-3-10.html 0644 root root 7525 63600 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-3-11.html 0644 root root 4122 38225 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-7-3-12.html 0644 root root 3538 57017 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-3-13.html 0644 root root 4629 18899 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-3-14.html 0644 root root 3942 25854 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-3-15.html 0644 root root 6326 25539 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-7-3-16.html 0644 root root 3435 47422 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-3-17.html 0644 root root 3561 51809 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-3-18.html 0644 root root 3658 963 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-7-3-19.html 0644 root root 3697 1312 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-7-3-2.html 0644 root root 5237 536 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-3-20.html 0644 root root 3535 51596 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-7-3-21.html 0644 root root 6227 4984 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-3-3.html 0644 root root 10322 3045 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-3-4.html 0644 root root 3534 56477 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-3-5.html 0644 root root 4525 9287 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-7-3-6.html 0644 root root 4460 9581 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-3-7.html 0644 root root 3384 48231 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-3-8.html 0644 root root 3603 1839 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-7-3-9.html 0644 root root 4111 44070 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-7-3.html 0644 root root 33085 20492 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-1.html 0644 root root 7148 19769 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-10.html 0644 root root 3817 14760 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-11.html 0644 root root 4868 38903 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-12.html 0644 root root 4232 48333 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-7-4-13.html 0644 root root 6972 12724 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-14.html 0644 root root 3684 739 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-15.html 0644 root root 4281 38908 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-16.html 0644 root root 3983 26575 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-7-4-17.html 0644 root root 4024 25423 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-18.html 0644 root root 3938 16700 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-19.html 0644 root root 7253 16511 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-2.html 0644 root root 8292 46338 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-7-4-20.html 0644 root root 6616 26933 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-21.html 0644 root root 3933 20065 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-22.html 0644 root root 4082 28479 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-23.html 0644 root root 4434 60084 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-7-4-24.html 0644 root root 4300 43570 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-25.html 0644 root root 4517 4669 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-26.html 0644 root root 5466 85 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-27.html 0644 root root 5175 53062 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-7-4-28.html 0644 root root 5640 22180 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-29.html 0644 root root 6971 383 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-3.html 0644 root root 4647 16143 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-30.html 0644 root root 6222 14189 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-4.html 0644 root root 4117 40254 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-5.html 0644 root root 3226 33531 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-6.html 0644 root root 4763 28567 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-7-4-7.html 0644 root root 4306 60111 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-8.html 0644 root root 10188 16285 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-9.html 0644 root root 5129 52969 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4.html 0644 root root 57409 5729 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-0-1.html 0644 root root 4776 31681 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-0-10.html 0644 root root 4762 9634 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-0-11.html 0644 root root 3980 25763 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-0-12.html 0644 root root 3145 23832 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-0-13.html 0644 root root 4129 33438 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-0-14.html 0644 root root 4529 62735 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-0-15.html 0644 root root 9112 29063 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-0-16.html 0644 root root 8957 5122 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-0-17.html 0644 root root 3931 20001 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-0-18.html 0644 root root 5590 13313 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-0-19.html 0644 root root 4987 36425 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-0-2.html 0644 root root 9598 15885 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-0-20.html 0644 root root 4323 46637 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-0-21.html 0644 root root 4515 4462 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-0-22.html 0644 root root 6451 6542 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-0-23.html 0644 root root 6034 54441 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-0-24.html 0644 root root 7013 63923 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-0-25.html 0644 root root 7438 36790 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-0-26.html 0644 root root 8037 21518 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-0-3.html 0644 root root 7457 55820 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-0-4.html 0644 root root 6691 43668 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-0-5.html 0644 root root 4827 33150 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-0-6.html 0644 root root 5705 46499 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-0-7.html 0644 root root 5920 47699 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-0-8.html 0644 root root 7236 34033 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-0-9.html 0644 root root 4317 48486 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-0.html 0644 root root 66850 58259 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-1-1.html 0644 root root 5488 19717 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-1-10.html 0644 root root 4789 16921 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-1-11.html 0644 root root 9954 26297 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-1-12.html 0644 root root 9349 35284 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-1-13.html 0644 root root 4300 45828 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-1-14.html 0644 root root 6909 52277 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-1-15.html 0644 root root 6282 3536 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-1-16.html 0644 root root 5286 60129 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-1-17.html 0644 root root 6043 59072 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-1-18.html 0644 root root 6450 6594 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-1-19.html 0644 root root 6620 34498 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-1-2.html 0644 root root 6364 32977 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-1-20.html 0644 root root 7306 21622 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-1-21.html 0644 root root 7221 19219 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-1-22.html 0644 root root 8332 44893 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-1-23.html 0644 root root 7941 65292 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-1-3.html 0644 root root 7034 5858 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-1-4.html 0644 root root 8881 37956 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-1-5.html 0644 root root 5487 9479 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-1-6.html 0644 root root 5345 53556 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-1-7.html 0644 root root 4566 6310 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-1-8.html 0644 root root 3124 22933 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-1-9.html 0644 root root 4396 54424 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-1.html 0644 root root 62145 26657 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-2-1.html 0644 root root 5093 34876 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-2-10.html 0644 root root 8187 19095 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-2-11.html 0644 root root 7154 3172 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-2-12.html 0644 root root 6755 41908 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-2-13.html 0644 root root 7355 26235 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-2-14.html 0644 root root 7883 51717 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-2-15.html 0644 root root 8162 25663 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-2-16.html 0644 root root 9300 43262 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-2-17.html 0644 root root 8221 29892 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-2-18.html 0644 root root 10284 892 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-2-19.html 0644 root root 8596 44938 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-2-2.html 0644 root root 5830 33832 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-2-20.html 0644 root root 6251 4157 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-2-21.html 0644 root root 5600 19524 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-2-22.html 0644 root root 9624 61231 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-2-23.html 0644 root root 9566 7862 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-2-3.html 0644 root root 3123 22178 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-2-4.html 0644 root root 5456 113 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-2-5.html 0644 root root 6023 41215 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-2-6.html 0644 root root 10579 1772 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-2-7.html 0644 root root 9339 44374 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-2-8.html 0644 root root 7528 25429 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-2-9.html 0644 root root 4288 45331 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-2.html 0644 root root 69408 31634 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-3-1.html 0644 root root 10613 9735 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-3-10.html 0644 root root 10732 23609 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-3-11.html 0644 root root 8970 23302 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-3-12.html 0644 root root 12126 8914 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-3-13.html 0644 root root 9513 53023 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-3-14.html 0644 root root 6249 4075 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-3-15.html 0644 root root 6388 17750 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-3-16.html 0644 root root 11022 34364 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-3-17.html 0644 root root 10597 20734 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-3-18.html 0644 root root 11272 20494 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-3-19.html 0644 root root 8473 49605 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-3-2.html 0644 root root 12210 52383 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-3-20.html 0644 root root 9240 45065 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-3-3.html 0644 root root 4282 44983 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-3-4.html 0644 root root 11280 61259 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-3-5.html 0644 root root 8696 50558 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-3-6.html 0644 root root 9204 32920 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-3-7.html 0644 root root 9736 18658 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-3-8.html 0644 root root 9267 21877 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-3-9.html 0644 root root 10213 52510 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-3.html 0644 root root 69776 613 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-4-1.html 0644 root root 9607 43986 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-4-10.html 0644 root root 11944 64047 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-4-11.html 0644 root root 13799 30085 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-4-12.html 0644 root root 9999 36083 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-4-13.html 0644 root root 9708 6282 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-4-2.html 0644 root root 15729 4441 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-4-3.html 0644 root root 13940 5763 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-4-4.html 0644 root root 10748 27438 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-4-5.html 0644 root root 15945 39253 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-4-6.html 0644 root root 10442 60671 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-4-7.html 0644 root root 6232 3293 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-4-8.html 0644 root root 8876 15359 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-4-9.html 0644 root root 14540 42424 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-4.html 0644 root root 88008 12741 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-9-0-1.html 0644 root root 5978 57177 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-9-0-2.html 0644 root root 13668 48818 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-9-0-3.html 0644 root root 7288 19259 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-9-0-4.html 0644 root root 11391 12508 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-9-0-5.html 0644 root root 17927 40399 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-9-0-6.html 0644 root root 13438 49292 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-9-0-7.html 0644 root root 18103 41778 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-9-0-8.html 0644 root root 11002 48734 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-9-0-9.html 0644 root root 11734 33904 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-9-0.html 0644 root root 96159 47009 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-9-1-1.html 0644 root root 3698 428 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-9-1-2.html 0644 root root 21602 31917 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-9-1-3.html 0644 root root 21161 6996 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-9-1-4.html 0644 root root 16026 48826 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-9-1-5.html 0644 root root 14038 16693 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-9-1.html 0644 root root 79097 6835 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-9-2.html 0644 root root 79601 61842 1347419719 1 f none /usr/local/share/doc/postgresql/html/release.html 0644 root root 18194 55284 1347419718 1 f none /usr/local/share/doc/postgresql/html/resources.html 0644 root root 4220 54030 1347419719 1 f none /usr/local/share/doc/postgresql/html/role-attributes.html 0644 root root 7860 2927 1347419719 1 f none /usr/local/share/doc/postgresql/html/role-membership.html 0644 root root 8616 8859 1347419719 1 f none /usr/local/share/doc/postgresql/html/routine-reindex.html 0644 root root 3626 18749 1347419719 1 f none /usr/local/share/doc/postgresql/html/routine-vacuuming.html 0644 root root 37670 11511 1347419719 1 f none /usr/local/share/doc/postgresql/html/row-estimation-examples.html 0644 root root 20657 59939 1347419718 1 f none /usr/local/share/doc/postgresql/html/rowtypes.html 0644 root root 14320 27824 1347419719 1 f none /usr/local/share/doc/postgresql/html/rule-system.html 0644 root root 4115 45741 1347419718 1 f none /usr/local/share/doc/postgresql/html/rules-privileges.html 0644 root root 11661 20801 1347419718 1 f none /usr/local/share/doc/postgresql/html/rules-status.html 0644 root root 4510 14587 1347419719 1 f none /usr/local/share/doc/postgresql/html/rules-triggers.html 0644 root root 9474 29156 1347419719 1 f none /usr/local/share/doc/postgresql/html/rules-update.html 0644 root root 32613 44373 1347419719 1 f none /usr/local/share/doc/postgresql/html/rules-views.html 0644 root root 26886 24545 1347419719 1 f none /usr/local/share/doc/postgresql/html/rules.html 0644 root root 4946 44594 1347419718 1 f none /usr/local/share/doc/postgresql/html/runtime-config-autovacuum.html 0644 root root 10972 55471 1347419719 1 f none /usr/local/share/doc/postgresql/html/runtime-config-client.html 0644 root root 32538 1553 1347419718 1 f none /usr/local/share/doc/postgresql/html/runtime-config-compatible.html 0644 root root 14087 10695 1347419718 1 f none /usr/local/share/doc/postgresql/html/runtime-config-connection.html 0644 root root 22109 40418 1347419719 1 f none /usr/local/share/doc/postgresql/html/runtime-config-custom.html 0644 root root 3546 9645 1347419719 1 f none /usr/local/share/doc/postgresql/html/runtime-config-developer.html 0644 root root 14068 9524 1347419719 1 f none /usr/local/share/doc/postgresql/html/runtime-config-error-handling.html 0644 root root 3568 2933 1347419719 1 f none /usr/local/share/doc/postgresql/html/runtime-config-file-locations.html 0644 root root 6965 4101 1347419718 1 f none /usr/local/share/doc/postgresql/html/runtime-config-locks.html 0644 root root 7632 7462 1347419719 1 f none /usr/local/share/doc/postgresql/html/runtime-config-logging.html 0644 root root 45385 54413 1347419718 1 f none /usr/local/share/doc/postgresql/html/runtime-config-preset.html 0644 root root 8708 56077 1347419719 1 f none /usr/local/share/doc/postgresql/html/runtime-config-query.html 0644 root root 24948 22344 1347419719 1 f none /usr/local/share/doc/postgresql/html/runtime-config-replication.html 0644 root root 18292 5594 1347419719 1 f none /usr/local/share/doc/postgresql/html/runtime-config-resource.html 0644 root root 27899 22680 1347419718 1 f none /usr/local/share/doc/postgresql/html/runtime-config-short.html 0644 root root 6679 4191 1347419719 1 f none /usr/local/share/doc/postgresql/html/runtime-config-statistics.html 0644 root root 8614 65351 1347419719 1 f none /usr/local/share/doc/postgresql/html/runtime-config-wal.html 0644 root root 27091 9949 1347419719 1 f none /usr/local/share/doc/postgresql/html/runtime-config.html 0644 root root 8247 34161 1347419718 1 f none /usr/local/share/doc/postgresql/html/runtime.html 0644 root root 4996 39962 1347419718 1 f none /usr/local/share/doc/postgresql/html/seg.html 0644 root root 15468 34859 1347419719 1 f none /usr/local/share/doc/postgresql/html/sepgsql.html 0644 root root 30825 34849 1347419718 1 f none /usr/local/share/doc/postgresql/html/server-programming.html 0644 root root 9616 2053 1347419719 1 f none /usr/local/share/doc/postgresql/html/server-shutdown.html 0644 root root 6467 39377 1347419719 1 f none /usr/local/share/doc/postgresql/html/server-start.html 0644 root root 14189 1159 1347419718 1 f none /usr/local/share/doc/postgresql/html/source-format.html 0644 root root 5131 65212 1347419718 1 f none /usr/local/share/doc/postgresql/html/source.html 0644 root root 4069 35153 1347419718 1 f none /usr/local/share/doc/postgresql/html/sourcerepo.html 0644 root root 3382 57222 1347419719 1 f none /usr/local/share/doc/postgresql/html/spgist-examples.html 0644 root root 2701 194 1347419719 1 f none /usr/local/share/doc/postgresql/html/spgist-extensibility.html 0644 root root 31280 30209 1347419718 1 f none /usr/local/share/doc/postgresql/html/spgist-implementation.html 0644 root root 8096 50414 1347419718 1 f none /usr/local/share/doc/postgresql/html/spgist-intro.html 0644 root root 4321 7328 1347419719 1 f none /usr/local/share/doc/postgresql/html/spgist.html 0644 root root 2964 17057 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-examples.html 0644 root root 6215 49607 1347419718 1 f none /usr/local/share/doc/postgresql/html/spi-interface-support.html 0644 root root 3768 25517 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-interface.html 0644 root root 5996 14865 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-memory.html 0644 root root 7087 35196 1347419718 1 f none /usr/local/share/doc/postgresql/html/spi-realloc.html 0644 root root 3625 63293 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-connect.html 0644 root root 4050 32314 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-copytuple.html 0644 root root 3451 50690 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-cursor-close.html 0644 root root 3334 46296 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-cursor-fetch.html 0644 root root 4108 32573 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-cursor-find.html 0644 root root 3462 55871 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-cursor-move.html 0644 root root 3888 18856 1347419718 1 f none /usr/local/share/doc/postgresql/html/spi-spi-cursor-open-with-args.html 0644 root root 6176 57572 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-cursor-open-with-paramlist.html 0644 root root 5033 43677 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-cursor-open.html 0644 root root 5730 30345 1347419718 1 f none /usr/local/share/doc/postgresql/html/spi-spi-exec.html 0644 root root 3548 55542 1347419718 1 f none /usr/local/share/doc/postgresql/html/spi-spi-execp.html 0644 root root 4823 20623 1347419718 1 f none /usr/local/share/doc/postgresql/html/spi-spi-execute-plan-with-paramlist.html 0644 root root 4850 24289 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-execute-plan.html 0644 root root 5858 29270 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-execute-with-args.html 0644 root root 6178 56255 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-execute.html 0644 root root 12172 43426 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-finish.html 0644 root root 3653 3806 1347419718 1 f none /usr/local/share/doc/postgresql/html/spi-spi-fname.html 0644 root root 3765 8727 1347419718 1 f none /usr/local/share/doc/postgresql/html/spi-spi-fnumber.html 0644 root root 3934 23517 1347419718 1 f none /usr/local/share/doc/postgresql/html/spi-spi-freeplan.html 0644 root root 3503 53705 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-freetuple.html 0644 root root 3275 40622 1347419718 1 f none /usr/local/share/doc/postgresql/html/spi-spi-freetupletable.html 0644 root root 3626 2540 1347419718 1 f none /usr/local/share/doc/postgresql/html/spi-spi-getargcount.html 0644 root root 3696 4183 1347419718 1 f none /usr/local/share/doc/postgresql/html/spi-spi-getargtypeid.html 0644 root root 4139 36765 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-getbinval.html 0644 root root 4285 46025 1347419718 1 f none /usr/local/share/doc/postgresql/html/spi-spi-getnspname.html 0644 root root 3465 54323 1347419718 1 f none /usr/local/share/doc/postgresql/html/spi-spi-getrelname.html 0644 root root 3349 44366 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-gettype.html 0644 root root 3712 4601 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-gettypeid.html 0644 root root 3716 3149 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-getvalue.html 0644 root root 4164 36889 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-is-cursor-plan.html 0644 root root 4558 4231 1347419718 1 f none /usr/local/share/doc/postgresql/html/spi-spi-keepplan.html 0644 root root 3882 19275 1347419718 1 f none /usr/local/share/doc/postgresql/html/spi-spi-modifytuple.html 0644 root root 5629 7378 1347419718 1 f none /usr/local/share/doc/postgresql/html/spi-spi-palloc.html 0644 root root 3155 27314 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-pfree.html 0644 root root 3273 37308 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-pop.html 0644 root root 2741 64108 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-prepare-cursor.html 0644 root root 5053 34838 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-prepare-params.html 0644 root root 4410 57827 1347419718 1 f none /usr/local/share/doc/postgresql/html/spi-spi-prepare.html 0644 root root 7659 61366 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-push.html 0644 root root 3735 14192 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-returntuple.html 0644 root root 4095 35687 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-saveplan.html 0644 root root 4574 6903 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-scroll-cursor-fetch.html 0644 root root 4807 15886 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-scroll-cursor-move.html 0644 root root 4897 23019 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-visibility.html 0644 root root 4150 50098 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi.html 0644 root root 10841 25901 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-abort.html 0644 root root 4175 35015 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-alteraggregate.html 0644 root root 6109 45094 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-altercollation.html 0644 root root 5082 32720 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-alterconversion.html 0644 root root 5168 41251 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-alterdatabase.html 0644 root root 8776 58357 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-alterdefaultprivileges.html 0644 root root 9453 33643 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-alterdomain.html 0644 root root 11111 17312 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-alterextension.html 0644 root root 11743 54685 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-alterforeigndatawrapper.html 0644 root root 7376 7604 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-alterforeigntable.html 0644 root root 12705 61003 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-alterfunction.html 0644 root root 12778 9336 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-altergroup.html 0644 root root 5237 47553 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-alterindex.html 0644 root root 7647 23806 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-alterlanguage.html 0644 root root 4020 18788 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-alterlargeobject.html 0644 root root 3728 64999 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-alteropclass.html 0644 root root 5112 37000 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-alteroperator.html 0644 root root 5433 61164 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-alteropfamily.html 0644 root root 13562 30490 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-alterrole.html 0644 root root 13026 49987 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-alterschema.html 0644 root root 4312 41915 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-altersequence.html 0644 root root 13029 27214 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-alterserver.html 0644 root root 5926 28351 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-altertable.html 0644 root root 42806 52233 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-altertablespace.html 0644 root root 5864 27956 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-altertrigger.html 0644 root root 4645 1555 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-altertsconfig.html 0644 root root 8124 62109 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-altertsdictionary.html 0644 root root 6510 16092 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-altertsparser.html 0644 root root 4255 37715 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-altertstemplate.html 0644 root root 4221 35094 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-altertype.html 0644 root root 11191 27629 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-alteruser.html 0644 root root 4438 45841 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-alterusermapping.html 0644 root root 5720 15089 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-alterview.html 0644 root root 6966 35081 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-analyze.html 0644 root root 10672 49339 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-begin.html 0644 root root 6693 39832 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-checkpoint.html 0644 root root 3756 11075 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-close.html 0644 root root 4982 30530 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-cluster.html 0644 root root 9402 593 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-commands.html 0644 root root 18808 55687 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-comment.html 0644 root root 13797 32566 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-commit-prepared.html 0644 root root 4514 273 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-commit.html 0644 root root 3990 20489 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-copy.html 0644 root root 37443 11367 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-createaggregate.html 0644 root root 13827 13816 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-createcast.html 0644 root root 19630 46801 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-createcollation.html 0644 root root 6737 31192 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-createconversion.html 0644 root root 6536 16737 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-createdatabase.html 0644 root root 12383 13042 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-createdomain.html 0644 root root 8542 42518 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-createextension.html 0644 root root 8823 9327 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-createforeigndatawrapper.html 0644 root root 8057 10911 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-createforeigntable.html 0644 root root 7716 38858 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-createfunction.html 0644 root root 30952 17301 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-creategroup.html 0644 root root 4010 13119 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-createindex.html 0644 root root 25738 52890 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-createlanguage.html 0644 root root 14886 37135 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-createopclass.html 0644 root root 12674 34466 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-createoperator.html 0644 root root 10686 2015 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-createopfamily.html 0644 root root 5624 27814 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-createrole.html 0644 root root 19508 12286 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-createrule.html 0644 root root 12654 25019 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-createschema.html 0644 root root 8159 18288 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-createsequence.html 0644 root root 14070 3745 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-createserver.html 0644 root root 6249 58577 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-createtable.html 0644 root root 58375 24680 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-createtableas.html 0644 root root 12770 14235 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-createtablespace.html 0644 root root 6102 47594 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-createtrigger.html 0644 root root 23173 43336 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-createtsconfig.html 0644 root root 5350 65388 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-createtsdictionary.html 0644 root root 5531 11145 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-createtsparser.html 0644 root root 5945 43537 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-createtstemplate.html 0644 root root 5435 10386 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-createtype.html 0644 root root 39458 38119 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-createuser.html 0644 root root 4522 51543 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-createusermapping.html 0644 root root 5501 4479 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-createview.html 0644 root root 10305 53050 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-deallocate.html 0644 root root 3783 3960 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-declare.html 0644 root root 15398 60627 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-delete.html 0644 root root 11792 15900 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-discard.html 0644 root root 4307 45870 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-do.html 0644 root root 5202 48974 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-drop-owned.html 0644 root root 4798 20348 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-dropaggregate.html 0644 root root 4559 59826 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-dropcast.html 0644 root root 4342 42855 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-dropcollation.html 0644 root root 4407 48169 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-dropconversion.html 0644 root root 4435 51890 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-dropdatabase.html 0644 root root 4342 48314 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-dropdomain.html 0644 root root 4255 36186 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-dropextension.html 0644 root root 4783 14378 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-dropforeigndatawrapper.html 0644 root root 4524 57528 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-dropforeigntable.html 0644 root root 4558 61588 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-dropfunction.html 0644 root root 5836 24799 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-dropgroup.html 0644 root root 3045 15469 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-dropindex.html 0644 root root 5255 52569 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-droplanguage.html 0644 root root 4839 15570 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-dropopclass.html 0644 root root 5676 17956 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-dropoperator.html 0644 root root 5220 41797 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-dropopfamily.html 0644 root root 5277 53921 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-droprole.html 0644 root root 5064 41173 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-droprule.html 0644 root root 4149 25961 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-dropschema.html 0644 root root 4527 59300 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-dropsequence.html 0644 root root 4365 45496 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-dropserver.html 0644 root root 4263 36348 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-droptable.html 0644 root root 5026 34551 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-droptablespace.html 0644 root root 4583 203 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-droptrigger.html 0644 root root 4709 5467 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-droptsconfig.html 0644 root root 4770 14824 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-droptsdictionary.html 0644 root root 4687 7501 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-droptsparser.html 0644 root root 4593 65445 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-droptstemplate.html 0644 root root 4565 63010 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-droptype.html 0644 root root 4461 53790 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-dropuser.html 0644 root root 3164 25310 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-dropusermapping.html 0644 root root 4677 2505 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-dropview.html 0644 root root 4260 37957 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-end.html 0644 root root 4155 32990 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-execute.html 0644 root root 5071 42620 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-explain.html 0644 root root 17092 20392 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-expressions.html 0644 root root 45028 16684 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-fetch.html 0644 root root 14249 30491 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-grant.html 0644 root root 28864 42335 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-insert.html 0644 root root 12858 29330 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-keywords-appendix.html 0644 root root 106531 8660 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-listen.html 0644 root root 5901 44835 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-load.html 0644 root root 4205 46333 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-lock.html 0644 root root 11689 28605 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-move.html 0644 root root 4982 20769 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-notify.html 0644 root root 10946 21048 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-prepare-transaction.html 0644 root root 8599 3617 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-prepare.html 0644 root root 9179 55879 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-reassign-owned.html 0644 root root 5240 52956 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-reindex.html 0644 root root 11098 63798 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-release-savepoint.html 0644 root root 5003 37567 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-reset.html 0644 root root 4991 36825 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-revoke.html 0644 root root 14877 51654 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-rollback-prepared.html 0644 root root 4625 8579 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-rollback-to.html 0644 root root 6399 14505 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-rollback.html 0644 root root 3994 19367 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-savepoint.html 0644 root root 5603 18892 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-security-label.html 0644 root root 8877 57783 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-select.html 0644 root root 78892 29071 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-selectinto.html 0644 root root 7632 16069 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-set-constraints.html 0644 root root 7066 9502 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-set-role.html 0644 root root 6913 58164 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-set-session-authorization.html 0644 root root 6060 58988 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-set-transaction.html 0644 root root 12694 51704 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-set.html 0644 root root 12055 30128 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-show.html 0644 root root 6849 31804 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-start-transaction.html 0644 root root 4981 34758 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-syntax-calling-funcs.html 0644 root root 7802 11227 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-syntax-lexical.html 0644 root root 43368 15565 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-syntax.html 0644 root root 5428 13261 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-truncate.html 0644 root root 9996 42434 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-unlisten.html 0644 root root 4921 24680 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-update.html 0644 root root 15483 52503 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-vacuum.html 0644 root root 11932 63998 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-values.html 0644 root root 10638 53825 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql.html 0644 root root 13425 38646 1347419719 1 f none /usr/local/share/doc/postgresql/html/ssh-tunnels.html 0644 root root 6261 26784 1347419719 1 f none /usr/local/share/doc/postgresql/html/ssl-tcp.html 0644 root root 13475 18397 1347419719 1 f none /usr/local/share/doc/postgresql/html/sslinfo.html 0644 root root 7592 90 1347419719 1 f none /usr/local/share/doc/postgresql/html/standby-settings.html 0644 root root 5425 10388 1347419719 1 f none /usr/local/share/doc/postgresql/html/storage-file-layout.html 0644 root root 12899 40984 1347419719 1 f none /usr/local/share/doc/postgresql/html/storage-fsm.html 0644 root root 3819 28976 1347419719 1 f none /usr/local/share/doc/postgresql/html/storage-init.html 0644 root root 2758 8936 1347419719 1 f none /usr/local/share/doc/postgresql/html/storage-page-layout.html 0644 root root 13889 48106 1347419718 1 f none /usr/local/share/doc/postgresql/html/storage-toast.html 0644 root root 11476 14635 1347419718 1 f none /usr/local/share/doc/postgresql/html/storage-vm.html 0644 root root 3538 10557 1347419719 1 f none /usr/local/share/doc/postgresql/html/storage.html 0644 root root 2950 17901 1347419718 1 f none /usr/local/share/doc/postgresql/html/stylesheet.css 0644 root root 1538 52916 1347419719 1 f none /usr/local/share/doc/postgresql/html/supported-platforms.html 0644 root root 5039 2500 1347419719 1 f none /usr/local/share/doc/postgresql/html/tablefunc.html 0644 root root 32191 53466 1347419719 1 f none /usr/local/share/doc/postgresql/html/tcn.html 0644 root root 4972 51087 1347419719 1 f none /usr/local/share/doc/postgresql/html/test-parser.html 0644 root root 4528 3833 1347419719 1 f none /usr/local/share/doc/postgresql/html/textsearch-configuration.html 0644 root root 6255 22329 1347419719 1 f none /usr/local/share/doc/postgresql/html/textsearch-controls.html 0644 root root 26963 34711 1347419719 1 f none /usr/local/share/doc/postgresql/html/textsearch-debugging.html 0644 root root 17225 21468 1347419719 1 f none /usr/local/share/doc/postgresql/html/textsearch-dictionaries.html 0644 root root 31265 48482 1347419718 1 f none /usr/local/share/doc/postgresql/html/textsearch-features.html 0644 root root 21308 49075 1347419718 1 f none /usr/local/share/doc/postgresql/html/textsearch-indexes.html 0644 root root 7385 51309 1347419718 1 f none /usr/local/share/doc/postgresql/html/textsearch-intro.html 0644 root root 18451 30569 1347419719 1 f none /usr/local/share/doc/postgresql/html/textsearch-limitations.html 0644 root root 3857 23462 1347419719 1 f none /usr/local/share/doc/postgresql/html/textsearch-migration.html 0644 root root 5032 57480 1347419719 1 f none /usr/local/share/doc/postgresql/html/textsearch-parsers.html 0644 root root 9208 25293 1347419719 1 f none /usr/local/share/doc/postgresql/html/textsearch-psql.html 0644 root root 9343 43987 1347419719 1 f none /usr/local/share/doc/postgresql/html/textsearch-tables.html 0644 root root 9748 47182 1347419718 1 f none /usr/local/share/doc/postgresql/html/textsearch.html 0644 root root 5876 43941 1347419718 1 f none /usr/local/share/doc/postgresql/html/transaction-iso.html 0644 root root 26729 4486 1347419719 1 f none /usr/local/share/doc/postgresql/html/trigger-datachanges.html 0644 root root 5070 58495 1347419719 1 f none /usr/local/share/doc/postgresql/html/trigger-definition.html 0644 root root 15505 48285 1347419719 1 f none /usr/local/share/doc/postgresql/html/trigger-example.html 0644 root root 7747 40969 1347419719 1 f none /usr/local/share/doc/postgresql/html/trigger-interface.html 0644 root root 10717 3827 1347419719 1 f none /usr/local/share/doc/postgresql/html/triggers.html 0644 root root 3796 25110 1347419719 1 f none /usr/local/share/doc/postgresql/html/tsearch2.html 0644 root root 9948 55577 1347419719 1 f none /usr/local/share/doc/postgresql/html/tutorial-accessdb.html 0644 root root 7023 57950 1347419719 1 f none /usr/local/share/doc/postgresql/html/tutorial-advanced-intro.html 0644 root root 3339 52498 1347419718 1 f none /usr/local/share/doc/postgresql/html/tutorial-advanced.html 0644 root root 2854 10995 1347419719 1 f none /usr/local/share/doc/postgresql/html/tutorial-agg.html 0644 root root 7592 44928 1347419718 1 f none /usr/local/share/doc/postgresql/html/tutorial-arch.html 0644 root root 4850 47198 1347419719 1 f none /usr/local/share/doc/postgresql/html/tutorial-concepts.html 0644 root root 3837 24614 1347419718 1 f none /usr/local/share/doc/postgresql/html/tutorial-conclusion.html 0644 root root 2846 12072 1347419719 1 f none /usr/local/share/doc/postgresql/html/tutorial-createdb.html 0644 root root 9198 65487 1347419719 1 f none /usr/local/share/doc/postgresql/html/tutorial-delete.html 0644 root root 3515 56740 1347419719 1 f none /usr/local/share/doc/postgresql/html/tutorial-fk.html 0644 root root 4420 4627 1347419718 1 f none /usr/local/share/doc/postgresql/html/tutorial-inheritance.html 0644 root root 6135 61093 1347419719 1 f none /usr/local/share/doc/postgresql/html/tutorial-install.html 0644 root root 4520 24421 1347419719 1 f none /usr/local/share/doc/postgresql/html/tutorial-join.html 0644 root root 9683 9202 1347419719 1 f none /usr/local/share/doc/postgresql/html/tutorial-populate.html 0644 root root 4837 37213 1347419718 1 f none /usr/local/share/doc/postgresql/html/tutorial-select.html 0644 root root 8031 52292 1347419719 1 f none /usr/local/share/doc/postgresql/html/tutorial-sql-intro.html 0644 root root 4902 33168 1347419719 1 f none /usr/local/share/doc/postgresql/html/tutorial-sql.html 0644 root root 3058 25615 1347419718 1 f none /usr/local/share/doc/postgresql/html/tutorial-start.html 0644 root root 2627 58222 1347419718 1 f none /usr/local/share/doc/postgresql/html/tutorial-table.html 0644 root root 5702 30762 1347419719 1 f none /usr/local/share/doc/postgresql/html/tutorial-transactions.html 0644 root root 9946 13892 1347419719 1 f none /usr/local/share/doc/postgresql/html/tutorial-update.html 0644 root root 3157 26920 1347419719 1 f none /usr/local/share/doc/postgresql/html/tutorial-views.html 0644 root root 3373 56776 1347419719 1 f none /usr/local/share/doc/postgresql/html/tutorial-window.html 0644 root root 12479 23583 1347419718 1 f none /usr/local/share/doc/postgresql/html/tutorial.html 0644 root root 5207 64909 1347419718 1 f none /usr/local/share/doc/postgresql/html/typeconv-func.html 0644 root root 11995 55805 1347419719 1 f none /usr/local/share/doc/postgresql/html/typeconv-oper.html 0644 root root 12013 55871 1347419719 1 f none /usr/local/share/doc/postgresql/html/typeconv-overview.html 0644 root root 8288 14912 1347419719 1 f none /usr/local/share/doc/postgresql/html/typeconv-query.html 0644 root root 5448 29685 1347419718 1 f none /usr/local/share/doc/postgresql/html/typeconv-union-case.html 0644 root root 5785 37862 1347419719 1 f none /usr/local/share/doc/postgresql/html/typeconv.html 0644 root root 3719 18586 1347419718 1 f none /usr/local/share/doc/postgresql/html/unaccent.html 0644 root root 6740 43397 1347419719 1 f none /usr/local/share/doc/postgresql/html/unsupported-features-sql-standard.html 0644 root root 35113 18896 1347419719 1 f none /usr/local/share/doc/postgresql/html/upgrading.html 0644 root root 12792 25885 1347419718 1 f none /usr/local/share/doc/postgresql/html/user-manag.html 0644 root root 3902 34660 1347419719 1 f none /usr/local/share/doc/postgresql/html/using-explain.html 0644 root root 41822 50889 1347419718 1 f none /usr/local/share/doc/postgresql/html/uuid-ossp.html 0644 root root 7226 2960 1347419719 1 f none /usr/local/share/doc/postgresql/html/vacuumlo.html 0644 root root 7546 34525 1347419718 1 f none /usr/local/share/doc/postgresql/html/view-pg-available-extension-versions.html 0644 root root 4640 14380 1347419718 1 f none /usr/local/share/doc/postgresql/html/view-pg-available-extensions.html 0644 root root 3942 27963 1347419719 1 f none /usr/local/share/doc/postgresql/html/view-pg-cursors.html 0644 root root 5667 23723 1347419719 1 f none /usr/local/share/doc/postgresql/html/view-pg-group.html 0644 root root 3895 18031 1347419718 1 f none /usr/local/share/doc/postgresql/html/view-pg-indexes.html 0644 root root 4153 34180 1347419719 1 f none /usr/local/share/doc/postgresql/html/view-pg-locks.html 0644 root root 14020 50330 1347419718 1 f none /usr/local/share/doc/postgresql/html/view-pg-prepared-statements.html 0644 root root 5058 47011 1347419719 1 f none /usr/local/share/doc/postgresql/html/view-pg-prepared-xacts.html 0644 root root 4910 37739 1347419719 1 f none /usr/local/share/doc/postgresql/html/view-pg-roles.html 0644 root root 6071 48813 1347419718 1 f none /usr/local/share/doc/postgresql/html/view-pg-rules.html 0644 root root 3997 23567 1347419719 1 f none /usr/local/share/doc/postgresql/html/view-pg-seclabels.html 0644 root root 5121 40126 1347419718 1 f none /usr/local/share/doc/postgresql/html/view-pg-settings.html 0644 root root 10598 14750 1347419719 1 f none /usr/local/share/doc/postgresql/html/view-pg-shadow.html 0644 root root 5379 62827 1347419718 1 f none /usr/local/share/doc/postgresql/html/view-pg-stats.html 0644 root root 8885 17377 1347419719 1 f none /usr/local/share/doc/postgresql/html/view-pg-tables.html 0644 root root 4834 20823 1347419719 1 f none /usr/local/share/doc/postgresql/html/view-pg-timezone-abbrevs.html 0644 root root 3574 64443 1347419719 1 f none /usr/local/share/doc/postgresql/html/view-pg-timezone-names.html 0644 root root 4175 45632 1347419719 1 f none /usr/local/share/doc/postgresql/html/view-pg-user-mappings.html 0644 root root 4691 10406 1347419719 1 f none /usr/local/share/doc/postgresql/html/view-pg-user.html 0644 root root 4515 64021 1347419719 1 f none /usr/local/share/doc/postgresql/html/view-pg-views.html 0644 root root 3851 13982 1347419719 1 f none /usr/local/share/doc/postgresql/html/views-overview.html 0644 root root 6540 37642 1347419718 1 f none /usr/local/share/doc/postgresql/html/wal-async-commit.html 0644 root root 9014 15912 1347419719 1 f none /usr/local/share/doc/postgresql/html/wal-configuration.html 0644 root root 14958 61441 1347419719 1 f none /usr/local/share/doc/postgresql/html/wal-internals.html 0644 root root 6149 26113 1347419719 1 f none /usr/local/share/doc/postgresql/html/wal-intro.html 0644 root root 5532 41896 1347419719 1 f none /usr/local/share/doc/postgresql/html/wal-reliability.html 0644 root root 11477 1053 1347419718 1 f none /usr/local/share/doc/postgresql/html/wal.html 0644 root root 2926 14956 1347419719 1 f none /usr/local/share/doc/postgresql/html/warm-standby-failover.html 0644 root root 6100 37261 1347419719 1 f none /usr/local/share/doc/postgresql/html/warm-standby.html 0644 root root 34549 2904 1347419719 1 f none /usr/local/share/doc/postgresql/html/xaggr.html 0644 root root 9900 1755 1347419719 1 f none /usr/local/share/doc/postgresql/html/xfunc-c.html 0644 root root 78710 28145 1347419719 1 f none /usr/local/share/doc/postgresql/html/xfunc-internal.html 0644 root root 4002 35905 1347419719 1 f none /usr/local/share/doc/postgresql/html/xfunc-overload.html 0644 root root 5909 3036 1347419718 1 f none /usr/local/share/doc/postgresql/html/xfunc-pl.html 0644 root root 2989 23841 1347419719 1 f none /usr/local/share/doc/postgresql/html/xfunc-sql.html 0644 root root 38566 3138 1347419718 1 f none /usr/local/share/doc/postgresql/html/xfunc-volatility.html 0644 root root 9837 50930 1347419719 1 f none /usr/local/share/doc/postgresql/html/xfunc.html 0644 root root 4516 9504 1347419719 1 f none /usr/local/share/doc/postgresql/html/xindex.html 0644 root root 44591 17481 1347419719 1 f none /usr/local/share/doc/postgresql/html/xml2.html 0644 root root 16794 15041 1347419719 1 f none /usr/local/share/doc/postgresql/html/xoper-optimization.html 0644 root root 23141 21241 1347419718 1 f none /usr/local/share/doc/postgresql/html/xoper.html 0644 root root 4833 41866 1347419718 1 f none /usr/local/share/doc/postgresql/html/xplang-install.html 0644 root root 11125 59353 1347419719 1 f none /usr/local/share/doc/postgresql/html/xplang.html 0644 root root 4233 62375 1347419719 1 f none /usr/local/share/doc/postgresql/html/xtypes.html 0644 root root 12112 39397 1347419719 1 d none /usr/local/share/man 0755 root root 1 d none /usr/local/share/man/man1 0755 root root 1 f none /usr/local/share/man/man1/clusterdb.1 0644 root root 5811 26853 1347419720 1 f none /usr/local/share/man/man1/createdb.1 0644 root root 7419 32174 1347419720 1 f none /usr/local/share/man/man1/createlang.1 0644 root root 5419 55483 1347419720 1 f none /usr/local/share/man/man1/createuser.1 0644 root root 9329 64941 1347419720 1 f none /usr/local/share/man/man1/dropdb.1 0644 root root 5369 51493 1347419720 1 f none /usr/local/share/man/man1/droplang.1 0644 root root 5211 36534 1347419720 1 f none /usr/local/share/man/man1/dropuser.1 0644 root root 5347 51714 1347419720 1 f none /usr/local/share/man/man1/ecpg.1 0644 root root 5326 48861 1347419720 1 f none /usr/local/share/man/man1/initdb.1 0644 root root 9340 23215 1347419720 1 f none /usr/local/share/man/man1/oid2name.1 0644 root root 8874 33070 1347419720 1 f none /usr/local/share/man/man1/pg_archivecleanup.1 0644 root root 5749 22088 1347419720 1 f none /usr/local/share/man/man1/pg_basebackup.1 0644 root root 13194 36714 1347419720 1 f none /usr/local/share/man/man1/pg_config.1 0644 root root 6800 49813 1347419720 1 f none /usr/local/share/man/man1/pg_controldata.1 0644 root root 2293 51640 1347419720 1 f none /usr/local/share/man/man1/pg_ctl.1 0644 root root 12877 64039 1347419720 1 f none /usr/local/share/man/man1/pg_dump.1 0644 root root 28996 61703 1347419720 1 f none /usr/local/share/man/man1/pg_dumpall.1 0644 root root 12881 5591 1347419720 1 f none /usr/local/share/man/man1/pg_receivexlog.1 0644 root root 6776 58497 1347419720 1 f none /usr/local/share/man/man1/pg_resetxlog.1 0644 root root 8233 49916 1347419720 1 f none /usr/local/share/man/man1/pg_restore.1 0644 root root 19578 58308 1347419720 1 f none /usr/local/share/man/man1/pg_standby.1 0644 root root 10596 47700 1347419720 1 f none /usr/local/share/man/man1/pg_test_fsync.1 0644 root root 2807 29256 1347419720 1 f none /usr/local/share/man/man1/pg_test_timing.1 0644 root root 9816 39715 1347419720 1 f none /usr/local/share/man/man1/pg_upgrade.1 0644 root root 17916 17702 1347419720 1 f none /usr/local/share/man/man1/pgbench.1 0644 root root 21411 43673 1347419720 1 f none /usr/local/share/man/man1/postgres.1 0644 root root 20851 8000 1347419720 1 f none /usr/local/share/man/man1/postmaster.1 0644 root root 1535 47114 1347419720 1 f none /usr/local/share/man/man1/psql.1 0644 root root 87146 36253 1347419720 1 f none /usr/local/share/man/man1/reindexdb.1 0644 root root 6128 52103 1347419720 1 f none /usr/local/share/man/man1/vacuumdb.1 0644 root root 7090 2079 1347419720 1 f none /usr/local/share/man/man1/vacuumlo.1 0644 root root 4314 31093 1347419720 1 d none /usr/local/share/man/man3 0755 root root 1 f none /usr/local/share/man/man3/SPI_connect.3 0644 root root 2261 45257 1347419720 1 f none /usr/local/share/man/man3/SPI_copytuple.3 0644 root root 1834 7398 1347419720 1 f none /usr/local/share/man/man3/SPI_cursor_close.3 0644 root root 1784 4490 1347419720 1 f none /usr/local/share/man/man3/SPI_cursor_fetch.3 0644 root root 2137 33539 1347419720 1 f none /usr/local/share/man/man3/SPI_cursor_find.3 0644 root root 1779 2587 1347419720 1 f none /usr/local/share/man/man3/SPI_cursor_move.3 0644 root root 2003 22323 1347419720 1 f none /usr/local/share/man/man3/SPI_cursor_open.3 0644 root root 3353 9921 1347419720 1 f none /usr/local/share/man/man3/SPI_cursor_open_with_args.3 0644 root root 3426 11406 1347419720 1 f none /usr/local/share/man/man3/SPI_cursor_open_with_paramlist.3 0644 root root 2890 32520 1347419720 1 f none /usr/local/share/man/man3/SPI_exec.3 0644 root root 1778 1451 1347419720 1 f none /usr/local/share/man/man3/SPI_execp.3 0644 root root 2474 62739 1347419720 1 f none /usr/local/share/man/man3/SPI_execute.3 0644 root root 7476 32494 1347419720 1 f none /usr/local/share/man/man3/SPI_execute_plan.3 0644 root root 2985 41007 1347419720 1 f none /usr/local/share/man/man3/SPI_execute_plan_with_paramlist.3 0644 root root 2733 18601 1347419720 1 f none /usr/local/share/man/man3/SPI_execute_with_args.3 0644 root root 3516 22953 1347419720 1 f none /usr/local/share/man/man3/SPI_finish.3 0644 root root 2128 33446 1347419720 1 f none /usr/local/share/man/man3/SPI_fname.3 0644 root root 1934 14950 1347419720 1 f none /usr/local/share/man/man3/SPI_fnumber.3 0644 root root 2176 37587 1347419720 1 f none /usr/local/share/man/man3/SPI_freeplan.3 0644 root root 1766 869 1347419720 1 f none /usr/local/share/man/man3/SPI_freetuple.3 0644 root root 1752 1128 1347419720 1 f none /usr/local/share/man/man3/SPI_freetuptable.3 0644 root root 2053 28399 1347419720 1 f none /usr/local/share/man/man3/SPI_getargcount.3 0644 root root 1909 13940 1347419720 1 f none /usr/local/share/man/man3/SPI_getargtypeid.3 0644 root root 2176 37262 1347419720 1 f none /usr/local/share/man/man3/SPI_getbinval.3 0644 root root 2321 48094 1347419720 1 f none /usr/local/share/man/man3/SPI_getnspname.3 0644 root root 1853 9394 1347419720 1 f none /usr/local/share/man/man3/SPI_getrelname.3 0644 root root 1757 95 1347419720 1 f none /usr/local/share/man/man3/SPI_gettype.3 0644 root root 1948 16448 1347419720 1 f none /usr/local/share/man/man3/SPI_gettypeid.3 0644 root root 1868 9322 1347419720 1 f none /usr/local/share/man/man3/SPI_getvalue.3 0644 root root 2192 38190 1347419720 1 f none /usr/local/share/man/man3/SPI_is_cursor_plan.3 0644 root root 2424 60306 1347419720 1 f none /usr/local/share/man/man3/SPI_keepplan.3 0644 root root 2101 31120 1347419720 1 f none /usr/local/share/man/man3/SPI_modifytuple.3 0644 root root 2938 34893 1347419720 1 f none /usr/local/share/man/man3/SPI_palloc.3 0644 root root 1664 57738 1347419720 1 f none /usr/local/share/man/man3/SPI_pfree.3 0644 root root 1752 658 1347419720 1 f none /usr/local/share/man/man3/SPI_pop.3 0644 root root 1508 44478 1347419720 1 f none /usr/local/share/man/man3/SPI_prepare.3 0644 root root 4742 8009 1347419720 1 f none /usr/local/share/man/man3/SPI_prepare_cursor.3 0644 root root 2626 8929 1347419720 1 f none /usr/local/share/man/man3/SPI_prepare_params.3 0644 root root 2432 57597 1347419720 1 f none /usr/local/share/man/man3/SPI_push.3 0644 root root 2274 49164 1347419720 1 f none /usr/local/share/man/man3/SPI_repalloc.3 0644 root root 1987 21471 1347419720 1 f none /usr/local/share/man/man3/SPI_returntuple.3 0644 root root 2209 41611 1347419720 1 f none /usr/local/share/man/man3/SPI_saveplan.3 0644 root root 2498 1103 1347419720 1 f none /usr/local/share/man/man3/SPI_scroll_cursor_fetch.3 0644 root root 2462 58627 1347419720 1 f none /usr/local/share/man/man3/SPI_scroll_cursor_move.3 0644 root root 2510 63003 1347419720 1 f none /usr/local/share/man/man3/dblink.3 0644 root root 6485 11858 1347419720 1 f none /usr/local/share/man/man3/dblink_build_sql_delete.3 0644 root root 3351 2690 1347419720 1 f none /usr/local/share/man/man3/dblink_build_sql_insert.3 0644 root root 3955 55290 1347419720 1 f none /usr/local/share/man/man3/dblink_build_sql_update.3 0644 root root 4208 11649 1347419720 1 f none /usr/local/share/man/man3/dblink_cancel_query.3 0644 root root 2162 36823 1347419720 1 f none /usr/local/share/man/man3/dblink_close.3 0644 root root 2756 19156 1347419720 1 f none /usr/local/share/man/man3/dblink_connect.3 0644 root root 5597 57568 1347419720 1 f none /usr/local/share/man/man3/dblink_connect_u.3 0644 root root 2810 35901 1347419720 1 f none /usr/local/share/man/man3/dblink_disconnect.3 0644 root root 2155 33368 1347419720 1 f none /usr/local/share/man/man3/dblink_error_message.3 0644 root root 1877 10710 1347419720 1 f none /usr/local/share/man/man3/dblink_exec.3 0644 root root 3831 41899 1347419720 1 f none /usr/local/share/man/man3/dblink_fetch.3 0644 root root 4238 14975 1347419720 1 f none /usr/local/share/man/man3/dblink_get_connections.3 0644 root root 1756 509 1347419720 1 f none /usr/local/share/man/man3/dblink_get_notify.3 0644 root root 2547 64712 1347419720 1 f none /usr/local/share/man/man3/dblink_get_pkey.3 0644 root root 2711 13092 1347419720 1 f none /usr/local/share/man/man3/dblink_get_result.3 0644 root root 4993 8095 1347419720 1 f none /usr/local/share/man/man3/dblink_is_busy.3 0644 root root 1871 9466 1347419720 1 f none /usr/local/share/man/man3/dblink_open.3 0644 root root 3270 1427 1347419720 1 f none /usr/local/share/man/man3/dblink_send_query.3 0644 root root 2389 56536 1347419720 1 d none /usr/local/share/man/man5 0755 root root 1 f none /usr/local/share/man/man5/ABORT.5sql 0644 root root 2249 38840 1347419720 1 f none /usr/local/share/man/man5/ALTER_AGGREGATE.5sql 0644 root root 3614 21849 1347419720 1 f none /usr/local/share/man/man5/ALTER_COLLATION.5sql 0644 root root 2867 22957 1347419720 1 f none /usr/local/share/man/man5/ALTER_CONVERSION.5sql 0644 root root 2965 32729 1347419720 1 f none /usr/local/share/man/man5/ALTER_DATABASE.5sql 0644 root root 5407 52474 1347419720 1 f none /usr/local/share/man/man5/ALTER_DEFAULT_PRIVILEGES.5sql 0644 root root 6528 51584 1347419720 1 f none /usr/local/share/man/man5/ALTER_DOMAIN.5sql 0644 root root 6949 33855 1347419720 1 f none /usr/local/share/man/man5/ALTER_EXTENSION.5sql 0644 root root 6703 26197 1347419720 1 f none /usr/local/share/man/man5/ALTER_FOREIGN_DATA_WRAPPER.5sql 0644 root root 4479 27521 1347419720 1 f none /usr/local/share/man/man5/ALTER_FOREIGN_TABLE.5sql 0644 root root 7785 36653 1347419720 1 f none /usr/local/share/man/man5/ALTER_FUNCTION.5sql 0644 root root 7774 42956 1347419720 1 f none /usr/local/share/man/man5/ALTER_GROUP.5sql 0644 root root 3077 42258 1347419720 1 f none /usr/local/share/man/man5/ALTER_INDEX.5sql 0644 root root 4623 38935 1347419720 1 f none /usr/local/share/man/man5/ALTER_LANGUAGE.5sql 0644 root root 2148 28538 1347419720 1 f none /usr/local/share/man/man5/ALTER_LARGE_OBJECT.5sql 0644 root root 2020 19525 1347419720 1 f none /usr/local/share/man/man5/ALTER_OPERATOR.5sql 0644 root root 3082 44361 1347419720 1 f none /usr/local/share/man/man5/ALTER_OPERATOR_CLASS.5sql 0644 root root 2917 29823 1347419720 1 f none /usr/local/share/man/man5/ALTER_OPERATOR_FAMILY.5sql 0644 root root 9305 50336 1347419720 1 f none /usr/local/share/man/man5/ALTER_ROLE.5sql 0644 root root 8431 36513 1347419720 1 f none /usr/local/share/man/man5/ALTER_SCHEMA.5sql 0644 root root 2368 48567 1347419720 1 f none /usr/local/share/man/man5/ALTER_SEQUENCE.5sql 0644 root root 7703 50439 1347419720 1 f none /usr/local/share/man/man5/ALTER_SERVER.5sql 0644 root root 3487 9196 1347419720 1 f none /usr/local/share/man/man5/ALTER_TABLE.5sql 0644 root root 30596 55413 1347419720 1 f none /usr/local/share/man/man5/ALTER_TABLESPACE.5sql 0644 root root 3349 940 1347419720 1 f none /usr/local/share/man/man5/ALTER_TEXT_SEARCH_CONFIGURATION.5sql 0644 root root 4919 65482 1347419720 1 f none /usr/local/share/man/man5/ALTER_TEXT_SEARCH_DICTIONARY.5sql 0644 root root 4131 875 1347419720 1 f none /usr/local/share/man/man5/ALTER_TEXT_SEARCH_PARSER.5sql 0644 root root 2325 42773 1347419720 1 f none /usr/local/share/man/man5/ALTER_TEXT_SEARCH_TEMPLATE.5sql 0644 root root 2363 45874 1347419720 1 f none /usr/local/share/man/man5/ALTER_TRIGGER.5sql 0644 root root 2567 65013 1347419720 1 f none /usr/local/share/man/man5/ALTER_TYPE.5sql 0644 root root 7035 49202 1347419720 1 f none /usr/local/share/man/man5/ALTER_USER.5sql 0644 root root 2410 46578 1347419720 1 f none /usr/local/share/man/man5/ALTER_USER_MAPPING.5sql 0644 root root 3378 65480 1347419720 1 f none /usr/local/share/man/man5/ALTER_VIEW.5sql 0644 root root 3987 51260 1347419720 1 f none /usr/local/share/man/man5/ANALYZE.5sql 0644 root root 7700 7433 1347419720 1 f none /usr/local/share/man/man5/BEGIN.5sql 0644 root root 4184 9843 1347419720 1 f none /usr/local/share/man/man5/CHECKPOINT.5sql 0644 root root 2372 54926 1347419720 1 f none /usr/local/share/man/man5/CLOSE.5sql 0644 root root 2827 24655 1347419720 1 f none /usr/local/share/man/man5/CLUSTER.5sql 0644 root root 6414 19024 1347419720 1 f none /usr/local/share/man/man5/COMMENT.5sql 0644 root root 9213 39363 1347419720 1 f none /usr/local/share/man/man5/COMMIT.5sql 0644 root root 2173 32141 1347419720 1 f none /usr/local/share/man/man5/COMMIT_PREPARED.5sql 0644 root root 2677 12751 1347419720 1 f none /usr/local/share/man/man5/COPY.5sql 0644 root root 26759 31964 1347419720 1 f none /usr/local/share/man/man5/CREATE_AGGREGATE.5sql 0644 root root 9672 46164 1347419720 1 f none /usr/local/share/man/man5/CREATE_CAST.5sql 0644 root root 14412 12550 1347419720 1 f none /usr/local/share/man/man5/CREATE_COLLATION.5sql 0644 root root 4102 65406 1347419720 1 f none /usr/local/share/man/man5/CREATE_CONVERSION.5sql 0644 root root 3914 48756 1347419720 1 f none /usr/local/share/man/man5/CREATE_DATABASE.5sql 0644 root root 8246 35212 1347419720 1 f none /usr/local/share/man/man5/CREATE_DOMAIN.5sql 0644 root root 5501 59781 1347419720 1 f none /usr/local/share/man/man5/CREATE_EXTENSION.5sql 0644 root root 5594 11144 1347419720 1 f none /usr/local/share/man/man5/CREATE_FOREIGN_DATA_WRAPPER.5sql 0644 root root 5205 32783 1347419720 1 f none /usr/local/share/man/man5/CREATE_FOREIGN_TABLE.5sql 0644 root root 4818 55354 1347419720 1 f none /usr/local/share/man/man5/CREATE_FUNCTION.5sql 0644 root root 22095 64284 1347419720 1 f none /usr/local/share/man/man5/CREATE_GROUP.5sql 0644 root root 2222 27733 1347419720 1 f none /usr/local/share/man/man5/CREATE_INDEX.5sql 0644 root root 18915 8517 1347419720 1 f none /usr/local/share/man/man5/CREATE_LANGUAGE.5sql 0644 root root 10100 18650 1347419720 1 f none /usr/local/share/man/man5/CREATE_OPERATOR.5sql 0644 root root 7086 50814 1347419720 1 f none /usr/local/share/man/man5/CREATE_OPERATOR_CLASS.5sql 0644 root root 8748 5282 1347419720 1 f none /usr/local/share/man/man5/CREATE_OPERATOR_FAMILY.5sql 0644 root root 3727 40122 1347419720 1 f none /usr/local/share/man/man5/CREATE_ROLE.5sql 0644 root root 12625 12988 1347419720 1 f none /usr/local/share/man/man5/CREATE_RULE.5sql 0644 root root 8102 19993 1347419720 1 f none /usr/local/share/man/man5/CREATE_SCHEMA.5sql 0644 root root 5428 50496 1347419720 1 f none /usr/local/share/man/man5/CREATE_SEQUENCE.5sql 0644 root root 9505 10557 1347419720 1 f none /usr/local/share/man/man5/CREATE_SERVER.5sql 0644 root root 3771 34572 1347419720 1 f none /usr/local/share/man/man5/CREATE_TABLE.5sql 0644 root root 40334 13745 1347419720 1 f none /usr/local/share/man/man5/CREATE_TABLESPACE.5sql 0644 root root 3604 21823 1347419720 1 f none /usr/local/share/man/man5/CREATE_TABLE_AS.5sql 0644 root root 8135 63490 1347419720 1 f none /usr/local/share/man/man5/CREATE_TEXT_SEARCH_CONFIGURATION.5sql 0644 root root 3323 1958 1347419720 1 f none /usr/local/share/man/man5/CREATE_TEXT_SEARCH_DICTIONARY.5sql 0644 root root 3473 12442 1347419720 1 f none /usr/local/share/man/man5/CREATE_TEXT_SEARCH_PARSER.5sql 0644 root root 3696 34425 1347419720 1 f none /usr/local/share/man/man5/CREATE_TEXT_SEARCH_TEMPLATE.5sql 0644 root root 3512 20464 1347419720 1 f none /usr/local/share/man/man5/CREATE_TRIGGER.5sql 0644 root root 15476 61047 1347419720 1 f none /usr/local/share/man/man5/CREATE_TYPE.5sql 0644 root root 29012 7556 1347419720 1 f none /usr/local/share/man/man5/CREATE_USER.5sql 0644 root root 2539 54653 1347419720 1 f none /usr/local/share/man/man5/CREATE_USER_MAPPING.5sql 0644 root root 3387 1899 1347419720 1 f none /usr/local/share/man/man5/CREATE_VIEW.5sql 0644 root root 7109 64218 1347419720 1 f none /usr/local/share/man/man5/DEALLOCATE.5sql 0644 root root 2096 26204 1347419720 1 f none /usr/local/share/man/man5/DECLARE.5sql 0644 root root 10504 43117 1347419720 1 f none /usr/local/share/man/man5/DELETE.5sql 0644 root root 7576 35293 1347419720 1 f none /usr/local/share/man/man5/DISCARD.5sql 0644 root root 2591 3176 1347419720 1 f none /usr/local/share/man/man5/DO.5sql 0644 root root 3200 54407 1347419720 1 f none /usr/local/share/man/man5/DROP_AGGREGATE.5sql 0644 root root 2639 4243 1347419720 1 f none /usr/local/share/man/man5/DROP_CAST.5sql 0644 root root 2340 44264 1347419720 1 f none /usr/local/share/man/man5/DROP_COLLATION.5sql 0644 root root 2393 47845 1347419720 1 f none /usr/local/share/man/man5/DROP_CONVERSION.5sql 0644 root root 2454 53663 1347419720 1 f none /usr/local/share/man/man5/DROP_DATABASE.5sql 0644 root root 2468 57872 1347419720 1 f none /usr/local/share/man/man5/DROP_DOMAIN.5sql 0644 root root 2302 39464 1347419720 1 f none /usr/local/share/man/man5/DROP_EXTENSION.5sql 0644 root root 2705 10644 1347419720 1 f none /usr/local/share/man/man5/DROP_FOREIGN_DATA_WRAPPER.5sql 0644 root root 2577 61275 1347419720 1 f none /usr/local/share/man/man5/DROP_FOREIGN_TABLE.5sql 0644 root root 2564 61586 1347419720 1 f none /usr/local/share/man/man5/DROP_FUNCTION.5sql 0644 root root 3344 339 1347419720 1 f none /usr/local/share/man/man5/DROP_GROUP.5sql 0644 root root 1638 51591 1347419720 1 f none /usr/local/share/man/man5/DROP_INDEX.5sql 0644 root root 3177 53363 1347419720 1 f none /usr/local/share/man/man5/DROP_LANGUAGE.5sql 0644 root root 2835 18953 1347419720 1 f none /usr/local/share/man/man5/DROP_OPERATOR.5sql 0644 root root 2968 30322 1347419720 1 f none /usr/local/share/man/man5/DROP_OPERATOR_CLASS.5sql 0644 root root 3461 9115 1347419720 1 f none /usr/local/share/man/man5/DROP_OPERATOR_FAMILY.5sql 0644 root root 3235 54559 1347419720 1 f none /usr/local/share/man/man5/DROP_OWNED.5sql 0644 root root 2854 26469 1347419720 1 f none /usr/local/share/man/man5/DROP_ROLE.5sql 0644 root root 3055 42553 1347419720 1 f none /usr/local/share/man/man5/DROP_RULE.5sql 0644 root root 2248 35865 1347419720 1 f none /usr/local/share/man/man5/DROP_SCHEMA.5sql 0644 root root 2612 1707 1347419720 1 f none /usr/local/share/man/man5/DROP_SEQUENCE.5sql 0644 root root 2433 51499 1347419720 1 f none /usr/local/share/man/man5/DROP_SERVER.5sql 0644 root root 2353 44067 1347419720 1 f none /usr/local/share/man/man5/DROP_TABLE.5sql 0644 root root 2945 31785 1347419720 1 f none /usr/local/share/man/man5/DROP_TABLESPACE.5sql 0644 root root 2576 78 1347419720 1 f none /usr/local/share/man/man5/DROP_TEXT_SEARCH_CONFIGURATION.5sql 0644 root root 2830 20437 1347419720 1 f none /usr/local/share/man/man5/DROP_TEXT_SEARCH_DICTIONARY.5sql 0644 root root 2739 12229 1347419720 1 f none /usr/local/share/man/man5/DROP_TEXT_SEARCH_PARSER.5sql 0644 root root 2639 3401 1347419720 1 f none /usr/local/share/man/man5/DROP_TEXT_SEARCH_TEMPLATE.5sql 0644 root root 2677 6542 1347419720 1 f none /usr/local/share/man/man5/DROP_TRIGGER.5sql 0644 root root 2576 65449 1347419720 1 f none /usr/local/share/man/man5/DROP_TYPE.5sql 0644 root root 2490 57187 1347419720 1 f none /usr/local/share/man/man5/DROP_USER.5sql 0644 root root 1702 57707 1347419720 1 f none /usr/local/share/man/man5/DROP_USER_MAPPING.5sql 0644 root root 2657 4306 1347419720 1 f none /usr/local/share/man/man5/DROP_VIEW.5sql 0644 root root 2394 48866 1347419720 1 f none /usr/local/share/man/man5/END.5sql 0644 root root 2265 40199 1347419720 1 f none /usr/local/share/man/man5/EXECUTE.5sql 0644 root root 3034 46233 1347419720 1 f none /usr/local/share/man/man5/EXPLAIN.5sql 0644 root root 13203 13114 1347419720 1 f none /usr/local/share/man/man5/FETCH.5sql 0644 root root 8727 47513 1347419720 1 f none /usr/local/share/man/man5/GRANT.5sql 0644 root root 21607 44659 1347419720 1 f none /usr/local/share/man/man5/INSERT.5sql 0644 root root 8951 8641 1347419720 1 f none /usr/local/share/man/man5/LISTEN.5sql 0644 root root 3621 35096 1347419720 1 f none /usr/local/share/man/man5/LOAD.5sql 0644 root root 2645 13315 1347419720 1 f none /usr/local/share/man/man5/LOCK.5sql 0644 root root 7972 8098 1347419720 1 f none /usr/local/share/man/man5/MOVE.5sql 0644 root root 3034 30914 1347419720 1 f none /usr/local/share/man/man5/NOTIFY.5sql 0644 root root 8154 56763 1347419720 1 f none /usr/local/share/man/man5/PREPARE.5sql 0644 root root 6352 15495 1347419720 1 f none /usr/local/share/man/man5/PREPARE_TRANSACTION.5sql 0644 root root 5900 37134 1347419720 1 f none /usr/local/share/man/man5/REASSIGN_OWNED.5sql 0644 root root 3134 49730 1347419720 1 f none /usr/local/share/man/man5/REINDEX.5sql 0644 root root 8039 21596 1347419720 1 f none /usr/local/share/man/man5/RELEASE_SAVEPOINT.5sql 0644 root root 3139 49779 1347419720 1 f none /usr/local/share/man/man5/RESET.5sql 0644 root root 3029 44847 1347419720 1 f none /usr/local/share/man/man5/REVOKE.5sql 0644 root root 10714 6386 1347419720 1 f none /usr/local/share/man/man5/ROLLBACK.5sql 0644 root root 2172 30471 1347419720 1 f none /usr/local/share/man/man5/ROLLBACK_PREPARED.5sql 0644 root root 2702 14383 1347419720 1 f none /usr/local/share/man/man5/ROLLBACK_TO_SAVEPOINT.5sql 0644 root root 4102 64973 1347419720 1 f none /usr/local/share/man/man5/SAVEPOINT.5sql 0644 root root 3639 23106 1347419720 1 f none /usr/local/share/man/man5/SECURITY_LABEL.5sql 0644 root root 5421 52744 1347419720 1 f none /usr/local/share/man/man5/SELECT.5sql 0644 root root 53674 35360 1347419720 1 f none /usr/local/share/man/man5/SELECT_INTO.5sql 0644 root root 4635 30826 1347419720 1 f none /usr/local/share/man/man5/SET.5sql 0644 root root 7642 44585 1347419720 1 f none /usr/local/share/man/man5/SET_CONSTRAINTS.5sql 0644 root root 4669 59825 1347419720 1 f none /usr/local/share/man/man5/SET_ROLE.5sql 0644 root root 4486 35384 1347419720 1 f none /usr/local/share/man/man5/SET_SESSION_AUTHORIZATION.5sql 0644 root root 4013 61308 1347419720 1 f none /usr/local/share/man/man5/SET_TRANSACTION.5sql 0644 root root 8646 13385 1347419720 1 f none /usr/local/share/man/man5/SHOW.5sql 0644 root root 4347 14736 1347419720 1 f none /usr/local/share/man/man5/START_TRANSACTION.5sql 0644 root root 3004 36805 1347419720 1 f none /usr/local/share/man/man5/TABLE.5sql 0644 root root 21 1613 1347419720 1 f none /usr/local/share/man/man5/TRUNCATE.5sql 0644 root root 6924 58938 1347419720 1 f none /usr/local/share/man/man5/UNLISTEN.5sql 0644 root root 2842 24918 1347419720 1 f none /usr/local/share/man/man5/UPDATE.5sql 0644 root root 10747 48240 1347419720 1 f none /usr/local/share/man/man5/VACUUM.5sql 0644 root root 8613 4580 1347419720 1 f none /usr/local/share/man/man5/VALUES.5sql 0644 root root 7140 46198 1347419720 1 f none /usr/local/share/man/man5/WITH.5sql 0644 root root 21 1613 1347419720 1 d none /usr/local/share/postgresql 0755 root root 1 f none /usr/local/share/postgresql/conversion_create.sql 0644 root root 74932 16952 1347419722 1 d none /usr/local/share/postgresql/extension 0755 root root 1 f none /usr/local/share/postgresql/extension/adminpack--1.0.sql 0644 root root 1535 55172 1347419725 1 f none /usr/local/share/postgresql/extension/adminpack.control 0644 root root 176 15922 1347419725 1 f none /usr/local/share/postgresql/extension/autoinc--1.0.sql 0644 root root 249 19868 1347419728 1 f none /usr/local/share/postgresql/extension/autoinc--unpackaged--1.0.sql 0644 root root 234 19493 1347419728 1 f none /usr/local/share/postgresql/extension/autoinc.control 0644 root root 149 13551 1347419728 1 f none /usr/local/share/postgresql/extension/btree_gin--1.0.sql 0644 root root 24818 50641 1347419726 1 f none /usr/local/share/postgresql/extension/btree_gin--unpackaged--1.0.sql 0644 root root 10091 1722 1347419726 1 f none /usr/local/share/postgresql/extension/btree_gin.control 0644 root root 160 14395 1347419725 1 f none /usr/local/share/postgresql/extension/btree_gist--1.0.sql 0644 root root 37814 841 1347419726 1 f none /usr/local/share/postgresql/extension/btree_gist--unpackaged--1.0.sql 0644 root root 21463 53290 1347419726 1 f none /usr/local/share/postgresql/extension/btree_gist.control 0644 root root 163 14758 1347419726 1 f none /usr/local/share/postgresql/extension/chkpass--1.0.sql 0644 root root 1154 22673 1347419726 1 f none /usr/local/share/postgresql/extension/chkpass--unpackaged--1.0.sql 0644 root root 619 52275 1347419726 1 f none /usr/local/share/postgresql/extension/chkpass.control 0644 root root 150 13549 1347419726 1 f none /usr/local/share/postgresql/extension/citext--1.0.sql 0644 root root 12337 52626 1347419726 1 f none /usr/local/share/postgresql/extension/citext--unpackaged--1.0.sql 0644 root root 8694 17079 1347419726 1 f none /usr/local/share/postgresql/extension/citext.control 0644 root root 158 14316 1347419726 1 f none /usr/local/share/postgresql/extension/cube--1.0.sql 0644 root root 7831 54747 1347419726 1 f none /usr/local/share/postgresql/extension/cube--unpackaged--1.0.sql 0644 root root 3179 6767 1347419726 1 f none /usr/local/share/postgresql/extension/cube.control 0644 root root 142 12679 1347419726 1 f none /usr/local/share/postgresql/extension/dblink--1.0.sql 0644 root root 5569 50377 1347419726 1 f none /usr/local/share/postgresql/extension/dblink--unpackaged--1.0.sql 0644 root root 2847 52141 1347419726 1 f none /usr/local/share/postgresql/extension/dblink.control 0644 root root 170 15238 1347419726 1 f none /usr/local/share/postgresql/extension/dict_int--1.0.sql 0644 root root 711 54377 1347419726 1 f none /usr/local/share/postgresql/extension/dict_int--unpackaged--1.0.sql 0644 root root 477 41646 1347419726 1 f none /usr/local/share/postgresql/extension/dict_int.control 0644 root root 158 14343 1347419726 1 f none /usr/local/share/postgresql/extension/dict_xsyn--1.0.sql 0644 root root 694 52924 1347419726 1 f none /usr/local/share/postgresql/extension/dict_xsyn--unpackaged--1.0.sql 0644 root root 472 41451 1347419726 1 f none /usr/local/share/postgresql/extension/dict_xsyn.control 0644 root root 179 16543 1347419726 1 f none /usr/local/share/postgresql/extension/earthdistance--1.0.sql 0644 root root 3096 46938 1347419726 1 f none /usr/local/share/postgresql/extension/earthdistance--unpackaged--1.0.sql 0644 root root 943 17025 1347419726 1 f none /usr/local/share/postgresql/extension/earthdistance.control 0644 root root 202 18215 1347419726 1 f none /usr/local/share/postgresql/extension/file_fdw--1.0.sql 0644 root root 475 37941 1347419726 1 f none /usr/local/share/postgresql/extension/file_fdw.control 0644 root root 155 13864 1347419726 1 f none /usr/local/share/postgresql/extension/fuzzystrmatch--1.0.sql 0644 root root 1436 48605 1347419726 1 f none /usr/local/share/postgresql/extension/fuzzystrmatch--unpackaged--1.0.sql 0644 root root 1092 29830 1347419726 1 f none /usr/local/share/postgresql/extension/fuzzystrmatch.control 0644 root root 175 16272 1347419726 1 f none /usr/local/share/postgresql/extension/hstore--1.0--1.1.sql 0644 root root 280 22033 1347419726 1 f none /usr/local/share/postgresql/extension/hstore--1.1.sql 0644 root root 12322 63009 1347419726 1 f none /usr/local/share/postgresql/extension/hstore--unpackaged--1.0.sql 0644 root root 5493 19041 1347419726 1 f none /usr/local/share/postgresql/extension/hstore.control 0644 root root 158 14016 1347419726 1 f none /usr/local/share/postgresql/extension/insert_username--1.0.sql 0644 root root 273 22463 1347419728 1 f none /usr/local/share/postgresql/extension/insert_username--unpackaged--1.0.sql 0644 root root 266 22953 1347419728 1 f none /usr/local/share/postgresql/extension/insert_username.control 0644 root root 170 15538 1347419728 1 f none /usr/local/share/postgresql/extension/intagg--1.0.sql 0644 root root 1041 22141 1347419726 1 f none /usr/local/share/postgresql/extension/intagg--unpackaged--1.0.sql 0644 root root 452 39006 1347419726 1 f none /usr/local/share/postgresql/extension/intagg.control 0644 root root 119 10675 1347419726 1 f none /usr/local/share/postgresql/extension/intarray--1.0.sql 0644 root root 10473 62938 1347419726 1 f none /usr/local/share/postgresql/extension/intarray--unpackaged--1.0.sql 0644 root root 6755 4808 1347419726 1 f none /usr/local/share/postgresql/extension/intarray.control 0644 root root 176 15795 1347419726 1 f none /usr/local/share/postgresql/extension/isn--1.0.sql 0644 root root 66205 43539 1347419726 1 f none /usr/local/share/postgresql/extension/isn--unpackaged--1.0.sql 0644 root root 23689 63473 1347419726 1 f none /usr/local/share/postgresql/extension/isn.control 0644 root root 160 14532 1347419726 1 f none /usr/local/share/postgresql/extension/lo--1.0.sql 0644 root root 708 57927 1347419727 1 f none /usr/local/share/postgresql/extension/lo--unpackaged--1.0.sql 0644 root root 298 24051 1347419727 1 f none /usr/local/share/postgresql/extension/lo.control 0644 root root 126 11025 1347419727 1 f none /usr/local/share/postgresql/extension/ltree--1.0.sql 0644 root root 18297 17636 1347419727 1 f none /usr/local/share/postgresql/extension/ltree--unpackaged--1.0.sql 0644 root root 7982 33494 1347419727 1 f none /usr/local/share/postgresql/extension/ltree.control 0644 root root 155 13974 1347419727 1 f none /usr/local/share/postgresql/extension/moddatetime--1.0.sql 0644 root root 261 21098 1347419728 1 f none /usr/local/share/postgresql/extension/moddatetime--unpackaged--1.0.sql 0644 root root 250 21133 1347419728 1 f none /usr/local/share/postgresql/extension/moddatetime.control 0644 root root 165 15068 1347419728 1 f none /usr/local/share/postgresql/extension/pageinspect--1.0.sql 0644 root root 2339 49575 1347419727 1 f none /usr/local/share/postgresql/extension/pageinspect--unpackaged--1.0.sql 0644 root root 1100 28168 1347419727 1 f none /usr/local/share/postgresql/extension/pageinspect.control 0644 root root 173 15611 1347419727 1 f none /usr/local/share/postgresql/extension/pg_buffercache--1.0.sql 0644 root root 755 63160 1347419727 1 f none /usr/local/share/postgresql/extension/pg_buffercache--unpackaged--1.0.sql 0644 root root 335 28822 1347419727 1 f none /usr/local/share/postgresql/extension/pg_buffercache.control 0644 root root 157 14123 1347419727 1 f none /usr/local/share/postgresql/extension/pg_freespacemap--1.0.sql 0644 root root 871 6061 1347419727 1 f none /usr/local/share/postgresql/extension/pg_freespacemap--unpackaged--1.0.sql 0644 root root 359 31338 1347419727 1 f none /usr/local/share/postgresql/extension/pg_freespacemap.control 0644 root root 160 14213 1347419727 1 f none /usr/local/share/postgresql/extension/pg_stat_statements--1.0--1.1.sql 0644 root root 1237 36608 1347419727 1 f none /usr/local/share/postgresql/extension/pg_stat_statements--1.1.sql 0644 root root 1205 33384 1347419727 1 f none /usr/local/share/postgresql/extension/pg_stat_statements--unpackaged--1.0.sql 0644 root root 433 38696 1347419727 1 f none /usr/local/share/postgresql/extension/pg_stat_statements.control 0644 root root 191 17722 1347419727 1 f none /usr/local/share/postgresql/extension/pg_trgm--1.0.sql 0644 root root 4977 46103 1347419727 1 f none /usr/local/share/postgresql/extension/pg_trgm--unpackaged--1.0.sql 0644 root root 4230 23225 1347419727 1 f none /usr/local/share/postgresql/extension/pg_trgm.control 0644 root root 177 16172 1347419727 1 f none /usr/local/share/postgresql/extension/pgcrypto--1.0.sql 0644 root root 4812 52313 1347419727 1 f none /usr/local/share/postgresql/extension/pgcrypto--unpackaged--1.0.sql 0644 root root 2433 19577 1347419727 1 f none /usr/local/share/postgresql/extension/pgcrypto.control 0644 root root 137 12478 1347419727 1 f none /usr/local/share/postgresql/extension/pgrowlocks--1.0.sql 0644 root root 534 41617 1347419727 1 f none /usr/local/share/postgresql/extension/pgrowlocks--unpackaged--1.0.sql 0644 root root 257 22089 1347419727 1 f none /usr/local/share/postgresql/extension/pgrowlocks.control 0644 root root 152 13879 1347419727 1 f none /usr/local/share/postgresql/extension/pgstattuple--1.0.sql 0644 root root 1910 20325 1347419728 1 f none /usr/local/share/postgresql/extension/pgstattuple--unpackaged--1.0.sql 0644 root root 441 38463 1347419728 1 f none /usr/local/share/postgresql/extension/pgstattuple.control 0644 root root 147 13451 1347419728 1 f none /usr/local/share/postgresql/extension/plpgsql--1.0.sql 0644 root root 332 27082 1347419725 1 f none /usr/local/share/postgresql/extension/plpgsql--unpackaged--1.0.sql 0644 root root 381 31702 1347419725 1 f none /usr/local/share/postgresql/extension/plpgsql.control 0644 root root 179 15991 1347419725 1 f none /usr/local/share/postgresql/extension/pltcl--1.0.sql 0644 root root 316 25411 1347419725 1 f none /usr/local/share/postgresql/extension/pltcl--unpackaged--1.0.sql 0644 root root 231 18450 1347419725 1 f none /usr/local/share/postgresql/extension/pltcl.control 0644 root root 173 15371 1347419725 1 f none /usr/local/share/postgresql/extension/pltclu--1.0.sql 0644 root root 330 26885 1347419725 1 f none /usr/local/share/postgresql/extension/pltclu--unpackaged--1.0.sql 0644 root root 236 19035 1347419725 1 f none /usr/local/share/postgresql/extension/pltclu.control 0644 root root 184 16536 1347419725 1 f none /usr/local/share/postgresql/extension/refint--1.0.sql 0644 root root 343 27206 1347419728 1 f none /usr/local/share/postgresql/extension/refint--unpackaged--1.0.sql 0644 root root 298 25099 1347419728 1 f none /usr/local/share/postgresql/extension/refint.control 0644 root root 169 15437 1347419728 1 f none /usr/local/share/postgresql/extension/seg--1.0.sql 0644 root root 7726 37487 1347419728 1 f none /usr/local/share/postgresql/extension/seg--unpackaged--1.0.sql 0644 root root 2766 32953 1347419728 1 f none /usr/local/share/postgresql/extension/seg.control 0644 root root 172 15615 1347419728 1 f none /usr/local/share/postgresql/extension/sslinfo--1.0.sql 0644 root root 1153 25468 1347419728 1 f none /usr/local/share/postgresql/extension/sslinfo--unpackaged--1.0.sql 0644 root root 830 3606 1347419728 1 f none /usr/local/share/postgresql/extension/sslinfo.control 0644 root root 146 13147 1347419728 1 f none /usr/local/share/postgresql/extension/tablefunc--1.0.sql 0644 root root 2153 42550 1347419728 1 f none /usr/local/share/postgresql/extension/tablefunc--unpackaged--1.0.sql 0644 root root 1144 34768 1347419728 1 f none /usr/local/share/postgresql/extension/tablefunc.control 0644 root root 174 15900 1347419728 1 f none /usr/local/share/postgresql/extension/tcn--1.0.sql 0644 root root 274 22381 1347419728 1 f none /usr/local/share/postgresql/extension/tcn.control 0644 root root 134 11933 1347419728 1 f none /usr/local/share/postgresql/extension/test_parser--1.0.sql 0644 root root 814 64847 1347419728 1 f none /usr/local/share/postgresql/extension/test_parser--unpackaged--1.0.sql 0644 root root 559 49683 1347419728 1 f none /usr/local/share/postgresql/extension/test_parser.control 0644 root root 167 15162 1347419728 1 f none /usr/local/share/postgresql/extension/timetravel--1.0.sql 0644 root root 486 37699 1347419728 1 f none /usr/local/share/postgresql/extension/timetravel--unpackaged--1.0.sql 0644 root root 378 32539 1347419728 1 f none /usr/local/share/postgresql/extension/timetravel.control 0644 root root 156 14262 1347419728 1 f none /usr/local/share/postgresql/extension/tsearch2--1.0.sql 0644 root root 15712 61127 1347419728 1 f none /usr/local/share/postgresql/extension/tsearch2--unpackaged--1.0.sql 0644 root root 9090 13125 1347419728 1 f none /usr/local/share/postgresql/extension/tsearch2.control 0644 root root 313 28094 1347419728 1 f none /usr/local/share/postgresql/extension/unaccent--1.0.sql 0644 root root 854 1374 1347419728 1 f none /usr/local/share/postgresql/extension/unaccent--unpackaged--1.0.sql 0644 root root 750 64613 1347419728 1 f none /usr/local/share/postgresql/extension/unaccent.control 0644 root root 157 14236 1347419728 1 f none /usr/local/share/postgresql/extension/xml2--1.0.sql 0644 root root 1867 15364 1347419728 1 f none /usr/local/share/postgresql/extension/xml2--unpackaged--1.0.sql 0644 root root 1325 48085 1347419728 1 f none /usr/local/share/postgresql/extension/xml2.control 0644 root root 208 18230 1347419728 1 f none /usr/local/share/postgresql/information_schema.sql 0644 root root 106299 41008 1347419721 1 f none /usr/local/share/postgresql/pg_hba.conf.sample 0644 root root 4420 35114 1347419721 1 f none /usr/local/share/postgresql/pg_ident.conf.sample 0644 root root 1636 5990 1347419721 1 f none /usr/local/share/postgresql/pg_service.conf.sample 0644 root root 604 53878 1347419723 1 f none /usr/local/share/postgresql/postgres.bki 0644 root root 519298 5463 1347419721 1 f none /usr/local/share/postgresql/postgres.description 0644 root root 98573 8879 1347419721 1 f none /usr/local/share/postgresql/postgres.shdescription 0644 root root 49 4530 1347419721 1 f none /usr/local/share/postgresql/postgresql.conf.sample 0644 root root 19579 64258 1347419721 1 f none /usr/local/share/postgresql/psqlrc.sample 0644 root root 211 18203 1347419724 1 f none /usr/local/share/postgresql/recovery.conf.sample 0644 root root 4704 50755 1347419721 1 f none /usr/local/share/postgresql/snowball_create.sql 0644 root root 13337 37703 1347419723 1 f none /usr/local/share/postgresql/sql_features.txt 0644 root root 33035 51692 1347419721 1 f none /usr/local/share/postgresql/system_views.sql 0644 root root 27302 25797 1347419721 1 d none /usr/local/share/postgresql/timezone 0755 root root 1 d none /usr/local/share/postgresql/timezone/Africa 0755 root root 1 f none /usr/local/share/postgresql/timezone/Africa/Abidjan 0644 root root 156 5984 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Accra 0644 root root 378 37100 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Addis_Ababa 0644 root root 180 7157 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Algiers 0644 root root 734 62353 1347419720 1 l none /usr/local/share/postgresql/timezone/Africa/Asmara=/usr/local/share/postgresql/timezone/Africa/Asmera 1 f none /usr/local/share/postgresql/timezone/Africa/Asmera 0644 root root 201 9012 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Bamako 0644 root root 208 12622 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Bangui 0644 root root 157 4570 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Banjul 0644 root root 232 14560 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Bissau 0644 root root 194 8834 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Blantyre 0644 root root 157 4901 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Brazzaville 0644 root root 157 4570 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Bujumbura 0644 root root 140 3870 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Cairo 0644 root root 1906 36864 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Casablanca 0644 root root 1346 27095 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Ceuta 0644 root root 2049 1023 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Conakry 0644 root root 208 12712 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Dakar 0644 root root 194 10846 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Dar_es_Salaam 0644 root root 213 11094 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Djibouti 0644 root root 157 4878 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Douala 0644 root root 157 4570 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/El_Aaiun 0644 root root 194 10028 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Freetown 0644 root root 665 11978 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Gaborone 0644 root root 194 8500 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Harare 0644 root root 157 4391 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Johannesburg 0644 root root 245 14912 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Juba 0644 root root 669 33364 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Kampala 0644 root root 253 13934 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Khartoum 0644 root root 669 32854 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Kigali 0644 root root 157 4481 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Kinshasa 0644 root root 140 3539 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Lagos 0644 root root 157 4510 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Libreville 0644 root root 157 5080 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Lome 0644 root root 139 3391 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Luanda 0644 root root 178 6113 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Lubumbashi 0644 root root 140 3540 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Lusaka 0644 root root 157 4901 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Malabo 0644 root root 195 7532 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Maputo 0644 root root 157 4901 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Maseru 0644 root root 204 9670 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Mbabane 0644 root root 160 4690 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Mogadishu 0644 root root 194 9300 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Monrovia 0644 root root 215 12455 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Nairobi 0644 root root 253 14654 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Ndjamena 0644 root root 211 6812 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Niamey 0644 root root 225 11818 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Nouakchott 0644 root root 208 13432 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Ouagadougou 0644 root root 156 6494 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Porto-Novo 0644 root root 195 7382 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Sao_Tome 0644 root root 173 7551 1347419720 1 l none /usr/local/share/postgresql/timezone/Africa/Timbuktu=/usr/local/share/postgresql/timezone/Africa/Bamako 1 f none /usr/local/share/postgresql/timezone/Africa/Tripoli 0644 root root 599 40497 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Tunis 0644 root root 684 51500 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Windhoek 0644 root root 1556 23610 1347419720 1 d none /usr/local/share/postgresql/timezone/America 0755 root root 1 l none /usr/local/share/postgresql/timezone/America/Adak=/usr/local/share/postgresql/timezone/America/Atka 1 f none /usr/local/share/postgresql/timezone/America/Anchorage 0644 root root 2358 26983 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Anguilla 0644 root root 156 7400 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Antigua 0644 root root 194 11842 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Araguaina 0644 root root 854 15298 1347419720 1 d none /usr/local/share/postgresql/timezone/America/Argentina 0755 root root 1 f none /usr/local/share/postgresql/timezone/America/Argentina/Buenos_Aires 0644 root root 1061 57344 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Argentina/Catamarca 0644 root root 1087 59834 1347419720 1 l none /usr/local/share/postgresql/timezone/America/Argentina/ComodRivadavia=/usr/local/share/postgresql/timezone/America/Argentina/Catamarca 1 f none /usr/local/share/postgresql/timezone/America/Argentina/Cordoba 0644 root root 1087 60145 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Argentina/Jujuy 0644 root root 1087 61777 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Argentina/La_Rioja 0644 root root 1101 60325 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Argentina/Mendoza 0644 root root 1115 63114 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Argentina/Rio_Gallegos 0644 root root 1087 59772 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Argentina/Salta 0644 root root 1059 58025 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Argentina/San_Juan 0644 root root 1101 60070 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Argentina/San_Luis 0644 root root 1125 64168 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Argentina/Tucuman 0644 root root 1115 62329 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Argentina/Ushuaia 0644 root root 1087 59697 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Aruba 0644 root root 194 11764 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Asuncion 0644 root root 2020 2515 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Atikokan 0644 root root 319 28726 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Atka 0644 root root 2353 31091 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Bahia 0644 root root 1777 8238 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Bahia_Banderas 0644 root root 1558 44889 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Barbados 0644 root root 330 21178 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Belem 0644 root root 574 63873 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Belize 0644 root root 962 59845 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Blanc-Sablon 0644 root root 281 24420 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Boa_Vista 0644 root root 630 2799 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Bogota 0644 root root 231 13834 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Boise 0644 root root 2377 27205 1347419720 1 l none /usr/local/share/postgresql/timezone/America/Buenos_Aires=/usr/local/share/postgresql/timezone/America/Argentina/Buenos_Aires 1 f none /usr/local/share/postgresql/timezone/America/Cambridge_Bay 0644 root root 2052 714 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Campo_Grande 0644 root root 2001 26193 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Cancun 0644 root root 1450 32355 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Caracas 0644 root root 224 14676 1347419720 1 l none /usr/local/share/postgresql/timezone/America/Catamarca=/usr/local/share/postgresql/timezone/America/Argentina/Catamarca 1 f none /usr/local/share/postgresql/timezone/America/Cayenne 0644 root root 186 12292 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Cayman 0644 root root 177 9618 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Chicago 0644 root root 3543 26898 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Chihuahua 0644 root root 1492 29758 1347419720 1 l none /usr/local/share/postgresql/timezone/America/Coral_Harbour=/usr/local/share/postgresql/timezone/America/Atikokan 1 l none /usr/local/share/postgresql/timezone/America/Cordoba=/usr/local/share/postgresql/timezone/America/Argentina/Cordoba 1 f none /usr/local/share/postgresql/timezone/America/Costa_Rica 0644 root root 315 18724 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Creston 0644 root root 191 12056 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Cuiaba 0644 root root 1973 24593 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Curacao 0644 root root 194 11764 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Danmarkshavn 0644 root root 700 40484 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Dawson 0644 root root 2067 10138 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Dawson_Creek 0644 root root 1033 62916 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Denver 0644 root root 2427 36179 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Detroit 0644 root root 2202 32128 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Dominica 0644 root root 156 7640 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Edmonton 0644 root root 2388 36832 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Eirunepe 0644 root root 640 4331 1347419720 1 f none /usr/local/share/postgresql/timezone/America/El_Salvador 0644 root root 236 13512 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Ensenada 0644 root root 2342 44117 1347419720 1 l none /usr/local/share/postgresql/timezone/America/Fort_Wayne=/usr/local/share/postgresql/timezone/America/Indianapolis 1 f none /usr/local/share/postgresql/timezone/America/Fortaleza 0644 root root 714 7958 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Glace_Bay 0644 root root 2192 25601 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Godthab 0644 root root 8296 56379 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Goose_Bay 0644 root root 3177 44944 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Grand_Turk 0644 root root 1871 63699 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Grenada 0644 root root 156 7520 1347419720 1 l none /usr/local/share/postgresql/timezone/America/Guadeloupe=/usr/local/share/postgresql/timezone/America/St_Barthelemy 1 f none /usr/local/share/postgresql/timezone/America/Guatemala 0644 root root 292 17312 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Guayaquil 0644 root root 177 9717 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Guyana 0644 root root 256 17404 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Halifax 0644 root root 3424 16864 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Havana 0644 root root 2411 62017 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Hermosillo 0644 root root 424 34895 1347419720 1 d none /usr/local/share/postgresql/timezone/America/Indiana 0755 root root 1 l none /usr/local/share/postgresql/timezone/America/Indiana/Indianapolis=/usr/local/share/postgresql/timezone/America/Indianapolis 1 l none /usr/local/share/postgresql/timezone/America/Indiana/Knox=/usr/local/share/postgresql/timezone/America/Knox_IN 1 f none /usr/local/share/postgresql/timezone/America/Indiana/Marengo 0644 root root 1705 23078 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Indiana/Petersburg 0644 root root 1887 44898 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Indiana/Tell_City 0644 root root 1677 27456 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Indiana/Vevay 0644 root root 1397 48217 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Indiana/Vincennes 0644 root root 1677 32576 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Indiana/Winamac 0644 root root 1761 46389 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Indianapolis 0644 root root 1649 27497 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Inuvik 0644 root root 1914 49021 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Iqaluit 0644 root root 2000 13720 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Jamaica 0644 root root 481 28533 1347419720 1 l none /usr/local/share/postgresql/timezone/America/Jujuy=/usr/local/share/postgresql/timezone/America/Argentina/Jujuy 1 f none /usr/local/share/postgresql/timezone/America/Juneau 0644 root root 2336 21616 1347419720 1 d none /usr/local/share/postgresql/timezone/America/Kentucky 0755 root root 1 f none /usr/local/share/postgresql/timezone/America/Kentucky/Louisville 0644 root root 2755 47219 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Kentucky/Monticello 0644 root root 2335 38401 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Knox_IN 0644 root root 2395 16709 1347419720 1 l none /usr/local/share/postgresql/timezone/America/Kralendijk=/usr/local/share/postgresql/timezone/America/Curacao 1 f none /usr/local/share/postgresql/timezone/America/La_Paz 0644 root root 217 14860 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Lima 0644 root root 395 32150 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Los_Angeles 0644 root root 2819 38311 1347419720 1 l none /usr/local/share/postgresql/timezone/America/Louisville=/usr/local/share/postgresql/timezone/America/Kentucky/Louisville 1 l none /usr/local/share/postgresql/timezone/America/Lower_Princes=/usr/local/share/postgresql/timezone/America/Curacao 1 f none /usr/local/share/postgresql/timezone/America/Maceio 0644 root root 742 9288 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Managua 0644 root root 421 25986 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Manaus 0644 root root 602 149 1347419720 1 l none /usr/local/share/postgresql/timezone/America/Marigot=/usr/local/share/postgresql/timezone/America/St_Barthelemy 1 f none /usr/local/share/postgresql/timezone/America/Martinique 0644 root root 231 14095 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Matamoros 0644 root root 1402 25394 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Mazatlan 0644 root root 1534 35102 1347419720 1 l none /usr/local/share/postgresql/timezone/America/Mendoza=/usr/local/share/postgresql/timezone/America/Argentina/Mendoza 1 f none /usr/local/share/postgresql/timezone/America/Menominee 0644 root root 2241 28442 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Merida 0644 root root 1426 28217 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Metlakatla 0644 root root 717 44064 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Mexico_City 0644 root root 1604 58057 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Miquelon 0644 root root 1670 44401 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Moncton 0644 root root 3137 47231 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Monterrey 0644 root root 1402 26265 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Montevideo 0644 root root 2118 63039 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Montreal 0644 root root 3477 38312 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Montserrat 0644 root root 156 7640 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Nassau 0644 root root 2270 40966 1347419720 1 f none /usr/local/share/postgresql/timezone/America/New_York 0644 root root 3519 46774 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Nipigon 0644 root root 2105 22275 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Nome 0644 root root 2350 28432 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Noronha 0644 root root 714 6427 1347419720 1 d none /usr/local/share/postgresql/timezone/America/North_Dakota 0755 root root 1 f none /usr/local/share/postgresql/timezone/America/North_Dakota/Beulah 0644 root root 2363 27674 1347419720 1 f none /usr/local/share/postgresql/timezone/America/North_Dakota/Center 0644 root root 2363 30762 1347419720 1 f none /usr/local/share/postgresql/timezone/America/North_Dakota/New_Salem 0644 root root 2363 28564 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Ojinaga 0644 root root 1492 33615 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Panama 0644 root root 177 10127 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Pangnirtung 0644 root root 2062 22092 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Paramaribo 0644 root root 294 21242 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Phoenix 0644 root root 327 31330 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Port-au-Prince 0644 root root 739 47005 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Port_of_Spain 0644 root root 156 7400 1347419720 1 l none /usr/local/share/postgresql/timezone/America/Porto_Acre=/usr/local/share/postgresql/timezone/America/Rio_Branco 1 f none /usr/local/share/postgresql/timezone/America/Porto_Velho 0644 root root 574 63874 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Puerto_Rico 0644 root root 229 17996 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Rainy_River 0644 root root 2105 12146 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Rankin_Inlet 0644 root root 1900 58156 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Recife 0644 root root 714 8078 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Regina 0644 root root 980 62715 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Resolute 0644 root root 1900 58640 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Rio_Branco 0644 root root 612 2401 1347419720 1 l none /usr/local/share/postgresql/timezone/America/Rosario=/usr/local/share/postgresql/timezone/America/Argentina/Cordoba 1 f none /usr/local/share/postgresql/timezone/America/Santa_Isabel 0644 root root 2342 40052 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Santarem 0644 root root 612 1408 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Santiago 0644 root root 9245 52728 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Santo_Domingo 0644 root root 463 34891 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Sao_Paulo 0644 root root 2001 22898 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Scoresbysund 0644 root root 1911 49060 1347419720 1 l none /usr/local/share/postgresql/timezone/America/Shiprock=/usr/local/share/postgresql/timezone/America/Denver 1 f none /usr/local/share/postgresql/timezone/America/Sitka 0644 root root 2324 20130 1347419720 1 f none /usr/local/share/postgresql/timezone/America/St_Barthelemy 0644 root root 156 8060 1347419720 1 f none /usr/local/share/postgresql/timezone/America/St_Johns 0644 root root 3622 48012 1347419720 1 f none /usr/local/share/postgresql/timezone/America/St_Kitts 0644 root root 156 7400 1347419720 1 f none /usr/local/share/postgresql/timezone/America/St_Lucia 0644 root root 177 10909 1347419720 1 l none /usr/local/share/postgresql/timezone/America/St_Thomas=/usr/local/share/postgresql/timezone/America/Virgin 1 f none /usr/local/share/postgresql/timezone/America/St_Vincent 0644 root root 177 10925 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Swift_Current 0644 root root 560 60208 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Tegucigalpa 0644 root root 264 15502 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Thule 0644 root root 1514 37722 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Thunder_Bay 0644 root root 2185 26584 1347419720 1 l none /usr/local/share/postgresql/timezone/America/Tijuana=/usr/local/share/postgresql/timezone/America/Ensenada 1 f none /usr/local/share/postgresql/timezone/America/Toronto 0644 root root 3477 35777 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Tortola 0644 root root 156 7520 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Vancouver 0644 root root 2875 45893 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Virgin 0644 root root 156 7520 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Whitehorse 0644 root root 2067 11400 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Winnipeg 0644 root root 2865 43735 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Yakutat 0644 root root 2288 18405 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Yellowknife 0644 root root 1966 56841 1347419720 1 d none /usr/local/share/postgresql/timezone/Antarctica 0755 root root 1 f none /usr/local/share/postgresql/timezone/Antarctica/Casey 0644 root root 255 10901 1347419720 1 f none /usr/local/share/postgresql/timezone/Antarctica/Davis 0644 root root 276 13837 1347419720 1 f none /usr/local/share/postgresql/timezone/Antarctica/DumontDUrville 0644 root root 213 10559 1347419720 1 f none /usr/local/share/postgresql/timezone/Antarctica/Macquarie 0644 root root 1549 28221 1347419720 1 f none /usr/local/share/postgresql/timezone/Antarctica/Mawson 0644 root root 190 6045 1347419720 1 l none /usr/local/share/postgresql/timezone/Antarctica/McMurdo=/usr/local/share/postgresql/timezone/Antarctica/South_Pole 1 f none /usr/local/share/postgresql/timezone/Antarctica/Palmer 0644 root root 8780 8000 1347419720 1 f none /usr/local/share/postgresql/timezone/Antarctica/Rothera 0644 root root 159 4676 1347419720 1 f none /usr/local/share/postgresql/timezone/Antarctica/South_Pole 0644 root root 2001 440 1347419720 1 f none /usr/local/share/postgresql/timezone/Antarctica/Syowa 0644 root root 160 4949 1347419720 1 f none /usr/local/share/postgresql/timezone/Antarctica/Vostok 0644 root root 160 5303 1347419720 1 d none /usr/local/share/postgresql/timezone/Arctic 0755 root root 1 f none /usr/local/share/postgresql/timezone/Arctic/Longyearbyen 0644 root root 2225 22171 1347419720 1 d none /usr/local/share/postgresql/timezone/Asia 0755 root root 1 f none /usr/local/share/postgresql/timezone/Asia/Aden 0644 root root 157 4470 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Almaty 0644 root root 922 51675 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Amman 0644 root root 8504 1317 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Anadyr 0644 root root 1167 3739 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Aqtau 0644 root root 1112 60574 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Aqtobe 0644 root root 1038 55520 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Ashgabat 0644 root root 657 32693 1347419720 1 l none /usr/local/share/postgresql/timezone/Asia/Ashkhabad=/usr/local/share/postgresql/timezone/Asia/Ashgabat 1 f none /usr/local/share/postgresql/timezone/Asia/Baghdad 0644 root root 962 49998 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Bahrain 0644 root root 195 6572 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Baku 0644 root root 1942 41162 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Bangkok 0644 root root 178 7056 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Beirut 0644 root root 2149 31718 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Bishkek 0644 root root 1047 56925 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Brunei 0644 root root 187 7515 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Calcutta 0644 root root 265 15172 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Choibalsan 0644 root root 890 48551 1347419720 1 l none /usr/local/share/postgresql/timezone/Asia/Chongqing=/usr/local/share/postgresql/timezone/Asia/Chungking 1 f none /usr/local/share/postgresql/timezone/Asia/Chungking 0644 root root 389 16521 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Colombo 0644 root root 347 17779 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Dacca 0644 root root 364 20219 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Damascus 0644 root root 2306 42956 1347419720 1 l none /usr/local/share/postgresql/timezone/Asia/Dhaka=/usr/local/share/postgresql/timezone/Asia/Dacca 1 f none /usr/local/share/postgresql/timezone/Asia/Dili 0644 root root 277 14380 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Dubai 0644 root root 157 5449 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Dushanbe 0644 root root 597 30470 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Gaza 0644 root root 1562 8330 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Harbin 0644 root root 447 24821 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Hebron 0644 root root 1590 9332 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Ho_Chi_Minh 0644 root root 239 12906 1347419720 1 l none /usr/local/share/postgresql/timezone/Asia/Hong_Kong=/usr/local/share/postgresql/timezone/Hongkong 1 f none /usr/local/share/postgresql/timezone/Asia/Hovd 0644 root root 834 42789 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Irkutsk 0644 root root 1187 1658 1347419720 1 l none /usr/local/share/postgresql/timezone/Asia/Istanbul=/usr/local/share/postgresql/timezone/Europe/Istanbul 1 f none /usr/local/share/postgresql/timezone/Asia/Jakarta 0644 root root 344 23265 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Jayapura 0644 root root 209 11510 1347419720 1 l none /usr/local/share/postgresql/timezone/Asia/Jerusalem=/usr/local/share/postgresql/timezone/Israel 1 f none /usr/local/share/postgresql/timezone/Asia/Kabul 0644 root root 173 6935 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Kamchatka 0644 root root 1151 3578 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Karachi 0644 root root 389 21593 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Kashgar 0644 root root 419 18469 1347419720 1 l none /usr/local/share/postgresql/timezone/Asia/Kathmandu=/usr/local/share/postgresql/timezone/Asia/Katmandu 1 f none /usr/local/share/postgresql/timezone/Asia/Katmandu 0644 root root 198 7371 1347419720 1 l none /usr/local/share/postgresql/timezone/Asia/Kolkata=/usr/local/share/postgresql/timezone/Asia/Calcutta 1 f none /usr/local/share/postgresql/timezone/Asia/Krasnoyarsk 0644 root root 1166 64951 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Kuala_Lumpur 0644 root root 372 22800 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Kuching 0644 root root 505 46305 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Kuwait 0644 root root 157 4980 1347419720 1 l none /usr/local/share/postgresql/timezone/Asia/Macao=/usr/local/share/postgresql/timezone/Asia/Macau 1 f none /usr/local/share/postgresql/timezone/Asia/Macau 0644 root root 781 62419 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Magadan 0644 root root 1167 4334 1347419720 1 l none /usr/local/share/postgresql/timezone/Asia/Makassar=/usr/local/share/postgresql/timezone/Asia/Ujung_Pandang 1 f none /usr/local/share/postgresql/timezone/Asia/Manila 0644 root root 319 23444 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Muscat 0644 root root 157 5449 1347419720 1 l none /usr/local/share/postgresql/timezone/Asia/Nicosia=/usr/local/share/postgresql/timezone/Europe/Nicosia 1 f none /usr/local/share/postgresql/timezone/Asia/Novokuznetsk 0644 root root 1220 1920 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Novosibirsk 0644 root root 1180 2412 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Omsk 0644 root root 1166 1960 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Oral 0644 root root 1086 58276 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Phnom_Penh 0644 root root 239 12906 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Pontianak 0644 root root 359 22984 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Pyongyang 0644 root root 242 16670 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Qatar 0644 root root 195 6572 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Qyzylorda 0644 root root 1068 57571 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Rangoon 0644 root root 259 14324 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Riyadh 0644 root root 157 4980 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Riyadh87 0644 root root 8669 45903 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Riyadh88 0644 root root 8523 42059 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Riyadh89 0644 root root 8523 41415 1347419720 1 l none /usr/local/share/postgresql/timezone/Asia/Saigon=/usr/local/share/postgresql/timezone/Asia/Ho_Chi_Minh 1 f none /usr/local/share/postgresql/timezone/Asia/Sakhalin 0644 root root 1197 3067 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Samarkand 0644 root root 677 34551 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Seoul 0644 root root 380 27686 1347419720 1 l none /usr/local/share/postgresql/timezone/Asia/Shanghai=/usr/local/share/postgresql/timezone/PRC 1 f none /usr/local/share/postgresql/timezone/Asia/Singapore 0644 root root 402 25591 1347419720 1 l none /usr/local/share/postgresql/timezone/Asia/Taipei=/usr/local/share/postgresql/timezone/ROC 1 f none /usr/local/share/postgresql/timezone/Asia/Tashkent 0644 root root 667 33929 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Tbilisi 0644 root root 1100 58787 1347419720 1 l none /usr/local/share/postgresql/timezone/Asia/Tehran=/usr/local/share/postgresql/timezone/Iran 1 l none /usr/local/share/postgresql/timezone/Asia/Tel_Aviv=/usr/local/share/postgresql/timezone/Israel 1 f none /usr/local/share/postgresql/timezone/Asia/Thimbu 0644 root root 195 6525 1347419720 1 l none /usr/local/share/postgresql/timezone/Asia/Thimphu=/usr/local/share/postgresql/timezone/Asia/Thimbu 1 l none /usr/local/share/postgresql/timezone/Asia/Tokyo=/usr/local/share/postgresql/timezone/Japan 1 f none /usr/local/share/postgresql/timezone/Asia/Ujung_Pandang 0644 root root 247 14413 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Ulaanbaatar 0644 root root 834 44805 1347419720 1 l none /usr/local/share/postgresql/timezone/Asia/Ulan_Bator=/usr/local/share/postgresql/timezone/Asia/Ulaanbaatar 1 f none /usr/local/share/postgresql/timezone/Asia/Urumqi 0644 root root 389 16049 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Vientiane 0644 root root 239 12906 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Vladivostok 0644 root root 1181 62618 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Yakutsk 0644 root root 1167 63467 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Yekaterinburg 0644 root root 1252 5653 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Yerevan 0644 root root 1263 5768 1347419720 1 d none /usr/local/share/postgresql/timezone/Atlantic 0755 root root 1 f none /usr/local/share/postgresql/timezone/Atlantic/Azores 0644 root root 3462 11487 1347419720 1 f none /usr/local/share/postgresql/timezone/Atlantic/Bermuda 0644 root root 1990 1965 1347419720 1 f none /usr/local/share/postgresql/timezone/Atlantic/Canary 0644 root root 1899 45340 1347419720 1 f none /usr/local/share/postgresql/timezone/Atlantic/Cape_Verde 0644 root root 240 17456 1347419720 1 l none /usr/local/share/postgresql/timezone/Atlantic/Faeroe=/usr/local/share/postgresql/timezone/Atlantic/Faroe 1 f none /usr/local/share/postgresql/timezone/Atlantic/Faroe 0644 root root 1815 38838 1347419720 1 l none /usr/local/share/postgresql/timezone/Atlantic/Jan_Mayen=/usr/local/share/postgresql/timezone/Arctic/Longyearbyen 1 f none /usr/local/share/postgresql/timezone/Atlantic/Madeira 0644 root root 3452 1316 1347419720 1 f none /usr/local/share/postgresql/timezone/Atlantic/Reykjavik 0644 root root 1141 18180 1347419720 1 f none /usr/local/share/postgresql/timezone/Atlantic/South_Georgia 0644 root root 139 6459 1347419720 1 f none /usr/local/share/postgresql/timezone/Atlantic/St_Helena 0644 root root 177 8952 1347419720 1 f none /usr/local/share/postgresql/timezone/Atlantic/Stanley 0644 root root 1204 27019 1347419720 1 d none /usr/local/share/postgresql/timezone/Australia 0755 root root 1 l none /usr/local/share/postgresql/timezone/Australia/ACT=/usr/local/share/postgresql/timezone/Australia/NSW 1 f none /usr/local/share/postgresql/timezone/Australia/Adelaide 0644 root root 2202 956 1347419720 1 f none /usr/local/share/postgresql/timezone/Australia/Brisbane 0644 root root 413 28218 1347419720 1 f none /usr/local/share/postgresql/timezone/Australia/Broken_Hill 0644 root root 2237 5034 1347419720 1 l none /usr/local/share/postgresql/timezone/Australia/Canberra=/usr/local/share/postgresql/timezone/Australia/NSW 1 f none /usr/local/share/postgresql/timezone/Australia/Currie 0644 root root 2183 62119 1347419720 1 l none /usr/local/share/postgresql/timezone/Australia/Darwin=/usr/local/share/postgresql/timezone/Australia/North 1 f none /usr/local/share/postgresql/timezone/Australia/Eucla 0644 root root 446 25452 1347419720 1 f none /usr/local/share/postgresql/timezone/Australia/Hobart 0644 root root 2295 8958 1347419720 1 l none /usr/local/share/postgresql/timezone/Australia/LHI=/usr/local/share/postgresql/timezone/Australia/Lord_Howe 1 f none /usr/local/share/postgresql/timezone/Australia/Lindeman 0644 root root 483 33220 1347419720 1 f none /usr/local/share/postgresql/timezone/Australia/Lord_Howe 0644 root root 1821 59909 1347419720 1 l none /usr/local/share/postgresql/timezone/Australia/Melbourne=/usr/local/share/postgresql/timezone/Australia/Victoria 1 f none /usr/local/share/postgresql/timezone/Australia/NSW 0644 root root 2183 64415 1347419720 1 f none /usr/local/share/postgresql/timezone/Australia/North 0644 root root 288 23683 1347419720 1 l none /usr/local/share/postgresql/timezone/Australia/Perth=/usr/local/share/postgresql/timezone/Australia/West 1 l none /usr/local/share/postgresql/timezone/Australia/Queensland=/usr/local/share/postgresql/timezone/Australia/Brisbane 1 l none /usr/local/share/postgresql/timezone/Australia/South=/usr/local/share/postgresql/timezone/Australia/Adelaide 1 l none /usr/local/share/postgresql/timezone/Australia/Sydney=/usr/local/share/postgresql/timezone/Australia/NSW 1 l none /usr/local/share/postgresql/timezone/Australia/Tasmania=/usr/local/share/postgresql/timezone/Australia/Hobart 1 f none /usr/local/share/postgresql/timezone/Australia/Victoria 0644 root root 2183 63395 1347419720 1 f none /usr/local/share/postgresql/timezone/Australia/West 0644 root root 440 28776 1347419720 1 l none /usr/local/share/postgresql/timezone/Australia/Yancowinna=/usr/local/share/postgresql/timezone/Australia/Broken_Hill 1 d none /usr/local/share/postgresql/timezone/Brazil 0755 root root 1 l none /usr/local/share/postgresql/timezone/Brazil/Acre=/usr/local/share/postgresql/timezone/America/Rio_Branco 1 l none /usr/local/share/postgresql/timezone/Brazil/DeNoronha=/usr/local/share/postgresql/timezone/America/Noronha 1 l none /usr/local/share/postgresql/timezone/Brazil/East=/usr/local/share/postgresql/timezone/America/Sao_Paulo 1 l none /usr/local/share/postgresql/timezone/Brazil/West=/usr/local/share/postgresql/timezone/America/Manaus 1 f none /usr/local/share/postgresql/timezone/CET 0644 root root 2102 3261 1347419720 1 f none /usr/local/share/postgresql/timezone/CST6CDT 0644 root root 2294 30587 1347419720 1 d none /usr/local/share/postgresql/timezone/Canada 0755 root root 1 l none /usr/local/share/postgresql/timezone/Canada/Atlantic=/usr/local/share/postgresql/timezone/America/Halifax 1 l none /usr/local/share/postgresql/timezone/Canada/Central=/usr/local/share/postgresql/timezone/America/Winnipeg 1 l none /usr/local/share/postgresql/timezone/Canada/East-Saskatchewan=/usr/local/share/postgresql/timezone/America/Regina 1 l none /usr/local/share/postgresql/timezone/Canada/Eastern=/usr/local/share/postgresql/timezone/America/Toronto 1 l none /usr/local/share/postgresql/timezone/Canada/Mountain=/usr/local/share/postgresql/timezone/America/Edmonton 1 l none /usr/local/share/postgresql/timezone/Canada/Newfoundland=/usr/local/share/postgresql/timezone/America/St_Johns 1 l none /usr/local/share/postgresql/timezone/Canada/Pacific=/usr/local/share/postgresql/timezone/America/Vancouver 1 l none /usr/local/share/postgresql/timezone/Canada/Saskatchewan=/usr/local/share/postgresql/timezone/America/Regina 1 l none /usr/local/share/postgresql/timezone/Canada/Yukon=/usr/local/share/postgresql/timezone/America/Whitehorse 1 d none /usr/local/share/postgresql/timezone/Chile 0755 root root 1 l none /usr/local/share/postgresql/timezone/Chile/Continental=/usr/local/share/postgresql/timezone/America/Santiago 1 l none /usr/local/share/postgresql/timezone/Chile/EasterIsland=/usr/local/share/postgresql/timezone/Pacific/Easter 1 l none /usr/local/share/postgresql/timezone/Cuba=/usr/local/share/postgresql/timezone/America/Havana 1 f none /usr/local/share/postgresql/timezone/EET 0644 root root 1876 39332 1347419720 1 f none /usr/local/share/postgresql/timezone/EST 0644 root root 118 3399 1347419720 1 f none /usr/local/share/postgresql/timezone/EST5EDT 0644 root root 2294 44916 1347419720 1 l none /usr/local/share/postgresql/timezone/Egypt=/usr/local/share/postgresql/timezone/Africa/Cairo 1 l none /usr/local/share/postgresql/timezone/Eire=/usr/local/share/postgresql/timezone/Europe/Dublin 1 d none /usr/local/share/postgresql/timezone/Etc 0755 root root 1 l none /usr/local/share/postgresql/timezone/Etc/GMT=/usr/local/share/postgresql/timezone/Etc/GMT0 1 l none /usr/local/share/postgresql/timezone/Etc/GMT+0=/usr/local/share/postgresql/timezone/Etc/GMT0 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+1 0644 root root 126 4025 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+10 0644 root root 130 3679 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+11 0644 root root 130 3623 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+12 0644 root root 130 3567 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+2 0644 root root 126 3969 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+3 0644 root root 126 3913 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+4 0644 root root 126 3857 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+5 0644 root root 126 3801 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+6 0644 root root 126 3745 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+7 0644 root root 126 3689 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+8 0644 root root 126 3633 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+9 0644 root root 126 3577 1347419720 1 l none /usr/local/share/postgresql/timezone/Etc/GMT-0=/usr/local/share/postgresql/timezone/Etc/GMT0 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-1 0644 root root 127 2154 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-10 0644 root root 131 2888 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-11 0644 root root 131 2952 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-12 0644 root root 131 3016 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-13 0644 root root 131 3080 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-14 0644 root root 131 3144 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-2 0644 root root 127 2218 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-3 0644 root root 127 2282 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-4 0644 root root 127 2346 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-5 0644 root root 127 2410 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-6 0644 root root 127 2474 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-7 0644 root root 127 2538 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-8 0644 root root 127 2602 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-9 0644 root root 127 2666 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT0 0644 root root 118 1640 1347419720 1 l none /usr/local/share/postgresql/timezone/Etc/Greenwich=/usr/local/share/postgresql/timezone/Etc/GMT0 1 f none /usr/local/share/postgresql/timezone/Etc/UCT 0644 root root 118 1652 1347419720 1 l none /usr/local/share/postgresql/timezone/Etc/UTC=/usr/local/share/postgresql/timezone/UTC 1 l none /usr/local/share/postgresql/timezone/Etc/Universal=/usr/local/share/postgresql/timezone/UTC 1 l none /usr/local/share/postgresql/timezone/Etc/Zulu=/usr/local/share/postgresql/timezone/UTC 1 d none /usr/local/share/postgresql/timezone/Europe 0755 root root 1 f none /usr/local/share/postgresql/timezone/Europe/Amsterdam 0644 root root 2917 37182 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Andorra 0644 root root 1725 31329 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Athens 0644 root root 2245 8903 1347419720 1 l none /usr/local/share/postgresql/timezone/Europe/Belfast=/usr/local/share/postgresql/timezone/Europe/Guernsey 1 l none /usr/local/share/postgresql/timezone/Europe/Belgrade=/usr/local/share/postgresql/timezone/Europe/Podgorica 1 f none /usr/local/share/postgresql/timezone/Europe/Berlin 0644 root root 2309 31972 1347419720 1 l none /usr/local/share/postgresql/timezone/Europe/Bratislava=/usr/local/share/postgresql/timezone/Europe/Prague 1 f none /usr/local/share/postgresql/timezone/Europe/Brussels 0644 root root 2944 49652 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Bucharest 0644 root root 2195 15951 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Budapest 0644 root root 2407 54508 1347419720 1 l none /usr/local/share/postgresql/timezone/Europe/Chisinau=/usr/local/share/postgresql/timezone/Europe/Tiraspol 1 f none /usr/local/share/postgresql/timezone/Europe/Copenhagen 0644 root root 2134 9516 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Dublin 0644 root root 3533 62255 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Gibraltar 0644 root root 3035 21375 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Guernsey 0644 root root 3661 21636 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Helsinki 0644 root root 1883 44323 1347419720 1 l none /usr/local/share/postgresql/timezone/Europe/Isle_of_Man=/usr/local/share/postgresql/timezone/Europe/Guernsey 1 f none /usr/local/share/postgresql/timezone/Europe/Istanbul 0644 root root 2721 11692 1347419720 1 l none /usr/local/share/postgresql/timezone/Europe/Jersey=/usr/local/share/postgresql/timezone/Europe/Guernsey 1 f none /usr/local/share/postgresql/timezone/Europe/Kaliningrad 0644 root root 1494 30053 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Kiev 0644 root root 2057 60272 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Lisbon 0644 root root 3439 3130 1347419720 1 l none /usr/local/share/postgresql/timezone/Europe/Ljubljana=/usr/local/share/postgresql/timezone/Europe/Podgorica 1 l none /usr/local/share/postgresql/timezone/Europe/London=/usr/local/share/postgresql/timezone/Europe/Guernsey 1 f none /usr/local/share/postgresql/timezone/Europe/Luxembourg 0644 root root 2960 43302 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Madrid 0644 root root 2593 362 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Malta 0644 root root 2603 61829 1347419720 1 l none /usr/local/share/postgresql/timezone/Europe/Mariehamn=/usr/local/share/postgresql/timezone/Europe/Helsinki 1 f none /usr/local/share/postgresql/timezone/Europe/Minsk 0644 root root 1328 11431 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Monaco 0644 root root 2927 49386 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Moscow 0644 root root 1448 32492 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Nicosia 0644 root root 2002 52702 1347419720 1 l none /usr/local/share/postgresql/timezone/Europe/Oslo=/usr/local/share/postgresql/timezone/Arctic/Longyearbyen 1 f none /usr/local/share/postgresql/timezone/Europe/Paris 0644 root root 2945 47644 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Podgorica 0644 root root 1931 52265 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Prague 0644 root root 2246 22587 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Riga 0644 root root 2209 9765 1347419720 1 l none /usr/local/share/postgresql/timezone/Europe/Rome=/usr/local/share/postgresql/timezone/Europe/Vatican 1 f none /usr/local/share/postgresql/timezone/Europe/Samara 0644 root root 1314 6977 1347419720 1 l none /usr/local/share/postgresql/timezone/Europe/San_Marino=/usr/local/share/postgresql/timezone/Europe/Vatican 1 l none /usr/local/share/postgresql/timezone/Europe/Sarajevo=/usr/local/share/postgresql/timezone/Europe/Podgorica 1 f none /usr/local/share/postgresql/timezone/Europe/Simferopol 0644 root root 2113 64622 1347419720 1 l none /usr/local/share/postgresql/timezone/Europe/Skopje=/usr/local/share/postgresql/timezone/Europe/Podgorica 1 f none /usr/local/share/postgresql/timezone/Europe/Sofia 0644 root root 2104 59048 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Stockholm 0644 root root 1892 44662 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Tallinn 0644 root root 2175 4402 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Tirane 0644 root root 2084 58136 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Tiraspol 0644 root root 2407 39520 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Uzhgorod 0644 root root 2077 63323 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Vaduz 0644 root root 1799 36441 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Vatican 0644 root root 2652 3498 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Vienna 0644 root root 2211 22045 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Vilnius 0644 root root 2173 2489 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Volgograd 0644 root root 1218 8567 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Warsaw 0644 root root 2679 6024 1347419720 1 l none /usr/local/share/postgresql/timezone/Europe/Zagreb=/usr/local/share/postgresql/timezone/Europe/Podgorica 1 f none /usr/local/share/postgresql/timezone/Europe/Zaporozhye 0644 root root 2085 62452 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Zurich 0644 root root 1892 46454 1347419720 1 f none /usr/local/share/postgresql/timezone/Factory 0644 root root 255 14338 1347419720 1 l none /usr/local/share/postgresql/timezone/GB=/usr/local/share/postgresql/timezone/Europe/Guernsey 1 l none /usr/local/share/postgresql/timezone/GB-Eire=/usr/local/share/postgresql/timezone/Europe/Guernsey 1 l none /usr/local/share/postgresql/timezone/GMT=/usr/local/share/postgresql/timezone/Etc/GMT0 1 l none /usr/local/share/postgresql/timezone/GMT+0=/usr/local/share/postgresql/timezone/Etc/GMT0 1 l none /usr/local/share/postgresql/timezone/GMT-0=/usr/local/share/postgresql/timezone/Etc/GMT0 1 l none /usr/local/share/postgresql/timezone/GMT0=/usr/local/share/postgresql/timezone/Etc/GMT0 1 l none /usr/local/share/postgresql/timezone/Greenwich=/usr/local/share/postgresql/timezone/Etc/GMT0 1 f none /usr/local/share/postgresql/timezone/HST 0644 root root 119 3152 1347419720 1 f none /usr/local/share/postgresql/timezone/Hongkong 0644 root root 1159 3228 1347419720 1 l none /usr/local/share/postgresql/timezone/Iceland=/usr/local/share/postgresql/timezone/Atlantic/Reykjavik 1 d none /usr/local/share/postgresql/timezone/Indian 0755 root root 1 f none /usr/local/share/postgresql/timezone/Indian/Antananarivo 0644 root root 227 11130 1347419720 1 f none /usr/local/share/postgresql/timezone/Indian/Chagos 0644 root root 187 7175 1347419720 1 f none /usr/local/share/postgresql/timezone/Indian/Christmas 0644 root root 140 4064 1347419720 1 f none /usr/local/share/postgresql/timezone/Indian/Cocos 0644 root root 143 4187 1347419720 1 f none /usr/local/share/postgresql/timezone/Indian/Comoro 0644 root root 157 5388 1347419720 1 f none /usr/local/share/postgresql/timezone/Indian/Kerguelen 0644 root root 157 4868 1347419720 1 f none /usr/local/share/postgresql/timezone/Indian/Mahe 0644 root root 157 5257 1347419720 1 f none /usr/local/share/postgresql/timezone/Indian/Maldives 0644 root root 178 7445 1347419720 1 f none /usr/local/share/postgresql/timezone/Indian/Mauritius 0644 root root 239 9549 1347419720 1 f none /usr/local/share/postgresql/timezone/Indian/Mayotte 0644 root root 157 4878 1347419720 1 f none /usr/local/share/postgresql/timezone/Indian/Reunion 0644 root root 157 4630 1347419720 1 f none /usr/local/share/postgresql/timezone/Iran 0644 root root 1622 35051 1347419720 1 f none /usr/local/share/postgresql/timezone/Israel 0644 root root 2197 52191 1347419720 1 l none /usr/local/share/postgresql/timezone/Jamaica=/usr/local/share/postgresql/timezone/America/Jamaica 1 f none /usr/local/share/postgresql/timezone/Japan 0644 root root 331 28605 1347419720 1 f none /usr/local/share/postgresql/timezone/Kwajalein 0644 root root 211 10091 1347419720 1 l none /usr/local/share/postgresql/timezone/Libya=/usr/local/share/postgresql/timezone/Africa/Tripoli 1 f none /usr/local/share/postgresql/timezone/MET 0644 root root 2102 3321 1347419720 1 f none /usr/local/share/postgresql/timezone/MST 0644 root root 118 3305 1347419720 1 f none /usr/local/share/postgresql/timezone/MST7MDT 0644 root root 2294 17398 1347419720 1 d none /usr/local/share/postgresql/timezone/Mexico 0755 root root 1 l none /usr/local/share/postgresql/timezone/Mexico/BajaNorte=/usr/local/share/postgresql/timezone/America/Ensenada 1 l none /usr/local/share/postgresql/timezone/Mexico/BajaSur=/usr/local/share/postgresql/timezone/America/Mazatlan 1 l none /usr/local/share/postgresql/timezone/Mexico/General=/usr/local/share/postgresql/timezone/America/Mexico_City 1 d none /usr/local/share/postgresql/timezone/Mideast 0755 root root 1 l none /usr/local/share/postgresql/timezone/Mideast/Riyadh87=/usr/local/share/postgresql/timezone/Asia/Riyadh87 1 l none /usr/local/share/postgresql/timezone/Mideast/Riyadh88=/usr/local/share/postgresql/timezone/Asia/Riyadh88 1 l none /usr/local/share/postgresql/timezone/Mideast/Riyadh89=/usr/local/share/postgresql/timezone/Asia/Riyadh89 1 f none /usr/local/share/postgresql/timezone/NZ 0644 root root 2434 2200 1347419720 1 f none /usr/local/share/postgresql/timezone/NZ-CHAT 0644 root root 2018 1082 1347419720 1 l none /usr/local/share/postgresql/timezone/Navajo=/usr/local/share/postgresql/timezone/America/Denver 1 f none /usr/local/share/postgresql/timezone/PRC 0644 root root 405 23461 1347419720 1 f none /usr/local/share/postgresql/timezone/PST8PDT 0644 root root 2294 21479 1347419720 1 d none /usr/local/share/postgresql/timezone/Pacific 0755 root root 1 f none /usr/local/share/postgresql/timezone/Pacific/Apia 0644 root root 343 21401 1347419720 1 l none /usr/local/share/postgresql/timezone/Pacific/Auckland=/usr/local/share/postgresql/timezone/NZ 1 l none /usr/local/share/postgresql/timezone/Pacific/Chatham=/usr/local/share/postgresql/timezone/NZ-CHAT 1 l none /usr/local/share/postgresql/timezone/Pacific/Chuuk=/usr/local/share/postgresql/timezone/Pacific/Yap 1 f none /usr/local/share/postgresql/timezone/Pacific/Easter 0644 root root 9007 15424 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Efate 0644 root root 464 25170 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Enderbury 0644 root root 204 8981 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Fakaofo 0644 root root 171 7664 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Fiji 0644 root root 324 16016 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Funafuti 0644 root root 141 4408 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Galapagos 0644 root root 197 10384 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Gambier 0644 root root 159 7002 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Guadalcanal 0644 root root 158 5540 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Guam 0644 root root 199 8566 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Honolulu 0644 root root 250 18837 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Johnston 0644 root root 119 3152 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Kiritimati 0644 root root 204 9030 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Kosrae 0644 root root 188 8020 1347419720 1 l none /usr/local/share/postgresql/timezone/Pacific/Kwajalein=/usr/local/share/postgresql/timezone/Kwajalein 1 f none /usr/local/share/postgresql/timezone/Pacific/Majuro 0644 root root 171 7032 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Marquesas 0644 root root 162 7162 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Midway 0644 root root 268 18659 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Nauru 0644 root root 240 12212 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Niue 0644 root root 200 11102 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Norfolk 0644 root root 182 7889 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Noumea 0644 root root 300 13682 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Pago_Pago 0644 root root 290 19545 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Palau 0644 root root 140 4177 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Pitcairn 0644 root root 177 8089 1347419720 1 l none /usr/local/share/postgresql/timezone/Pacific/Pohnpei=/usr/local/share/postgresql/timezone/Pacific/Ponape 1 f none /usr/local/share/postgresql/timezone/Pacific/Ponape 0644 root root 144 4550 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Port_Moresby 0644 root root 163 6758 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Rarotonga 0644 root root 548 28554 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Saipan 0644 root root 229 11262 1347419720 1 l none /usr/local/share/postgresql/timezone/Pacific/Samoa=/usr/local/share/postgresql/timezone/Pacific/Pago_Pago 1 f none /usr/local/share/postgresql/timezone/Pacific/Tahiti 0644 root root 160 7516 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Tarawa 0644 root root 144 4560 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Tongatapu 0644 root root 313 15767 1347419720 1 l none /usr/local/share/postgresql/timezone/Pacific/Truk=/usr/local/share/postgresql/timezone/Pacific/Yap 1 f none /usr/local/share/postgresql/timezone/Pacific/Wake 0644 root root 144 4581 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Wallis 0644 root root 141 4369 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Yap 0644 root root 144 4450 1347419720 1 l none /usr/local/share/postgresql/timezone/Poland=/usr/local/share/postgresql/timezone/Europe/Warsaw 1 l none /usr/local/share/postgresql/timezone/Portugal=/usr/local/share/postgresql/timezone/Europe/Lisbon 1 f none /usr/local/share/postgresql/timezone/ROC 0644 root root 724 21200 1347419720 1 l none /usr/local/share/postgresql/timezone/ROK=/usr/local/share/postgresql/timezone/Asia/Seoul 1 l none /usr/local/share/postgresql/timezone/Singapore=/usr/local/share/postgresql/timezone/Asia/Singapore 1 l none /usr/local/share/postgresql/timezone/Turkey=/usr/local/share/postgresql/timezone/Europe/Istanbul 1 l none /usr/local/share/postgresql/timezone/UCT=/usr/local/share/postgresql/timezone/Etc/UCT 1 d none /usr/local/share/postgresql/timezone/US 0755 root root 1 l none /usr/local/share/postgresql/timezone/US/Alaska=/usr/local/share/postgresql/timezone/America/Anchorage 1 l none /usr/local/share/postgresql/timezone/US/Aleutian=/usr/local/share/postgresql/timezone/America/Atka 1 l none /usr/local/share/postgresql/timezone/US/Arizona=/usr/local/share/postgresql/timezone/America/Phoenix 1 l none /usr/local/share/postgresql/timezone/US/Central=/usr/local/share/postgresql/timezone/America/Chicago 1 l none /usr/local/share/postgresql/timezone/US/East-Indiana=/usr/local/share/postgresql/timezone/America/Indianapolis 1 l none /usr/local/share/postgresql/timezone/US/Eastern=/usr/local/share/postgresql/timezone/America/New_York 1 l none /usr/local/share/postgresql/timezone/US/Hawaii=/usr/local/share/postgresql/timezone/Pacific/Honolulu 1 l none /usr/local/share/postgresql/timezone/US/Indiana-Starke=/usr/local/share/postgresql/timezone/America/Knox_IN 1 l none /usr/local/share/postgresql/timezone/US/Michigan=/usr/local/share/postgresql/timezone/America/Detroit 1 l none /usr/local/share/postgresql/timezone/US/Mountain=/usr/local/share/postgresql/timezone/America/Denver 1 l none /usr/local/share/postgresql/timezone/US/Pacific=/usr/local/share/postgresql/timezone/America/Los_Angeles 1 l none /usr/local/share/postgresql/timezone/US/Pacific-New=/usr/local/share/postgresql/timezone/America/Los_Angeles 1 l none /usr/local/share/postgresql/timezone/US/Samoa=/usr/local/share/postgresql/timezone/Pacific/Pago_Pago 1 f none /usr/local/share/postgresql/timezone/UTC 0644 root root 118 1652 1347419720 1 l none /usr/local/share/postgresql/timezone/Universal=/usr/local/share/postgresql/timezone/UTC 1 l none /usr/local/share/postgresql/timezone/W-SU=/usr/local/share/postgresql/timezone/Europe/Moscow 1 f none /usr/local/share/postgresql/timezone/WET 0644 root root 1873 39052 1347419720 1 l none /usr/local/share/postgresql/timezone/Zulu=/usr/local/share/postgresql/timezone/UTC 1 l none /usr/local/share/postgresql/timezone/posixrules=/usr/local/share/postgresql/timezone/America/New_York 1 d none /usr/local/share/postgresql/timezonesets 0755 root root 1 f none /usr/local/share/postgresql/timezonesets/Africa.txt 0644 root root 6973 6439 1347419720 1 f none /usr/local/share/postgresql/timezonesets/America.txt 0644 root root 12717 22411 1347419720 1 f none /usr/local/share/postgresql/timezonesets/Antarctica.txt 0644 root root 1478 34571 1347419720 1 f none /usr/local/share/postgresql/timezonesets/Asia.txt 0644 root root 9509 5304 1347419720 1 f none /usr/local/share/postgresql/timezonesets/Atlantic.txt 0644 root root 3774 43117 1347419720 1 f none /usr/local/share/postgresql/timezonesets/Australia 0644 root root 1404 38525 1347419720 1 f none /usr/local/share/postgresql/timezonesets/Australia.txt 0644 root root 2782 9096 1347419720 1 f none /usr/local/share/postgresql/timezonesets/Default 0644 root root 29620 49534 1347419720 1 f none /usr/local/share/postgresql/timezonesets/Etc.txt 0644 root root 1241 12088 1347419720 1 f none /usr/local/share/postgresql/timezonesets/Europe.txt 0644 root root 8301 24059 1347419720 1 f none /usr/local/share/postgresql/timezonesets/India 0644 root root 593 50003 1347419720 1 f none /usr/local/share/postgresql/timezonesets/Indian.txt 0644 root root 1566 37344 1347419720 1 f none /usr/local/share/postgresql/timezonesets/Pacific.txt 0644 root root 4150 8407 1347419720 1 d none /usr/local/share/postgresql/tsearch_data 0755 root root 1 f none /usr/local/share/postgresql/tsearch_data/danish.stop 0644 root root 424 37100 1347419723 1 f none /usr/local/share/postgresql/tsearch_data/dutch.stop 0644 root root 453 38763 1347419723 1 f none /usr/local/share/postgresql/tsearch_data/english.stop 0644 root root 622 54931 1347419723 1 f none /usr/local/share/postgresql/tsearch_data/finnish.stop 0644 root root 1579 33237 1347419723 1 f none /usr/local/share/postgresql/tsearch_data/french.stop 0644 root root 805 10912 1347419723 1 f none /usr/local/share/postgresql/tsearch_data/german.stop 0644 root root 1349 57331 1347419723 1 f none /usr/local/share/postgresql/tsearch_data/hungarian.stop 0644 root root 1227 57949 1347419723 1 f none /usr/local/share/postgresql/tsearch_data/hunspell_sample.affix 0644 root root 244 13989 1347419721 1 f none /usr/local/share/postgresql/tsearch_data/ispell_sample.affix 0644 root root 465 31429 1347419721 1 f none /usr/local/share/postgresql/tsearch_data/ispell_sample.dict 0644 root root 81 7108 1347419721 1 f none /usr/local/share/postgresql/tsearch_data/italian.stop 0644 root root 1654 20806 1347419723 1 f none /usr/local/share/postgresql/tsearch_data/norwegian.stop 0644 root root 851 11364 1347419723 1 f none /usr/local/share/postgresql/tsearch_data/portuguese.stop 0644 root root 1267 57350 1347419723 1 f none /usr/local/share/postgresql/tsearch_data/russian.stop 0644 root root 1235 9585 1347419723 1 f none /usr/local/share/postgresql/tsearch_data/spanish.stop 0644 root root 2178 21152 1347419723 1 f none /usr/local/share/postgresql/tsearch_data/swedish.stop 0644 root root 559 52354 1347419723 1 f none /usr/local/share/postgresql/tsearch_data/synonym_sample.syn 0644 root root 73 6890 1347419721 1 f none /usr/local/share/postgresql/tsearch_data/thesaurus_sample.ths 0644 root root 473 41646 1347419721 1 f none /usr/local/share/postgresql/tsearch_data/turkish.stop 0644 root root 260 25287 1347419723 1 f none /usr/local/share/postgresql/tsearch_data/unaccent.rules 0644 root root 937 22169 1347419728 1 f none /usr/local/share/postgresql/tsearch_data/xsyn_sample.rules 0644 root root 139 12006 1347419726 1 f none /usr/local/share/postgresql/unknown.pltcl 0644 root root 2406 25686 1347419725 1 i checkinstall 790 2504 1347428573 1 i pkginfo 301 24275 1347428573 07070100000000000000000000000000000000000000010000000000000000000000000000000000000000000000000000000b00000000TRAILER!!!070701000894c1000081a4000000000000000000000001505020dd0000012d000000b500010002ffffffffffffffff0000000800000000pkginfoPKG=postgresql NAME=postgresql 9.2.0 i86pc Solaris 10 VERSION=9.2.0 PSTAMP=12th September 2012 VENDOR=PostgreSQL Global Development Group EMAIL=http://www.postgresql.org/ DESC=Open source object-relational database ARCH=i386 CATEGORY=utility CLASSES=none BASEDIR=/ ISTATES=S s 1 2 3 RSTATES=S s 1 2 3 070701000894c0000081a4000000000000000000000001505020dd00046849000000b500010002ffffffffffffffff0000000700000000pkgmap: 1 93582 1 d none /usr ? ? ? 1 d none /usr/local ? ? ? 1 d none /usr/local/bin 0755 root root 1 f none /usr/local/bin/clusterdb 0755 root root 82768 42542 1347419725 1 f none /usr/local/bin/createdb 0755 root root 83420 3917 1347419724 1 f none /usr/local/bin/createlang 0755 root root 87456 38443 1347419724 1 f none /usr/local/bin/createuser 0755 root root 85060 59590 1347419725 1 f none /usr/local/bin/dropdb 0755 root root 81396 17940 1347419724 1 f none /usr/local/bin/droplang 0755 root root 87296 36858 1347419725 1 f none /usr/local/bin/dropuser 0755 root root 81372 14203 1347419725 1 f none /usr/local/bin/ecpg 0755 root root 825676 5393 1347419724 1 f none /usr/local/bin/initdb 0755 root root 132780 5677 1347419724 1 f none /usr/local/bin/oid2name 0755 root root 39880 17056 1347419727 1 f none /usr/local/bin/pg_archivecleanup 0755 root root 30924 47513 1347419727 1 f none /usr/local/bin/pg_basebackup 0755 root root 86776 5261 1347419725 1 f none /usr/local/bin/pg_config 0755 root root 38116 31241 1347419725 1 f none /usr/local/bin/pg_controldata 0755 root root 39884 22664 1347419725 1 f none /usr/local/bin/pg_ctl 0755 root root 53304 9736 1347419724 1 f none /usr/local/bin/pg_dump 0755 root root 377960 10649 1347419724 1 f none /usr/local/bin/pg_dumpall 0755 root root 103592 58118 1347419724 1 f none /usr/local/bin/pg_receivexlog 0755 root root 63640 47045 1347419725 1 f none /usr/local/bin/pg_resetxlog 0755 root root 52096 28512 1347419725 1 f none /usr/local/bin/pg_restore 0755 root root 181116 55732 1347419724 1 f none /usr/local/bin/pg_standby 0755 root root 40184 49244 1347419727 1 f none /usr/local/bin/pg_test_fsync 0755 root root 30552 37835 1347419727 1 f none /usr/local/bin/pg_test_timing 0755 root root 24732 39083 1347419727 1 f none /usr/local/bin/pg_upgrade 0755 root root 172972 54524 1347419727 1 f none /usr/local/bin/pgbench 0755 root root 73552 9822 1347419727 1 f none /usr/local/bin/pltcl_delmod 0755 root root 2219 44861 1347419725 1 f none /usr/local/bin/pltcl_listmod 0755 root root 2377 56553 1347419725 1 f none /usr/local/bin/pltcl_loadmod 0755 root root 11455 4231 1347419725 1 f none /usr/local/bin/postgres 0755 root root 7378380 56196 1347419721 1 s none /usr/local/bin/postmaster=postgres 1 f none /usr/local/bin/psql 0755 root root 516736 51706 1347419724 1 f none /usr/local/bin/reindexdb 0755 root root 84092 44922 1347419725 1 f none /usr/local/bin/vacuumdb 0755 root root 49876 38665 1347419725 1 f none /usr/local/bin/vacuumlo 0755 root root 39792 20443 1347419728 1 d none /usr/local/include 0755 root root 1 f none /usr/local/include/ecpg_config.h 0644 root root 714 57266 1347419724 1 f none /usr/local/include/ecpg_informix.h 0644 root root 2758 29110 1347419724 1 f none /usr/local/include/ecpgerrno.h 0644 root root 2540 60981 1347419724 1 f none /usr/local/include/ecpglib.h 0644 root root 2601 15719 1347419724 1 f none /usr/local/include/ecpgtype.h 0644 root root 2621 18076 1347419724 1 d none /usr/local/include/libpq 0755 root root 1 f none /usr/local/include/libpq-events.h 0644 root root 2211 49429 1347419723 1 f none /usr/local/include/libpq-fe.h 0644 root root 20649 29784 1347419723 1 f none /usr/local/include/libpq/libpq-fs.h 0644 root root 633 44679 1347419723 1 f none /usr/local/include/pg_config.h 0644 root root 26316 5454 1347419723 1 f none /usr/local/include/pg_config_manual.h 0644 root root 9261 50041 1347419723 1 f none /usr/local/include/pg_config_os.h 0644 root root 1041 19956 1347419723 1 f none /usr/local/include/pgtypes_date.h 0644 root root 766 65439 1347419724 1 f none /usr/local/include/pgtypes_error.h 0644 root root 530 39306 1347419724 1 f none /usr/local/include/pgtypes_interval.h 0644 root root 1143 28859 1347419724 1 f none /usr/local/include/pgtypes_numeric.h 0644 root root 2227 44302 1347419724 1 f none /usr/local/include/pgtypes_timestamp.h 0644 root root 1010 23484 1347419724 1 f none /usr/local/include/postgres_ext.h 0644 root root 1778 8903 1347419723 1 d none /usr/local/include/postgresql 0755 root root 1 d none /usr/local/include/postgresql/informix 0755 root root 1 d none /usr/local/include/postgresql/informix/esql 0755 root root 1 f none /usr/local/include/postgresql/informix/esql/datetime.h 0644 root root 338 27003 1347419724 1 f none /usr/local/include/postgresql/informix/esql/decimal.h 0644 root root 301 23254 1347419724 1 f none /usr/local/include/postgresql/informix/esql/sqltypes.h 0644 root root 1435 45823 1347419724 1 d none /usr/local/include/postgresql/internal 0755 root root 1 f none /usr/local/include/postgresql/internal/c.h 0644 root root 24689 44709 1347419723 1 d none /usr/local/include/postgresql/internal/libpq 0755 root root 1 f none /usr/local/include/postgresql/internal/libpq-int.h 0644 root root 22813 53598 1347419723 1 f none /usr/local/include/postgresql/internal/libpq/pqcomm.h 0644 root root 5800 11746 1347419723 1 f none /usr/local/include/postgresql/internal/port.h 0644 root root 13841 61945 1347419723 1 f none /usr/local/include/postgresql/internal/postgres_fe.h 0644 root root 730 54063 1347419723 1 f none /usr/local/include/postgresql/internal/pqexpbuffer.h 0644 root root 6527 5186 1347419723 1 d none /usr/local/include/postgresql/server 0755 root root 1 d none /usr/local/include/postgresql/server/access 0755 root root 1 f none /usr/local/include/postgresql/server/access/attnum.h 0644 root root 1553 56964 1347419723 1 f none /usr/local/include/postgresql/server/access/clog.h 0644 root root 1508 62296 1347419723 1 f none /usr/local/include/postgresql/server/access/genam.h 0644 root root 7470 58296 1347419723 1 f none /usr/local/include/postgresql/server/access/gin.h 0644 root root 1664 65164 1347419723 1 f none /usr/local/include/postgresql/server/access/gin_private.h 0644 root root 23313 11499 1347419723 1 f none /usr/local/include/postgresql/server/access/gist.h 0644 root root 5562 59338 1347419723 1 f none /usr/local/include/postgresql/server/access/gist_private.h 0644 root root 18682 60890 1347419723 1 f none /usr/local/include/postgresql/server/access/gistscan.h 0644 root root 718 53420 1347419723 1 f none /usr/local/include/postgresql/server/access/hash.h 0644 root root 13177 63527 1347419723 1 f none /usr/local/include/postgresql/server/access/heapam.h 0644 root root 6344 29310 1347419723 1 f none /usr/local/include/postgresql/server/access/hio.h 0644 root root 1280 35802 1347419723 1 f none /usr/local/include/postgresql/server/access/htup.h 0644 root root 32708 34557 1347419723 1 f none /usr/local/include/postgresql/server/access/itup.h 0644 root root 4404 25058 1347419723 1 f none /usr/local/include/postgresql/server/access/multixact.h 0644 root root 2810 46471 1347419723 1 f none /usr/local/include/postgresql/server/access/nbtree.h 0644 root root 27906 5562 1347419723 1 f none /usr/local/include/postgresql/server/access/printtup.h 0644 root root 1051 18880 1347419723 1 f none /usr/local/include/postgresql/server/access/reloptions.h 0644 root root 8813 55753 1347419723 1 f none /usr/local/include/postgresql/server/access/relscan.h 0644 root root 4168 17731 1347419723 1 f none /usr/local/include/postgresql/server/access/rewriteheap.h 0644 root root 1016 16149 1347419723 1 f none /usr/local/include/postgresql/server/access/rmgr.h 0644 root root 804 58096 1347419723 1 f none /usr/local/include/postgresql/server/access/sdir.h 0644 root root 1466 50616 1347419723 1 f none /usr/local/include/postgresql/server/access/skey.h 0644 root root 7033 60969 1347419723 1 f none /usr/local/include/postgresql/server/access/slru.h 0644 root root 5278 46117 1347419723 1 f none /usr/local/include/postgresql/server/access/spgist.h 0644 root root 6391 59800 1347419723 1 f none /usr/local/include/postgresql/server/access/spgist_private.h 0644 root root 22659 43385 1347419723 1 f none /usr/local/include/postgresql/server/access/subtrans.h 0644 root root 973 19627 1347419723 1 f none /usr/local/include/postgresql/server/access/sysattr.h 0644 root root 891 2124 1347419723 1 f none /usr/local/include/postgresql/server/access/transam.h 0644 root root 6161 59536 1347419723 1 f none /usr/local/include/postgresql/server/access/tupconvert.h 0644 root root 1287 37028 1347419723 1 f none /usr/local/include/postgresql/server/access/tupdesc.h 0644 root root 4241 32279 1347419723 1 f none /usr/local/include/postgresql/server/access/tupmacs.h 0644 root root 7326 56488 1347419723 1 f none /usr/local/include/postgresql/server/access/tuptoaster.h 0644 root root 5821 13150 1347419723 1 f none /usr/local/include/postgresql/server/access/twophase.h 0644 root root 1716 15073 1347419723 1 f none /usr/local/include/postgresql/server/access/twophase_rmgr.h 0644 root root 1272 34879 1347419723 1 f none /usr/local/include/postgresql/server/access/valid.h 0644 root root 1437 37032 1347419723 1 f none /usr/local/include/postgresql/server/access/visibilitymap.h 0644 root root 1178 30998 1347419723 1 f none /usr/local/include/postgresql/server/access/xact.h 0644 root root 8646 13793 1347419723 1 f none /usr/local/include/postgresql/server/access/xlog.h 0644 root root 12301 61077 1347419723 1 f none /usr/local/include/postgresql/server/access/xlog_internal.h 0644 root root 9567 7477 1347419723 1 f none /usr/local/include/postgresql/server/access/xlogdefs.h 0644 root root 4597 41837 1347419723 1 f none /usr/local/include/postgresql/server/access/xlogutils.h 0644 root root 956 18495 1347419723 1 d none /usr/local/include/postgresql/server/bootstrap 0755 root root 1 f none /usr/local/include/postgresql/server/bootstrap/bootstrap.h 0644 root root 1573 61655 1347419723 1 f none /usr/local/include/postgresql/server/c.h 0644 root root 24689 44709 1347419723 1 d none /usr/local/include/postgresql/server/catalog 0755 root root 1 f none /usr/local/include/postgresql/server/catalog/catalog.h 0644 root root 2099 42876 1347419723 1 f none /usr/local/include/postgresql/server/catalog/catversion.h 0644 root root 2586 22604 1347419723 1 f none /usr/local/include/postgresql/server/catalog/dependency.h 0644 root root 9669 16852 1347419723 1 f none /usr/local/include/postgresql/server/catalog/genbki.h 0644 root root 1794 14046 1347419723 1 f none /usr/local/include/postgresql/server/catalog/heap.h 0644 root root 3899 57913 1347419723 1 f none /usr/local/include/postgresql/server/catalog/index.h 0644 root root 2845 28723 1347419723 1 f none /usr/local/include/postgresql/server/catalog/indexing.h 0644 root root 16686 18284 1347419723 1 f none /usr/local/include/postgresql/server/catalog/namespace.h 0644 root root 5769 42170 1347419723 1 f none /usr/local/include/postgresql/server/catalog/objectaccess.h 0644 root root 1654 1004 1347419723 1 f none /usr/local/include/postgresql/server/catalog/objectaddress.h 0644 root root 1236 31185 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_aggregate.h 0644 root root 10609 43944 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_am.h 0644 root root 5941 33137 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_amop.h 0644 root root 25108 20608 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_amproc.h 0644 root root 14345 10564 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_attrdef.h 0644 root root 1670 63088 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_attribute.h 0644 root root 6949 55282 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_auth_members.h 0644 root root 1791 8636 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_authid.h 0644 root root 3270 3767 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_cast.h 0644 root root 11759 13768 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_class.h 0644 root root 6070 18629 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_collation.h 0644 root root 2284 43221 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_collation_fn.h 0644 root root 735 55497 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_constraint.h 0644 root root 8149 17531 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_control.h 0644 root root 8166 24816 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_conversion.h 0644 root root 2175 38551 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_conversion_fn.h 0644 root root 833 64411 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_database.h 0644 root root 2689 16061 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_db_role_setting.h 0644 root root 2008 28577 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_default_acl.h 0644 root root 2150 33859 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_depend.h 0644 root root 2796 27834 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_description.h 0644 root root 2985 46833 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_enum.h 0644 root root 1859 12008 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_extension.h 0644 root root 2136 37516 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_foreign_data_wrapper.h 0644 root root 2066 35018 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_foreign_server.h 0644 root root 1914 21633 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_foreign_table.h 0644 root root 1628 60303 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_index.h 0644 root root 3421 14992 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_inherits.h 0644 root root 1499 47948 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_inherits_fn.h 0644 root root 850 822 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_language.h 0644 root root 2442 57657 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_largeobject.h 0644 root root 1829 12311 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_largeobject_metadata.h 0644 root root 1714 4788 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_namespace.h 0644 root root 2282 40965 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_opclass.h 0644 root root 11699 44490 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_operator.h 0644 root root 98031 1469 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_opfamily.h 0644 root root 6493 63238 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_pltemplate.h 0644 root root 3185 64381 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_proc.h 0644 root root 461504 12506 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_proc_fn.h 0644 root root 1169 23528 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_range.h 0644 root root 2595 4977 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_rewrite.h 0644 root root 1893 18512 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_seclabel.h 0644 root root 1363 37456 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_shdepend.h 0644 root root 2815 28366 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_shdescription.h 0644 root root 2444 64232 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_shseclabel.h 0644 root root 1343 36227 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_statistic.h 0644 root root 11373 57274 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_tablespace.h 0644 root root 1891 14850 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_trigger.h 0644 root root 5746 56772 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_ts_config.h 0644 root root 1645 59783 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_ts_config_map.h 0644 root root 2334 38328 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_ts_dict.h 0644 root root 1822 9954 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_ts_parser.h 0644 root root 1993 26851 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_ts_template.h 0644 root root 2152 40685 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_type.h 0644 root root 42313 24492 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_type_fn.h 0644 root root 2126 30879 1347419723 1 f none /usr/local/include/postgresql/server/catalog/pg_user_mapping.h 0644 root root 1624 60121 1347419723 1 f none /usr/local/include/postgresql/server/catalog/schemapg.h 0644 root root 16154 34939 1347419723 1 f none /usr/local/include/postgresql/server/catalog/storage.h 0644 root root 1366 48541 1347419723 1 f none /usr/local/include/postgresql/server/catalog/toasting.h 0644 root root 1954 25184 1347419723 1 d none /usr/local/include/postgresql/server/commands 0755 root root 1 f none /usr/local/include/postgresql/server/commands/alter.h 0644 root root 942 8016 1347419723 1 f none /usr/local/include/postgresql/server/commands/async.h 0644 root root 1832 23595 1347419723 1 f none /usr/local/include/postgresql/server/commands/cluster.h 0644 root root 1167 27997 1347419723 1 f none /usr/local/include/postgresql/server/commands/collationcmds.h 0644 root root 919 7441 1347419723 1 f none /usr/local/include/postgresql/server/commands/comment.h 0644 root root 1364 38947 1347419723 1 f none /usr/local/include/postgresql/server/commands/conversioncmds.h 0644 root root 941 10217 1347419723 1 f none /usr/local/include/postgresql/server/commands/copy.h 0644 root root 1241 35297 1347419723 1 f none /usr/local/include/postgresql/server/commands/createas.h 0644 root root 801 61384 1347419723 1 f none /usr/local/include/postgresql/server/commands/dbcommands.h 0644 root root 2117 44688 1347419723 1 f none /usr/local/include/postgresql/server/commands/defrem.h 0644 root root 7701 31234 1347419723 1 f none /usr/local/include/postgresql/server/commands/discard.h 0644 root root 471 32118 1347419723 1 f none /usr/local/include/postgresql/server/commands/explain.h 0644 root root 2994 49722 1347419723 1 f none /usr/local/include/postgresql/server/commands/extension.h 0644 root root 1566 779 1347419723 1 f none /usr/local/include/postgresql/server/commands/lockcmds.h 0644 root root 559 39242 1347419723 1 f none /usr/local/include/postgresql/server/commands/portalcmds.h 0644 root root 896 4600 1347419723 1 f none /usr/local/include/postgresql/server/commands/prepare.h 0644 root root 2078 41852 1347419723 1 f none /usr/local/include/postgresql/server/commands/proclang.h 0644 root root 784 61944 1347419723 1 f none /usr/local/include/postgresql/server/commands/schemacmds.h 0644 root root 843 65332 1347419723 1 f none /usr/local/include/postgresql/server/commands/seclabel.h 0644 root root 970 16689 1347419723 1 f none /usr/local/include/postgresql/server/commands/sequence.h 0644 root root 1997 26269 1347419723 1 f none /usr/local/include/postgresql/server/commands/tablecmds.h 0644 root root 2339 735 1347419723 1 f none /usr/local/include/postgresql/server/commands/tablespace.h 0644 root root 1803 19133 1347419723 1 f none /usr/local/include/postgresql/server/commands/trigger.h 0644 root root 6780 25096 1347419723 1 f none /usr/local/include/postgresql/server/commands/typecmds.h 0644 root root 1917 30630 1347419723 1 f none /usr/local/include/postgresql/server/commands/user.h 0644 root root 1105 25135 1347419723 1 f none /usr/local/include/postgresql/server/commands/vacuum.h 0644 root root 6877 59395 1347419723 1 f none /usr/local/include/postgresql/server/commands/variable.h 0644 root root 1881 39127 1347419723 1 f none /usr/local/include/postgresql/server/commands/view.h 0644 root root 510 35677 1347419723 1 d none /usr/local/include/postgresql/server/datatype 0755 root root 1 f none /usr/local/include/postgresql/server/datatype/timestamp.h 0644 root root 5629 47604 1347419723 1 f none /usr/local/include/postgresql/server/dynloader.h 0644 root root 1053 15161 1347419723 1 d none /usr/local/include/postgresql/server/executor 0755 root root 1 f none /usr/local/include/postgresql/server/executor/execdebug.h 0644 root root 4426 64137 1347419723 1 f none /usr/local/include/postgresql/server/executor/execdesc.h 0644 root root 2384 61582 1347419723 1 f none /usr/local/include/postgresql/server/executor/executor.h 0644 root root 14798 50206 1347419723 1 f none /usr/local/include/postgresql/server/executor/functions.h 0644 root root 1150 26343 1347419723 1 f none /usr/local/include/postgresql/server/executor/hashjoin.h 0644 root root 7353 30831 1347419723 1 f none /usr/local/include/postgresql/server/executor/instrument.h 0644 root root 2857 37851 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeAgg.h 0644 root root 782 59303 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeAppend.h 0644 root root 701 52560 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeBitmapAnd.h 0644 root root 738 55773 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeBitmapHeapscan.h 0644 root root 813 62912 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeBitmapIndexscan.h 0644 root root 822 64009 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeBitmapOr.h 0644 root root 724 54721 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeCtescan.h 0644 root root 715 53646 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeForeignscan.h 0644 root root 771 59282 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeFunctionscan.h 0644 root root 785 60922 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeGroup.h 0644 root root 716 54291 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeHash.h 0644 root root 1926 27070 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeHashjoin.h 0644 root root 890 3738 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeIndexonlyscan.h 0644 root root 920 8044 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeIndexscan.h 0644 root root 1558 62898 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeLimit.h 0644 root root 687 51410 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeLockRows.h 0644 root root 729 55544 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeMaterial.h 0644 root root 838 54 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeMergeAppend.h 0644 root root 771 59120 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeMergejoin.h 0644 root root 743 56576 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeModifyTable.h 0644 root root 768 59148 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeNestloop.h 0644 root root 729 55608 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeRecursiveunion.h 0644 root root 813 64174 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeResult.h 0644 root root 802 62613 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeSeqscan.h 0644 root root 812 62745 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeSetOp.h 0644 root root 687 51226 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeSort.h 0644 root root 766 58935 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeSubplan.h 0644 root root 812 63210 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeSubqueryscan.h 0644 root root 785 61286 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeTidscan.h 0644 root root 812 62601 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeUnique.h 0644 root root 701 52994 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeValuesscan.h 0644 root root 866 2808 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeWindowAgg.h 0644 root root 776 59673 1347419723 1 f none /usr/local/include/postgresql/server/executor/nodeWorktablescan.h 0644 root root 799 61952 1347419723 1 f none /usr/local/include/postgresql/server/executor/spi.h 0644 root root 5543 6791 1347419723 1 f none /usr/local/include/postgresql/server/executor/spi_priv.h 0644 root root 3318 17303 1347419723 1 f none /usr/local/include/postgresql/server/executor/tstoreReceiver.h 0644 root root 767 57546 1347419723 1 f none /usr/local/include/postgresql/server/executor/tuptable.h 0644 root root 8591 32493 1347419723 1 f none /usr/local/include/postgresql/server/fmgr.h 0644 root root 30065 54957 1347419723 1 d none /usr/local/include/postgresql/server/foreign 0755 root root 1 f none /usr/local/include/postgresql/server/foreign/fdwapi.h 0644 root root 3083 51822 1347419723 1 f none /usr/local/include/postgresql/server/foreign/foreign.h 0644 root root 2606 12795 1347419723 1 f none /usr/local/include/postgresql/server/funcapi.h 0644 root root 10324 7657 1347419723 1 f none /usr/local/include/postgresql/server/getaddrinfo.h 0644 root root 3936 50846 1347419723 1 f none /usr/local/include/postgresql/server/getopt_long.h 0644 root root 827 2276 1347419723 1 d none /usr/local/include/postgresql/server/lib 0755 root root 1 f none /usr/local/include/postgresql/server/lib/dllist.h 0644 root root 2871 31329 1347419723 1 f none /usr/local/include/postgresql/server/lib/stringinfo.h 0644 root root 5489 56620 1347419723 1 d none /usr/local/include/postgresql/server/libpq 0755 root root 1 f none /usr/local/include/postgresql/server/libpq/auth.h 0644 root root 903 6942 1347419723 1 f none /usr/local/include/postgresql/server/libpq/be-fsstubs.h 0644 root root 1610 63743 1347419723 1 f none /usr/local/include/postgresql/server/libpq/crypt.h 0644 root root 550 39406 1347419723 1 f none /usr/local/include/postgresql/server/libpq/hba.h 0644 root root 1780 10147 1347419723 1 f none /usr/local/include/postgresql/server/libpq/ip.h 0644 root root 1704 5168 1347419723 1 f none /usr/local/include/postgresql/server/libpq/libpq-be.h 0644 root root 5584 61607 1347419723 1 f none /usr/local/include/postgresql/server/libpq/libpq-fs.h 0644 root root 633 44679 1347419723 1 f none /usr/local/include/postgresql/server/libpq/libpq.h 0644 root root 2453 10988 1347419723 1 f none /usr/local/include/postgresql/server/libpq/md5.h 0644 root root 901 2480 1347419723 1 f none /usr/local/include/postgresql/server/libpq/pqcomm.h 0644 root root 5800 11746 1347419723 1 f none /usr/local/include/postgresql/server/libpq/pqformat.h 0644 root root 1997 42679 1347419723 1 f none /usr/local/include/postgresql/server/libpq/pqsignal.h 0644 root root 1300 33631 1347419723 1 d none /usr/local/include/postgresql/server/mb 0755 root root 1 f none /usr/local/include/postgresql/server/mb/pg_wchar.h 0644 root root 17249 36233 1347419723 1 f none /usr/local/include/postgresql/server/miscadmin.h 0644 root root 15125 8175 1347419723 1 d none /usr/local/include/postgresql/server/nodes 0755 root root 1 f none /usr/local/include/postgresql/server/nodes/bitmapset.h 0644 root root 3440 28053 1347419723 1 f none /usr/local/include/postgresql/server/nodes/execnodes.h 0644 root root 66161 1017 1347419723 1 f none /usr/local/include/postgresql/server/nodes/makefuncs.h 0644 root root 2380 147 1347419723 1 f none /usr/local/include/postgresql/server/nodes/memnodes.h 0644 root root 2614 20900 1347419723 1 f none /usr/local/include/postgresql/server/nodes/nodeFuncs.h 0644 root root 2510 3312 1347419723 1 f none /usr/local/include/postgresql/server/nodes/nodes.h 0644 root root 13865 21195 1347419723 1 f none /usr/local/include/postgresql/server/nodes/params.h 0644 root root 3776 47449 1347419723 1 f none /usr/local/include/postgresql/server/nodes/parsenodes.h 0644 root root 88399 53169 1347419723 1 f none /usr/local/include/postgresql/server/nodes/pg_list.h 0644 root root 11367 37318 1347419723 1 f none /usr/local/include/postgresql/server/nodes/plannodes.h 0644 root root 28122 7204 1347419723 1 f none /usr/local/include/postgresql/server/nodes/primnodes.h 0644 root root 50383 64749 1347419723 1 f none /usr/local/include/postgresql/server/nodes/print.h 0644 root root 1070 21166 1347419723 1 f none /usr/local/include/postgresql/server/nodes/readfuncs.h 0644 root root 897 3910 1347419723 1 f none /usr/local/include/postgresql/server/nodes/relation.h 0644 root root 69030 9115 1347419723 1 f none /usr/local/include/postgresql/server/nodes/replnodes.h 0644 root root 1053 8745 1347419723 1 f none /usr/local/include/postgresql/server/nodes/tidbitmap.h 0644 root root 2238 54195 1347419723 1 f none /usr/local/include/postgresql/server/nodes/value.h 0644 root root 1798 10409 1347419723 1 d none /usr/local/include/postgresql/server/optimizer 0755 root root 1 f none /usr/local/include/postgresql/server/optimizer/clauses.h 0644 root root 2999 64034 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/cost.h 0644 root root 7502 46997 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/geqo.h 0644 root root 2173 34361 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/geqo_copy.h 0644 root root 966 2865 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/geqo_gene.h 0644 root root 1114 13818 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/geqo_misc.h 0644 root root 1124 15692 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/geqo_mutation.h 0644 root root 959 2185 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/geqo_pool.h 0644 root root 1317 35034 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/geqo_random.h 0644 root root 1312 31647 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/geqo_recombination.h 0644 root root 2644 13745 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/geqo_selection.h 0644 root root 1015 6141 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/joininfo.h 0644 root root 836 63227 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/pathnode.h 0644 root root 5513 62611 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/paths.h 0644 root root 6734 36713 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/placeholder.h 0644 root root 1233 35170 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/plancat.h 0644 root root 1691 3782 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/planmain.h 0644 root root 4974 30890 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/planner.h 0644 root root 1363 43470 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/predtest.h 0644 root root 668 49780 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/prep.h 0644 root root 1657 8058 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/restrictinfo.h 0644 root root 1754 13971 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/subselect.h 0644 root root 1417 49691 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/tlist.h 0644 root root 1594 3728 1347419723 1 f none /usr/local/include/postgresql/server/optimizer/var.h 0644 root root 1534 59450 1347419723 1 d none /usr/local/include/postgresql/server/parser 0755 root root 1 f none /usr/local/include/postgresql/server/parser/analyze.h 0644 root root 1465 54867 1347419723 1 f none /usr/local/include/postgresql/server/parser/gram.h 0644 root root 11350 22875 1347419723 1 f none /usr/local/include/postgresql/server/parser/gramparse.h 0644 root root 2149 44822 1347419723 1 f none /usr/local/include/postgresql/server/parser/keywords.h 0644 root root 1055 14503 1347419723 1 f none /usr/local/include/postgresql/server/parser/kwlist.h 0644 root root 20745 37109 1347419723 1 f none /usr/local/include/postgresql/server/parser/parse_agg.h 0644 root root 1152 23815 1347419723 1 f none /usr/local/include/postgresql/server/parser/parse_clause.h 0644 root root 1772 15441 1347419723 1 f none /usr/local/include/postgresql/server/parser/parse_coerce.h 0644 root root 3116 57264 1347419723 1 f none /usr/local/include/postgresql/server/parser/parse_collate.h 0644 root root 829 65444 1347419723 1 f none /usr/local/include/postgresql/server/parser/parse_cte.h 0644 root root 694 51806 1347419723 1 f none /usr/local/include/postgresql/server/parser/parse_expr.h 0644 root root 619 45566 1347419723 1 f none /usr/local/include/postgresql/server/parser/parse_func.h 0644 root root 2672 18426 1347419723 1 f none /usr/local/include/postgresql/server/parser/parse_node.h 0644 root root 6244 11590 1347419723 1 f none /usr/local/include/postgresql/server/parser/parse_oper.h 0644 root root 2497 9498 1347419723 1 f none /usr/local/include/postgresql/server/parser/parse_param.h 0644 root root 776 59320 1347419723 1 f none /usr/local/include/postgresql/server/parser/parse_relation.h 0644 root root 3544 24362 1347419723 1 f none /usr/local/include/postgresql/server/parser/parse_target.h 0644 root root 1425 48194 1347419723 1 f none /usr/local/include/postgresql/server/parser/parse_type.h 0644 root root 1710 11912 1347419723 1 f none /usr/local/include/postgresql/server/parser/parse_utilcmd.h 0644 root root 953 10432 1347419723 1 f none /usr/local/include/postgresql/server/parser/parser.h 0644 root root 1146 25345 1347419723 1 f none /usr/local/include/postgresql/server/parser/parsetree.h 0644 root root 2069 32621 1347419723 1 f none /usr/local/include/postgresql/server/parser/scanner.h 0644 root root 4199 25390 1347419723 1 f none /usr/local/include/postgresql/server/parser/scansup.h 0644 root root 752 57084 1347419723 1 f none /usr/local/include/postgresql/server/pg_config.h 0644 root root 26316 5454 1347419723 1 f none /usr/local/include/postgresql/server/pg_config_manual.h 0644 root root 9261 50041 1347419723 1 f none /usr/local/include/postgresql/server/pg_config_os.h 0644 root root 1041 19956 1347419723 1 f none /usr/local/include/postgresql/server/pg_trace.h 0644 root root 316 23828 1347419723 1 f none /usr/local/include/postgresql/server/pgstat.h 0644 root root 24463 41272 1347419723 1 f none /usr/local/include/postgresql/server/pgtime.h 0644 root root 2056 38441 1347419723 1 f none /usr/local/include/postgresql/server/plpgsql.h 0644 root root 26354 20318 1347419725 1 d none /usr/local/include/postgresql/server/port 0755 root root 1 f none /usr/local/include/postgresql/server/port.h 0644 root root 13841 61945 1347419723 1 f none /usr/local/include/postgresql/server/port/aix.h 0644 root root 82 6256 1347419723 1 f none /usr/local/include/postgresql/server/port/cygwin.h 0644 root root 436 35069 1347419723 1 f none /usr/local/include/postgresql/server/port/darwin.h 0644 root root 157 12088 1347419723 1 f none /usr/local/include/postgresql/server/port/freebsd.h 0644 root root 33 2795 1347419723 1 f none /usr/local/include/postgresql/server/port/hpux.h 0644 root root 52 4183 1347419723 1 f none /usr/local/include/postgresql/server/port/irix.h 0644 root root 191 15025 1347419723 1 f none /usr/local/include/postgresql/server/port/linux.h 0644 root root 1051 25270 1347419723 1 f none /usr/local/include/postgresql/server/port/netbsd.h 0644 root root 32 2704 1347419723 1 f none /usr/local/include/postgresql/server/port/openbsd.h 0644 root root 33 2811 1347419723 1 f none /usr/local/include/postgresql/server/port/osf.h 0644 root root 73 5705 1347419723 1 f none /usr/local/include/postgresql/server/port/sco.h 0644 root root 115 9040 1347419723 1 f none /usr/local/include/postgresql/server/port/solaris.h 0644 root root 1041 19956 1347419723 1 f none /usr/local/include/postgresql/server/port/unixware.h 0644 root root 279 19440 1347419723 1 d none /usr/local/include/postgresql/server/port/win32 0755 root root 1 f none /usr/local/include/postgresql/server/port/win32.h 0644 root root 12891 6721 1347419723 1 d none /usr/local/include/postgresql/server/port/win32/arpa 0755 root root 1 f none /usr/local/include/postgresql/server/port/win32/arpa/inet.h 0644 root root 66 5591 1347419723 1 f none /usr/local/include/postgresql/server/port/win32/dlfcn.h 0644 root root 37 3065 1347419723 1 f none /usr/local/include/postgresql/server/port/win32/grp.h 0644 root root 35 2875 1347419723 1 f none /usr/local/include/postgresql/server/port/win32/netdb.h 0644 root root 37 3071 1347419723 1 d none /usr/local/include/postgresql/server/port/win32/netinet 0755 root root 1 f none /usr/local/include/postgresql/server/port/win32/netinet/in.h 0644 root root 67 5713 1347419723 1 f none /usr/local/include/postgresql/server/port/win32/pwd.h 0644 root root 39 2971 1347419723 1 d none /usr/local/include/postgresql/server/port/win32/sys 0755 root root 1 f none /usr/local/include/postgresql/server/port/win32/sys/socket.h 0644 root root 696 57001 1347419723 1 f none /usr/local/include/postgresql/server/port/win32/sys/wait.h 0644 root root 44 3475 1347419723 1 d none /usr/local/include/postgresql/server/port/win32_msvc 0755 root root 1 f none /usr/local/include/postgresql/server/port/win32_msvc/dirent.h 0644 root root 411 33794 1347419723 1 d none /usr/local/include/postgresql/server/port/win32_msvc/sys 0755 root root 1 f none /usr/local/include/postgresql/server/port/win32_msvc/sys/file.h 0644 root root 45 3896 1347419723 1 f none /usr/local/include/postgresql/server/port/win32_msvc/sys/param.h 0644 root root 46 4009 1347419723 1 f none /usr/local/include/postgresql/server/port/win32_msvc/sys/time.h 0644 root root 45 3911 1347419723 1 f none /usr/local/include/postgresql/server/port/win32_msvc/unistd.h 0644 root root 43 3745 1347419723 1 f none /usr/local/include/postgresql/server/port/win32_msvc/utime.h 0644 root root 42 3630 1347419723 1 d none /usr/local/include/postgresql/server/portability 0755 root root 1 f none /usr/local/include/postgresql/server/portability/instr_time.h 0644 root root 4262 61224 1347419723 1 f none /usr/local/include/postgresql/server/postgres.h 0644 root root 20550 48738 1347419723 1 f none /usr/local/include/postgresql/server/postgres_ext.h 0644 root root 1778 8903 1347419723 1 f none /usr/local/include/postgresql/server/postgres_fe.h 0644 root root 730 54063 1347419723 1 d none /usr/local/include/postgresql/server/postmaster 0755 root root 1 f none /usr/local/include/postgresql/server/postmaster/autovacuum.h 0644 root root 1965 40205 1347419723 1 f none /usr/local/include/postgresql/server/postmaster/bgwriter.h 0644 root root 1239 37701 1347419723 1 f none /usr/local/include/postgresql/server/postmaster/fork_process.h 0644 root root 447 30691 1347419723 1 f none /usr/local/include/postgresql/server/postmaster/pgarch.h 0644 root root 641 45645 1347419723 1 f none /usr/local/include/postgresql/server/postmaster/postmaster.h 0644 root root 1765 17711 1347419723 1 f none /usr/local/include/postgresql/server/postmaster/startup.h 0644 root root 635 48878 1347419723 1 f none /usr/local/include/postgresql/server/postmaster/syslogger.h 0644 root root 2571 10401 1347419723 1 f none /usr/local/include/postgresql/server/postmaster/walwriter.h 0644 root root 487 33996 1347419723 1 d none /usr/local/include/postgresql/server/regex 0755 root root 1 f none /usr/local/include/postgresql/server/regex/regcustom.h 0644 root root 2892 31982 1347419723 1 f none /usr/local/include/postgresql/server/regex/regerrs.h 0644 root root 1214 25525 1347419723 1 f none /usr/local/include/postgresql/server/regex/regex.h 0644 root root 6595 52283 1347419723 1 f none /usr/local/include/postgresql/server/regex/regguts.h 0644 root root 15392 50306 1347419723 1 d none /usr/local/include/postgresql/server/replication 0755 root root 1 f none /usr/local/include/postgresql/server/replication/basebackup.h 0644 root root 494 34341 1347419723 1 f none /usr/local/include/postgresql/server/replication/syncrep.h 0644 root root 1518 55943 1347419723 1 f none /usr/local/include/postgresql/server/replication/walprotocol.h 0644 root root 3366 17716 1347419723 1 f none /usr/local/include/postgresql/server/replication/walreceiver.h 0644 root root 3884 981 1347419723 1 f none /usr/local/include/postgresql/server/replication/walsender.h 0644 root root 1001 16364 1347419723 1 f none /usr/local/include/postgresql/server/replication/walsender_private.h 0644 root root 3036 53296 1347419723 1 d none /usr/local/include/postgresql/server/rewrite 0755 root root 1 f none /usr/local/include/postgresql/server/rewrite/prs2lock.h 0644 root root 1070 16122 1347419723 1 f none /usr/local/include/postgresql/server/rewrite/rewriteDefine.h 0644 root root 1143 20696 1347419723 1 f none /usr/local/include/postgresql/server/rewrite/rewriteHandler.h 0644 root root 744 57214 1347419723 1 f none /usr/local/include/postgresql/server/rewrite/rewriteManip.h 0644 root root 2764 37971 1347419723 1 f none /usr/local/include/postgresql/server/rewrite/rewriteRemove.h 0644 root root 537 38035 1347419723 1 f none /usr/local/include/postgresql/server/rewrite/rewriteSupport.h 0644 root root 911 5157 1347419723 1 f none /usr/local/include/postgresql/server/rusagestub.h 0644 root root 843 61889 1347419723 1 d none /usr/local/include/postgresql/server/snowball 0755 root root 1 f none /usr/local/include/postgresql/server/snowball/header.h 0644 root root 1690 5770 1347419723 1 d none /usr/local/include/postgresql/server/snowball/libstemmer 0755 root root 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/api.h 0644 root root 763 64946 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/header.h 0644 root root 2487 16389 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_danish.h 0644 root root 325 28045 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_dutch.h 0644 root root 322 27760 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_english.h 0644 root root 328 28390 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_finnish.h 0644 root root 328 28405 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_french.h 0644 root root 325 28042 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_german.h 0644 root root 325 28054 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_hungarian.h 0644 root root 334 29023 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_italian.h 0644 root root 328 28366 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_norwegian.h 0644 root root 334 29062 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_porter.h 0644 root root 325 28156 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_portuguese.h 0644 root root 337 29473 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_spanish.h 0644 root root 328 28426 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_swedish.h 0644 root root 328 28429 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_2_romanian.h 0644 root root 331 28714 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_KOI8_R_russian.h 0644 root root 316 27763 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_danish.h 0644 root root 310 27127 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_dutch.h 0644 root root 307 26842 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_english.h 0644 root root 313 27472 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_finnish.h 0644 root root 313 27487 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_french.h 0644 root root 310 27124 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_german.h 0644 root root 310 27136 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_hungarian.h 0644 root root 319 28105 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_italian.h 0644 root root 313 27448 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_norwegian.h 0644 root root 319 28144 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_porter.h 0644 root root 310 27238 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_portuguese.h 0644 root root 322 28555 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_romanian.h 0644 root root 316 27793 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_russian.h 0644 root root 313 27553 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_spanish.h 0644 root root 313 27508 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_swedish.h 0644 root root 313 27511 1347419723 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_turkish.h 0644 root root 313 27568 1347419723 1 d none /usr/local/include/postgresql/server/storage 0755 root root 1 f none /usr/local/include/postgresql/server/storage/backendid.h 0644 root root 730 51005 1347419723 1 f none /usr/local/include/postgresql/server/storage/barrier.h 0644 root root 6445 25044 1347419723 1 f none /usr/local/include/postgresql/server/storage/block.h 0644 root root 3281 1187 1347419723 1 f none /usr/local/include/postgresql/server/storage/buf.h 0644 root root 1082 17129 1347419723 1 f none /usr/local/include/postgresql/server/storage/buf_internals.h 0644 root root 7963 13200 1347419723 1 f none /usr/local/include/postgresql/server/storage/buffile.h 0644 root root 1714 12012 1347419723 1 f none /usr/local/include/postgresql/server/storage/bufmgr.h 0644 root root 6950 62401 1347419723 1 f none /usr/local/include/postgresql/server/storage/bufpage.h 0644 root root 13193 12038 1347419723 1 f none /usr/local/include/postgresql/server/storage/copydir.h 0644 root root 561 40290 1347419723 1 f none /usr/local/include/postgresql/server/storage/fd.h 0644 root root 3423 24352 1347419723 1 f none /usr/local/include/postgresql/server/storage/freespace.h 0644 root root 1264 35691 1347419723 1 f none /usr/local/include/postgresql/server/storage/fsm_internals.h 0644 root root 2296 57945 1347419723 1 f none /usr/local/include/postgresql/server/storage/indexfsm.h 0644 root root 795 61420 1347419723 1 f none /usr/local/include/postgresql/server/storage/ipc.h 0644 root root 2600 18517 1347419723 1 f none /usr/local/include/postgresql/server/storage/item.h 0644 root root 469 31708 1347419723 1 f none /usr/local/include/postgresql/server/storage/itemid.h 0644 root root 4341 14322 1347419723 1 f none /usr/local/include/postgresql/server/storage/itemptr.h 0644 root root 3812 54502 1347419723 1 f none /usr/local/include/postgresql/server/storage/large_object.h 0644 root root 2964 48730 1347419723 1 f none /usr/local/include/postgresql/server/storage/latch.h 0644 root root 5399 2495 1347419723 1 f none /usr/local/include/postgresql/server/storage/lmgr.h 0644 root root 3224 12313 1347419723 1 f none /usr/local/include/postgresql/server/storage/lock.h 0644 root root 20611 64853 1347419723 1 f none /usr/local/include/postgresql/server/storage/lwlock.h 0644 root root 3665 42202 1347419723 1 f none /usr/local/include/postgresql/server/storage/off.h 0644 root root 1618 60679 1347419723 1 f none /usr/local/include/postgresql/server/storage/pg_sema.h 0644 root root 2469 10863 1347419723 1 f none /usr/local/include/postgresql/server/storage/pg_shmem.h 0644 root root 1956 27391 1347419723 1 f none /usr/local/include/postgresql/server/storage/pmsignal.h 0644 root root 2080 41129 1347419723 1 f none /usr/local/include/postgresql/server/storage/pos.h 0644 root root 1592 60695 1347419723 1 f none /usr/local/include/postgresql/server/storage/predicate.h 0644 root root 2623 32119 1347419723 1 f none /usr/local/include/postgresql/server/storage/predicate_internals.h 0644 root root 17906 55412 1347419723 1 f none /usr/local/include/postgresql/server/storage/proc.h 0644 root root 9801 33810 1347419723 1 f none /usr/local/include/postgresql/server/storage/procarray.h 0644 root root 2958 62117 1347419723 1 f none /usr/local/include/postgresql/server/storage/procsignal.h 0644 root root 1798 13394 1347419723 1 f none /usr/local/include/postgresql/server/storage/reinit.h 0644 root root 588 41139 1347419723 1 f none /usr/local/include/postgresql/server/storage/relfilenode.h 0644 root root 4416 41241 1347419723 1 f none /usr/local/include/postgresql/server/storage/s_lock.h 0644 root root 26285 63248 1347419723 1 f none /usr/local/include/postgresql/server/storage/shmem.h 0644 root root 2694 26282 1347419723 1 f none /usr/local/include/postgresql/server/storage/sinval.h 0644 root root 5089 33061 1347419723 1 f none /usr/local/include/postgresql/server/storage/sinvaladt.h 0644 root root 1522 61336 1347419723 1 f none /usr/local/include/postgresql/server/storage/smgr.h 0644 root root 5583 30862 1347419723 1 f none /usr/local/include/postgresql/server/storage/spin.h 0644 root root 2568 16803 1347419723 1 f none /usr/local/include/postgresql/server/storage/standby.h 0644 root root 4085 26198 1347419723 1 d none /usr/local/include/postgresql/server/tcop 0755 root root 1 f none /usr/local/include/postgresql/server/tcop/dest.h 0644 root root 5670 24127 1347419723 1 f none /usr/local/include/postgresql/server/tcop/fastpath.h 0644 root root 509 35675 1347419723 1 f none /usr/local/include/postgresql/server/tcop/pquery.h 0644 root root 1161 27113 1347419723 1 f none /usr/local/include/postgresql/server/tcop/tcopdebug.h 0644 root root 1316 21742 1347419723 1 f none /usr/local/include/postgresql/server/tcop/tcopprot.h 0644 root root 2996 55912 1347419723 1 f none /usr/local/include/postgresql/server/tcop/utility.h 0644 root root 1514 59783 1347419723 1 d none /usr/local/include/postgresql/server/tsearch 0755 root root 1 d none /usr/local/include/postgresql/server/tsearch/dicts 0755 root root 1 f none /usr/local/include/postgresql/server/tsearch/dicts/regis.h 0644 root root 915 1629 1347419723 1 f none /usr/local/include/postgresql/server/tsearch/dicts/spell.h 0644 root root 3697 26849 1347419723 1 f none /usr/local/include/postgresql/server/tsearch/ts_cache.h 0644 root root 2109 38292 1347419723 1 f none /usr/local/include/postgresql/server/tsearch/ts_locale.h 0644 root root 2055 33086 1347419723 1 f none /usr/local/include/postgresql/server/tsearch/ts_public.h 0644 root root 2809 21524 1347419723 1 f none /usr/local/include/postgresql/server/tsearch/ts_type.h 0644 root root 8812 55356 1347419723 1 f none /usr/local/include/postgresql/server/tsearch/ts_utils.h 0644 root root 7829 4582 1347419723 1 d none /usr/local/include/postgresql/server/utils 0755 root root 1 f none /usr/local/include/postgresql/server/utils/acl.h 0644 root root 13098 31821 1347419723 1 f none /usr/local/include/postgresql/server/utils/array.h 0644 root root 10863 57414 1347419723 1 f none /usr/local/include/postgresql/server/utils/ascii.h 0644 root root 579 42025 1347419723 1 f none /usr/local/include/postgresql/server/utils/attoptcache.h 0644 root root 716 53471 1347419723 1 f none /usr/local/include/postgresql/server/utils/builtins.h 0644 root root 48719 42868 1347419723 1 f none /usr/local/include/postgresql/server/utils/bytea.h 0644 root root 1615 64112 1347419723 1 f none /usr/local/include/postgresql/server/utils/cash.h 0644 root root 2118 45533 1347419723 1 f none /usr/local/include/postgresql/server/utils/catcache.h 0644 root root 7734 43523 1347419723 1 f none /usr/local/include/postgresql/server/utils/combocid.h 0644 root root 698 52060 1347419723 1 f none /usr/local/include/postgresql/server/utils/date.h 0644 root root 7919 4881 1347419723 1 f none /usr/local/include/postgresql/server/utils/datetime.h 0644 root root 8757 23248 1347419723 1 f none /usr/local/include/postgresql/server/utils/datum.h 0644 root root 1520 57061 1347419723 1 f none /usr/local/include/postgresql/server/utils/dynahash.h 0644 root root 498 34232 1347419723 1 f none /usr/local/include/postgresql/server/utils/dynamic_loader.h 0644 root root 648 47623 1347419723 1 f none /usr/local/include/postgresql/server/utils/elog.h 0644 root root 12857 14027 1347419723 1 f none /usr/local/include/postgresql/server/utils/errcodes.h 0644 root root 20079 65175 1347419723 1 f none /usr/local/include/postgresql/server/utils/fmgroids.h 0644 root root 62560 44991 1347419723 1 f none /usr/local/include/postgresql/server/utils/fmgrtab.h 0644 root root 1181 25590 1347419723 1 f none /usr/local/include/postgresql/server/utils/formatting.h 0644 root root 1261 35536 1347419723 1 f none /usr/local/include/postgresql/server/utils/geo_decls.h 0644 root root 16242 60062 1347419723 1 f none /usr/local/include/postgresql/server/utils/guc.h 0644 root root 13503 20197 1347419723 1 f none /usr/local/include/postgresql/server/utils/guc_tables.h 0644 root root 7319 12077 1347419723 1 f none /usr/local/include/postgresql/server/utils/help_config.h 0644 root root 432 29084 1347419723 1 f none /usr/local/include/postgresql/server/utils/hsearch.h 0644 root root 5639 8050 1347419723 1 f none /usr/local/include/postgresql/server/utils/inet.h 0644 root root 2722 23333 1347419723 1 f none /usr/local/include/postgresql/server/utils/int8.h 0644 root root 4130 8792 1347419723 1 f none /usr/local/include/postgresql/server/utils/inval.h 0644 root root 1849 23057 1347419723 1 f none /usr/local/include/postgresql/server/utils/json.h 0644 root root 916 5604 1347419723 1 f none /usr/local/include/postgresql/server/utils/logtape.h 0644 root root 1539 62057 1347419723 1 f none /usr/local/include/postgresql/server/utils/lsyscache.h 0644 root root 6663 64530 1347419723 1 f none /usr/local/include/postgresql/server/utils/memutils.h 0644 root root 5037 38397 1347419723 1 f none /usr/local/include/postgresql/server/utils/nabstime.h 0644 root root 5927 24841 1347419723 1 f none /usr/local/include/postgresql/server/utils/numeric.h 0644 root root 1833 13366 1347419723 1 f none /usr/local/include/postgresql/server/utils/palloc.h 0644 root root 4006 20054 1347419723 1 f none /usr/local/include/postgresql/server/utils/pg_crc.h 0644 root root 4465 22267 1347419723 1 f none /usr/local/include/postgresql/server/utils/pg_crc_tables.h 0644 root root 20203 47300 1347419723 1 f none /usr/local/include/postgresql/server/utils/pg_locale.h 0644 root root 2614 29074 1347419723 1 f none /usr/local/include/postgresql/server/utils/pg_lzcompress.h 0644 root root 3045 45929 1347419723 1 f none /usr/local/include/postgresql/server/utils/pg_rusage.h 0644 root root 847 65424 1347419723 1 f none /usr/local/include/postgresql/server/utils/plancache.h 0644 root root 7347 35915 1347419723 1 f none /usr/local/include/postgresql/server/utils/portal.h 0644 root root 8911 37494 1347419723 1 f none /usr/local/include/postgresql/server/utils/probes.h 0644 root root 6654 33176 1347419723 1 f none /usr/local/include/postgresql/server/utils/ps_status.h 0644 root root 668 51504 1347419723 1 f none /usr/local/include/postgresql/server/utils/rangetypes.h 0644 root root 7577 38449 1347419723 1 f none /usr/local/include/postgresql/server/utils/rbtree.h 0644 root root 2312 55775 1347419723 1 f none /usr/local/include/postgresql/server/utils/rel.h 0644 root root 12658 16510 1347419723 1 f none /usr/local/include/postgresql/server/utils/relcache.h 0644 root root 3241 11100 1347419723 1 f none /usr/local/include/postgresql/server/utils/relmapper.h 0644 root root 1719 8149 1347419723 1 f none /usr/local/include/postgresql/server/utils/reltrigger.h 0644 root root 1999 33515 1347419723 1 f none /usr/local/include/postgresql/server/utils/resowner.h 0644 root root 4960 36572 1347419723 1 f none /usr/local/include/postgresql/server/utils/selfuncs.h 0644 root root 7533 40605 1347419723 1 f none /usr/local/include/postgresql/server/utils/snapmgr.h 0644 root root 1625 10656 1347419723 1 f none /usr/local/include/postgresql/server/utils/snapshot.h 0644 root root 2653 19559 1347419723 1 f none /usr/local/include/postgresql/server/utils/sortsupport.h 0644 root root 5427 64487 1347419723 1 f none /usr/local/include/postgresql/server/utils/spccache.h 0644 root root 556 39333 1347419723 1 f none /usr/local/include/postgresql/server/utils/syscache.h 0644 root root 5593 50252 1347419723 1 f none /usr/local/include/postgresql/server/utils/timestamp.h 0644 root root 9731 51308 1347419723 1 f none /usr/local/include/postgresql/server/utils/tqual.h 0644 root root 3507 34041 1347419723 1 f none /usr/local/include/postgresql/server/utils/tuplesort.h 0644 root root 4726 19377 1347419723 1 f none /usr/local/include/postgresql/server/utils/tuplestore.h 0644 root root 3213 21407 1347419723 1 f none /usr/local/include/postgresql/server/utils/typcache.h 0644 root root 4361 31294 1347419723 1 f none /usr/local/include/postgresql/server/utils/tzparser.h 0644 root root 993 10973 1347419723 1 f none /usr/local/include/postgresql/server/utils/uuid.h 0644 root root 861 63449 1347419723 1 f none /usr/local/include/postgresql/server/utils/varbit.h 0644 root root 4159 7206 1347419723 1 f none /usr/local/include/postgresql/server/utils/xml.h 0644 root root 3986 15516 1347419723 1 f none /usr/local/include/postgresql/server/windowapi.h 0644 root root 2379 2298 1347419723 1 f none /usr/local/include/sql3types.h 0644 root root 834 59470 1347419724 1 f none /usr/local/include/sqlca.h 0644 root root 1267 26312 1347419724 1 f none /usr/local/include/sqlda-compat.h 0644 root root 1583 59559 1347419724 1 f none /usr/local/include/sqlda-native.h 0644 root root 820 2805 1347419724 1 f none /usr/local/include/sqlda.h 0644 root root 315 27403 1347419724 1 d none /usr/local/lib 0755 root root 1 f none /usr/local/lib/libecpg.a 0644 root root 948876 28827 1347419724 1 s none /usr/local/lib/libecpg.so=libecpg.so.6.4 1 s none /usr/local/lib/libecpg.so.6=libecpg.so.6.4 1 f none /usr/local/lib/libecpg.so.6.4 0755 root root 921184 50384 1347419724 1 f none /usr/local/lib/libecpg_compat.a 0644 root root 18920 55024 1347419724 1 s none /usr/local/lib/libecpg_compat.so=libecpg_compat.so.3.4 1 s none /usr/local/lib/libecpg_compat.so.3=libecpg_compat.so.3.4 1 f none /usr/local/lib/libecpg_compat.so.3.4 0755 root root 22208 8423 1347419724 1 f none /usr/local/lib/libpgport.a 0644 root root 115128 4264 1347419720 1 f none /usr/local/lib/libpgtypes.a 0644 root root 113020 23569 1347419724 1 s none /usr/local/lib/libpgtypes.so=libpgtypes.so.3.3 1 s none /usr/local/lib/libpgtypes.so.3=libpgtypes.so.3.3 1 f none /usr/local/lib/libpgtypes.so.3.3 0755 root root 98484 55983 1347419724 1 f none /usr/local/lib/libpq.a 0644 root root 327000 20320 1347419723 1 s none /usr/local/lib/libpq.so=libpq.so.5.5 1 s none /usr/local/lib/libpq.so.5=libpq.so.5.5 1 f none /usr/local/lib/libpq.so.5.5 0755 root root 277820 14018 1347419723 1 d none /usr/local/lib/postgresql 0755 root root 1 f none /usr/local/lib/postgresql/_int.so 0755 root root 67900 38306 1347419726 1 f none /usr/local/lib/postgresql/adminpack.so 0755 root root 16384 11957 1347419725 1 f none /usr/local/lib/postgresql/ascii_and_mic.so 0755 root root 7228 33198 1347419722 1 f none /usr/local/lib/postgresql/auth_delay.so 0755 root root 7652 49165 1347419725 1 f none /usr/local/lib/postgresql/auto_explain.so 0755 root root 13308 2614 1347419725 1 f none /usr/local/lib/postgresql/autoinc.so 0755 root root 10072 1401 1347419728 1 f none /usr/local/lib/postgresql/btree_gin.so 0755 root root 43660 29810 1347419725 1 f none /usr/local/lib/postgresql/btree_gist.so 0755 root root 151180 53955 1347419726 1 f none /usr/local/lib/postgresql/chkpass.so 0755 root root 9468 48554 1347419726 1 f none /usr/local/lib/postgresql/citext.so 0755 root root 11012 27767 1347419726 1 f none /usr/local/lib/postgresql/cube.so 0755 root root 56224 5981 1347419726 1 f none /usr/local/lib/postgresql/cyrillic_and_mic.so 0755 root root 15284 18374 1347419722 1 f none /usr/local/lib/postgresql/dblink.so 0755 root root 49308 58649 1347419726 1 f none /usr/local/lib/postgresql/dict_int.so 0755 root root 8424 44549 1347419726 1 f none /usr/local/lib/postgresql/dict_snowball.so 0755 root root 479852 27376 1347419723 1 f none /usr/local/lib/postgresql/dict_xsyn.so 0755 root root 11472 53746 1347419726 1 f none /usr/local/lib/postgresql/dummy_seclabel.so 0755 root root 7672 7943 1347419726 1 f none /usr/local/lib/postgresql/earthdistance.so 0755 root root 8300 63016 1347419726 1 f none /usr/local/lib/postgresql/euc2004_sjis2004.so 0755 root root 9208 42811 1347419722 1 f none /usr/local/lib/postgresql/euc_cn_and_mic.so 0755 root root 7772 16682 1347419722 1 f none /usr/local/lib/postgresql/euc_jp_and_sjis.so 0755 root root 15408 59117 1347419722 1 f none /usr/local/lib/postgresql/euc_kr_and_mic.so 0755 root root 7892 30052 1347419722 1 f none /usr/local/lib/postgresql/euc_tw_and_big5.so 0755 root root 15588 35501 1347419722 1 f none /usr/local/lib/postgresql/file_fdw.so 0755 root root 19584 18142 1347419726 1 f none /usr/local/lib/postgresql/fuzzystrmatch.so 0755 root root 42632 10841 1347419726 1 f none /usr/local/lib/postgresql/hstore.so 0755 root root 72676 38981 1347419726 1 f none /usr/local/lib/postgresql/insert_username.so 0755 root root 9476 12582 1347419728 1 f none /usr/local/lib/postgresql/isn.so 0755 root root 63568 36404 1347419727 1 f none /usr/local/lib/postgresql/latin2_and_win1250.so 0755 root root 9824 41660 1347419722 1 f none /usr/local/lib/postgresql/latin_and_mic.so 0755 root root 8956 25646 1347419722 1 f none /usr/local/lib/postgresql/libpqwalreceiver.so 0755 root root 14248 57681 1347419724 1 f none /usr/local/lib/postgresql/lo.so 0755 root root 8240 31695 1347419727 1 f none /usr/local/lib/postgresql/ltree.so 0755 root root 96188 23538 1347419727 1 f none /usr/local/lib/postgresql/moddatetime.so 0755 root root 9588 25641 1347419728 1 f none /usr/local/lib/postgresql/pageinspect.so 0755 root root 31604 6369 1347419727 1 f none /usr/local/lib/postgresql/passwordcheck.so 0755 root root 8680 24542 1347419727 1 f none /usr/local/lib/postgresql/pg_buffercache.so 0755 root root 10256 10790 1347419727 1 f none /usr/local/lib/postgresql/pg_freespacemap.so 0755 root root 7784 406 1347419727 1 f none /usr/local/lib/postgresql/pg_stat_statements.so 0755 root root 32844 16326 1347419727 1 f none /usr/local/lib/postgresql/pg_trgm.so 0755 root root 35320 62379 1347419727 1 f none /usr/local/lib/postgresql/pg_upgrade_support.so 0755 root root 11084 32011 1347419727 1 f none /usr/local/lib/postgresql/pgcrypto.so 0755 root root 214288 42872 1347419727 1 f none /usr/local/lib/postgresql/pgrowlocks.so 0755 root root 12148 35835 1347419727 1 f none /usr/local/lib/postgresql/pgstattuple.so 0755 root root 23372 18740 1347419728 1 f none /usr/local/lib/postgresql/pgxml.so 0755 root root 28916 16171 1347419728 1 d none /usr/local/lib/postgresql/pgxs 0755 root root 1 d none /usr/local/lib/postgresql/pgxs/config 0755 root root 1 f none /usr/local/lib/postgresql/pgxs/config/install-sh 0755 root root 13901 20906 1347419725 1 d none /usr/local/lib/postgresql/pgxs/src 0755 root root 1 f none /usr/local/lib/postgresql/pgxs/src/Makefile.global 0644 root root 23116 49190 1347419725 1 f none /usr/local/lib/postgresql/pgxs/src/Makefile.port 0644 root root 484 35873 1347419725 1 f none /usr/local/lib/postgresql/pgxs/src/Makefile.shlib 0644 root root 14858 31014 1347419725 1 d none /usr/local/lib/postgresql/pgxs/src/makefiles 0755 root root 1 f none /usr/local/lib/postgresql/pgxs/src/makefiles/pgxs.mk 0644 root root 7947 39936 1347419725 1 f none /usr/local/lib/postgresql/pgxs/src/nls-global.mk 0644 root root 5971 12498 1347419725 1 d none /usr/local/lib/postgresql/pgxs/src/test 0755 root root 1 d none /usr/local/lib/postgresql/pgxs/src/test/regress 0755 root root 1 f none /usr/local/lib/postgresql/pgxs/src/test/regress/pg_regress 0755 root root 75224 15448 1347419725 1 f none /usr/local/lib/postgresql/plpgsql.so 0755 root root 189220 46169 1347419725 1 f none /usr/local/lib/postgresql/pltcl.so 0755 root root 38992 43713 1347419725 1 f none /usr/local/lib/postgresql/refint.so 0755 root root 18676 26063 1347419728 1 f none /usr/local/lib/postgresql/seg.so 0755 root root 41696 43256 1347419728 1 f none /usr/local/lib/postgresql/sslinfo.so 0755 root root 14488 4003 1347419728 1 f none /usr/local/lib/postgresql/tablefunc.so 0755 root root 27356 12286 1347419728 1 f none /usr/local/lib/postgresql/tcn.so 0755 root root 10288 41059 1347419728 1 f none /usr/local/lib/postgresql/test_parser.so 0755 root root 8172 19020 1347419728 1 f none /usr/local/lib/postgresql/timetravel.so 0755 root root 15972 55256 1347419728 1 f none /usr/local/lib/postgresql/tsearch2.so 0755 root root 26492 41143 1347419728 1 f none /usr/local/lib/postgresql/unaccent.so 0755 root root 13432 21233 1347419728 1 f none /usr/local/lib/postgresql/utf8_and_ascii.so 0755 root root 7236 34300 1347419722 1 f none /usr/local/lib/postgresql/utf8_and_big5.so 0755 root root 226736 25243 1347419722 1 f none /usr/local/lib/postgresql/utf8_and_cyrillic.so 0755 root root 12100 10481 1347419722 1 f none /usr/local/lib/postgresql/utf8_and_euc2004.so 0755 root root 190988 58476 1347419722 1 f none /usr/local/lib/postgresql/utf8_and_euc_cn.so 0755 root root 126452 33270 1347419722 1 f none /usr/local/lib/postgresql/utf8_and_euc_jp.so 0755 root root 218308 12881 1347419722 1 f none /usr/local/lib/postgresql/utf8_and_euc_kr.so 0755 root root 138964 43214 1347419722 1 f none /usr/local/lib/postgresql/utf8_and_euc_tw.so 0755 root root 337620 5637 1347419722 1 f none /usr/local/lib/postgresql/utf8_and_gb18030.so 0755 root root 1021104 12878 1347419722 1 f none /usr/local/lib/postgresql/utf8_and_gbk.so 0755 root root 355964 16694 1347419722 1 f none /usr/local/lib/postgresql/utf8_and_iso8859.so 0755 root root 34580 37918 1347419722 1 f none /usr/local/lib/postgresql/utf8_and_iso8859_1.so 0755 root root 8068 49906 1347419722 1 f none /usr/local/lib/postgresql/utf8_and_johab.so 0755 root root 280104 62558 1347419722 1 f none /usr/local/lib/postgresql/utf8_and_sjis.so 0755 root root 128792 49117 1347419722 1 f none /usr/local/lib/postgresql/utf8_and_sjis2004.so 0755 root root 190492 38382 1347419722 1 f none /usr/local/lib/postgresql/utf8_and_uhc.so 0755 root root 283084 43240 1347419722 1 f none /usr/local/lib/postgresql/utf8_and_win.so 0755 root root 29856 46064 1347419722 1 d none /usr/local/share 0755 root root 1 d none /usr/local/share/doc 0755 root root 1 d none /usr/local/share/doc/postgresql 0755 root root 1 d none /usr/local/share/doc/postgresql/extension 0755 root root 1 f none /usr/local/share/doc/postgresql/extension/autoinc.example 0644 root root 798 56417 1347419728 1 f none /usr/local/share/doc/postgresql/extension/insert_username.example 0644 root root 560 44401 1347419728 1 f none /usr/local/share/doc/postgresql/extension/moddatetime.example 0644 root root 493 34473 1347419728 1 f none /usr/local/share/doc/postgresql/extension/refint.example 0644 root root 2105 24710 1347419728 1 f none /usr/local/share/doc/postgresql/extension/timetravel.example 0644 root root 2372 6310 1347419728 1 d none /usr/local/share/doc/postgresql/html 0755 root root 1 f none /usr/local/share/doc/postgresql/html/LEGALNOTICE.html 0644 root root 2679 62344 1347419719 1 f none /usr/local/share/doc/postgresql/html/acronyms.html 0644 root root 16281 41487 1347419718 1 f none /usr/local/share/doc/postgresql/html/admin.html 0644 root root 12497 39709 1347419718 1 f none /usr/local/share/doc/postgresql/html/adminpack.html 0644 root root 3412 63159 1347419719 1 f none /usr/local/share/doc/postgresql/html/app-clusterdb.html 0644 root root 10600 41712 1347419719 1 f none /usr/local/share/doc/postgresql/html/app-createdb.html 0644 root root 12854 11824 1347419719 1 f none /usr/local/share/doc/postgresql/html/app-createlang.html 0644 root root 9905 55548 1347419719 1 f none /usr/local/share/doc/postgresql/html/app-createuser.html 0644 root root 15638 28555 1347419719 1 f none /usr/local/share/doc/postgresql/html/app-dropdb.html 0644 root root 9640 41596 1347419719 1 f none /usr/local/share/doc/postgresql/html/app-droplang.html 0644 root root 9636 32496 1347419719 1 f none /usr/local/share/doc/postgresql/html/app-dropuser.html 0644 root root 9594 39048 1347419718 1 f none /usr/local/share/doc/postgresql/html/app-ecpg.html 0644 root root 8917 62646 1347419718 1 f none /usr/local/share/doc/postgresql/html/app-initdb.html 0644 root root 15228 19815 1347419719 1 f none /usr/local/share/doc/postgresql/html/app-pg-ctl.html 0644 root root 22127 50394 1347419719 1 f none /usr/local/share/doc/postgresql/html/app-pg-dumpall.html 0644 root root 20079 62364 1347419719 1 f none /usr/local/share/doc/postgresql/html/app-pgbasebackup.html 0644 root root 19816 60387 1347419719 1 f none /usr/local/share/doc/postgresql/html/app-pgconfig.html 0644 root root 11091 34210 1347419719 1 f none /usr/local/share/doc/postgresql/html/app-pgcontroldata.html 0644 root root 3977 29152 1347419719 1 f none /usr/local/share/doc/postgresql/html/app-pgdump.html 0644 root root 42955 48967 1347419719 1 f none /usr/local/share/doc/postgresql/html/app-pgreceivexlog.html 0644 root root 11055 45383 1347419719 1 f none /usr/local/share/doc/postgresql/html/app-pgresetxlog.html 0644 root root 11456 31731 1347419719 1 f none /usr/local/share/doc/postgresql/html/app-pgrestore.html 0644 root root 29944 11035 1347419719 1 f none /usr/local/share/doc/postgresql/html/app-postgres.html 0644 root root 31484 57185 1347419719 1 f none /usr/local/share/doc/postgresql/html/app-postmaster.html 0644 root root 3003 16004 1347419718 1 f none /usr/local/share/doc/postgresql/html/app-psql.html 0644 root root 135001 52252 1347419718 1 f none /usr/local/share/doc/postgresql/html/app-reindexdb.html 0644 root root 11279 16440 1347419719 1 f none /usr/local/share/doc/postgresql/html/app-vacuumdb.html 0644 root root 12614 51902 1347419718 1 f none /usr/local/share/doc/postgresql/html/appendixes.html 0644 root root 21640 36021 1347419719 1 f none /usr/local/share/doc/postgresql/html/applevel-consistency.html 0644 root root 10358 49597 1347419718 1 f none /usr/local/share/doc/postgresql/html/archive-recovery-settings.html 0644 root root 7336 41415 1347419718 1 f none /usr/local/share/doc/postgresql/html/arrays.html 0644 root root 26891 22375 1347419719 1 f none /usr/local/share/doc/postgresql/html/auth-delay.html 0644 root root 3778 18745 1347419718 1 f none /usr/local/share/doc/postgresql/html/auth-methods.html 0644 root root 34495 62877 1347419718 1 f none /usr/local/share/doc/postgresql/html/auth-pg-hba-conf.html 0644 root root 29511 62934 1347419718 1 f none /usr/local/share/doc/postgresql/html/auth-username-maps.html 0644 root root 8595 8467 1347419719 1 f none /usr/local/share/doc/postgresql/html/auto-explain.html 0644 root root 8731 6699 1347419719 1 f none /usr/local/share/doc/postgresql/html/backup-dump.html 0644 root root 15925 53150 1347419719 1 f none /usr/local/share/doc/postgresql/html/backup-file.html 0644 root root 7994 53207 1347419718 1 f none /usr/local/share/doc/postgresql/html/backup.html 0644 root root 4483 3753 1347419719 1 f none /usr/local/share/doc/postgresql/html/biblio.html 0644 root root 11547 37197 1347419718 1 f none /usr/local/share/doc/postgresql/html/bki-commands.html 0644 root root 9644 27707 1347419719 1 f none /usr/local/share/doc/postgresql/html/bki-example.html 0644 root root 3047 25416 1347419719 1 f none /usr/local/share/doc/postgresql/html/bki-format.html 0644 root root 3461 59037 1347419718 1 f none /usr/local/share/doc/postgresql/html/bki-structure.html 0644 root root 4318 46948 1347419719 1 f none /usr/local/share/doc/postgresql/html/bki.html 0644 root root 4328 59268 1347419718 1 f none /usr/local/share/doc/postgresql/html/bookindex.html 0644 root root 241543 4032 1347419719 1 f none /usr/local/share/doc/postgresql/html/btree-gin.html 0644 root root 4598 12803 1347419719 1 f none /usr/local/share/doc/postgresql/html/btree-gist.html 0644 root root 6883 56616 1347419719 1 f none /usr/local/share/doc/postgresql/html/bug-reporting.html 0644 root root 18642 2304 1347419718 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-aggregate.html 0644 root root 5500 12266 1347419718 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-am.html 0644 root root 10545 43757 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-amop.html 0644 root root 7591 42402 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-amproc.html 0644 root root 4883 31933 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-attrdef.html 0644 root root 4362 57213 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-attribute.html 0644 root root 10285 40900 1347419718 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-auth-members.html 0644 root root 4253 43905 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-authid.html 0644 root root 6813 47946 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-cast.html 0644 root root 6953 2178 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-class.html 0644 root root 12659 61309 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-collation.html 0644 root root 5895 46581 1347419718 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-constraint.html 0644 root root 11574 61380 1347419718 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-conversion.html 0644 root root 4428 55363 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-database.html 0644 root root 7025 53443 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-db-role-setting.html 0644 root root 4066 35795 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-default-acl.html 0644 root root 5221 57099 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-depend.html 0644 root root 8633 53056 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-description.html 0644 root root 4476 65077 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-enum.html 0644 root root 4714 26295 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-extension.html 0644 root root 5280 60841 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-foreign-data-wrapper.html 0644 root root 4943 34151 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-foreign-server.html 0644 root root 4686 12983 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-foreign-table.html 0644 root root 4034 31619 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-index.html 0644 root root 8783 56030 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-inherits.html 0644 root root 3886 17136 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-language.html 0644 root root 5950 42266 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-largeobject-metadata.html 0644 root root 3628 64076 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-largeobject.html 0644 root root 5152 56700 1347419718 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-namespace.html 0644 root root 3749 7979 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-opclass.html 0644 root root 5861 39228 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-operator.html 0644 root root 6643 16823 1347419718 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-opfamily.html 0644 root root 4809 27571 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-pltemplate.html 0644 root root 5362 4885 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-proc.html 0644 root root 13401 7268 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-range.html 0644 root root 5180 49192 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-rewrite.html 0644 root root 5391 52125 1347419718 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-seclabel.html 0644 root root 4513 873 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-shdepend.html 0644 root root 7041 63424 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-shdescription.html 0644 root root 4245 50284 1347419718 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-shseclabel.html 0644 root root 4402 61922 1347419718 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-statistic.html 0644 root root 9487 61999 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-tablespace.html 0644 root root 4156 37978 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-trigger.html 0644 root root 8285 19924 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-ts-config-map.html 0644 root root 4191 42147 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-ts-config.html 0644 root root 4479 490 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-ts-dict.html 0644 root root 4714 20646 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-ts-parser.html 0644 root root 5080 41813 1347419718 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-ts-template.html 0644 root root 4256 47689 1347419719 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-type.html 0644 root root 19903 10119 1347419718 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-user-mapping.html 0644 root root 3845 14862 1347419718 1 f none /usr/local/share/doc/postgresql/html/catalogs-overview.html 0644 root root 10429 7457 1347419718 1 f none /usr/local/share/doc/postgresql/html/catalogs.html 0644 root root 10385 47073 1347419719 1 f none /usr/local/share/doc/postgresql/html/charset.html 0644 root root 4160 42323 1347419719 1 f none /usr/local/share/doc/postgresql/html/chkpass.html 0644 root root 4389 6520 1347419719 1 f none /usr/local/share/doc/postgresql/html/citext.html 0644 root root 11067 51544 1347419719 1 f none /usr/local/share/doc/postgresql/html/client-authentication-problems.html 0644 root root 4222 61941 1347419718 1 f none /usr/local/share/doc/postgresql/html/client-authentication.html 0644 root root 5912 62842 1347419718 1 f none /usr/local/share/doc/postgresql/html/client-interfaces.html 0644 root root 13715 56270 1347419718 1 f none /usr/local/share/doc/postgresql/html/collation.html 0644 root root 14220 13137 1347419719 1 f none /usr/local/share/doc/postgresql/html/config-setting.html 0644 root root 11144 21158 1347419719 1 f none /usr/local/share/doc/postgresql/html/connect-estab.html 0644 root root 4313 780 1347419719 1 f none /usr/local/share/doc/postgresql/html/continuous-archiving.html 0644 root root 49828 27905 1347419719 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-build-sql-delete.html 0644 root root 5449 9666 1347419719 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-build-sql-insert.html 0644 root root 6050 57453 1347419719 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-build-sql-update.html 0644 root root 6279 8843 1347419719 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-cancel-query.html 0644 root root 3817 18926 1347419719 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-close.html 0644 root root 4647 12124 1347419719 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-connect-u.html 0644 root root 4480 17507 1347419719 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-connect.html 0644 root root 7322 30195 1347419719 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-disconnect.html 0644 root root 3715 7521 1347419718 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-error-message.html 0644 root root 3505 59507 1347419719 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-exec.html 0644 root root 5463 11085 1347419719 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-fetch.html 0644 root root 5976 56717 1347419718 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-function.html 0644 root root 8627 10270 1347419719 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-get-connections.html 0644 root root 3204 37625 1347419719 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-get-notify.html 0644 root root 4165 43401 1347419718 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-get-pkey.html 0644 root root 4496 3375 1347419719 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-get-result.html 0644 root root 6956 614 1347419719 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-is-busy.html 0644 root root 3487 55869 1347419719 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-open.html 0644 root root 5461 7861 1347419719 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-send-query.html 0644 root root 4167 45398 1347419719 1 f none /usr/local/share/doc/postgresql/html/contrib-prog-client.html 0644 root root 3432 57231 1347419719 1 f none /usr/local/share/doc/postgresql/html/contrib-prog-server.html 0644 root root 3835 24165 1347419718 1 f none /usr/local/share/doc/postgresql/html/contrib-prog.html 0644 root root 3318 49965 1347419718 1 f none /usr/local/share/doc/postgresql/html/contrib-spi.html 0644 root root 11234 40034 1347419719 1 f none /usr/local/share/doc/postgresql/html/contrib.html 0644 root root 8902 27116 1347419718 1 f none /usr/local/share/doc/postgresql/html/creating-cluster.html 0644 root root 10596 51326 1347419719 1 f none /usr/local/share/doc/postgresql/html/cube.html 0644 root root 15939 63423 1347419719 1 f none /usr/local/share/doc/postgresql/html/database-roles.html 0644 root root 6090 18532 1347419719 1 f none /usr/local/share/doc/postgresql/html/datatype-binary.html 0644 root root 12891 8592 1347419719 1 f none /usr/local/share/doc/postgresql/html/datatype-bit.html 0644 root root 5094 46557 1347419719 1 f none /usr/local/share/doc/postgresql/html/datatype-boolean.html 0644 root root 5265 37817 1347419719 1 f none /usr/local/share/doc/postgresql/html/datatype-character.html 0644 root root 11891 47501 1347419719 1 f none /usr/local/share/doc/postgresql/html/datatype-datetime.html 0644 root root 49768 36313 1347419718 1 f none /usr/local/share/doc/postgresql/html/datatype-enum.html 0644 root root 6431 26182 1347419718 1 f none /usr/local/share/doc/postgresql/html/datatype-geometric.html 0644 root root 12501 8577 1347419718 1 f none /usr/local/share/doc/postgresql/html/datatype-json.html 0644 root root 3437 58197 1347419719 1 f none /usr/local/share/doc/postgresql/html/datatype-money.html 0644 root root 5050 51908 1347419718 1 f none /usr/local/share/doc/postgresql/html/datatype-net-types.html 0644 root root 10421 18397 1347419719 1 f none /usr/local/share/doc/postgresql/html/datatype-numeric.html 0644 root root 21774 26175 1347419719 1 f none /usr/local/share/doc/postgresql/html/datatype-oid.html 0644 root root 9684 21941 1347419719 1 f none /usr/local/share/doc/postgresql/html/datatype-pseudo.html 0644 root root 7283 32210 1347419719 1 f none /usr/local/share/doc/postgresql/html/datatype-textsearch.html 0644 root root 10031 20419 1347419719 1 f none /usr/local/share/doc/postgresql/html/datatype-uuid.html 0644 root root 4558 22456 1347419718 1 f none /usr/local/share/doc/postgresql/html/datatype-xml.html 0644 root root 11332 31454 1347419719 1 f none /usr/local/share/doc/postgresql/html/datatype.html 0644 root root 16481 14858 1347419719 1 f none /usr/local/share/doc/postgresql/html/datetime-appendix.html 0644 root root 3523 5135 1347419719 1 f none /usr/local/share/doc/postgresql/html/datetime-config-files.html 0644 root root 7705 8230 1347419719 1 f none /usr/local/share/doc/postgresql/html/datetime-input-rules.html 0644 root root 6761 27690 1347419719 1 f none /usr/local/share/doc/postgresql/html/datetime-keywords.html 0644 root root 5094 32747 1347419718 1 f none /usr/local/share/doc/postgresql/html/datetime-units-history.html 0644 root root 7632 10430 1347419719 1 f none /usr/local/share/doc/postgresql/html/dblink.html 0644 root root 5320 31223 1347419718 1 f none /usr/local/share/doc/postgresql/html/ddl-alter.html 0644 root root 10412 18193 1347419718 1 f none /usr/local/share/doc/postgresql/html/ddl-basics.html 0644 root root 7814 36594 1347419719 1 f none /usr/local/share/doc/postgresql/html/ddl-constraints.html 0644 root root 22383 25109 1347419719 1 f none /usr/local/share/doc/postgresql/html/ddl-default.html 0644 root root 4538 15232 1347419719 1 f none /usr/local/share/doc/postgresql/html/ddl-depend.html 0644 root root 5247 8571 1347419719 1 f none /usr/local/share/doc/postgresql/html/ddl-foreign-data.html 0644 root root 4483 18410 1347419719 1 f none /usr/local/share/doc/postgresql/html/ddl-inherit.html 0644 root root 15171 12329 1347419718 1 f none /usr/local/share/doc/postgresql/html/ddl-others.html 0644 root root 3078 29115 1347419719 1 f none /usr/local/share/doc/postgresql/html/ddl-partitioning.html 0644 root root 27761 62472 1347419718 1 f none /usr/local/share/doc/postgresql/html/ddl-priv.html 0644 root root 6064 3345 1347419718 1 f none /usr/local/share/doc/postgresql/html/ddl-schemas.html 0644 root root 18044 50485 1347419719 1 f none /usr/local/share/doc/postgresql/html/ddl-system-columns.html 0644 root root 8047 31236 1347419719 1 f none /usr/local/share/doc/postgresql/html/ddl.html 0644 root root 6222 3598 1347419719 1 f none /usr/local/share/doc/postgresql/html/dict-int.html 0644 root root 4791 33919 1347419719 1 f none /usr/local/share/doc/postgresql/html/dict-xsyn.html 0644 root root 6479 24063 1347419719 1 f none /usr/local/share/doc/postgresql/html/different-replication-solutions.html 0644 root root 14790 58665 1347419718 1 f none /usr/local/share/doc/postgresql/html/disk-full.html 0644 root root 3515 5910 1347419719 1 f none /usr/local/share/doc/postgresql/html/disk-usage.html 0644 root root 5659 30483 1347419719 1 f none /usr/local/share/doc/postgresql/html/diskusage.html 0644 root root 2666 60845 1347419718 1 f none /usr/local/share/doc/postgresql/html/dml-delete.html 0644 root root 3467 63548 1347419719 1 f none /usr/local/share/doc/postgresql/html/dml-insert.html 0644 root root 5367 15740 1347419718 1 f none /usr/local/share/doc/postgresql/html/dml-update.html 0644 root root 5554 34625 1347419719 1 f none /usr/local/share/doc/postgresql/html/dml.html 0644 root root 2858 12169 1347419719 1 f none /usr/local/share/doc/postgresql/html/docguide-authoring.html 0644 root root 6755 53625 1347419719 1 f none /usr/local/share/doc/postgresql/html/docguide-build.html 0644 root root 15797 50481 1347419719 1 f none /usr/local/share/doc/postgresql/html/docguide-docbook.html 0644 root root 3851 31764 1347419719 1 f none /usr/local/share/doc/postgresql/html/docguide-style.html 0644 root root 7427 54569 1347419718 1 f none /usr/local/share/doc/postgresql/html/docguide-toolsets.html 0644 root root 20670 50370 1347419719 1 f none /usr/local/share/doc/postgresql/html/docguide.html 0644 root root 3622 3070 1347419718 1 f none /usr/local/share/doc/postgresql/html/dummy-seclabel.html 0644 root root 4356 62424 1347419719 1 f none /usr/local/share/doc/postgresql/html/dynamic-trace.html 0644 root root 27232 22052 1347419719 1 f none /usr/local/share/doc/postgresql/html/earthdistance.html 0644 root root 8808 20292 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-commands.html 0644 root root 9525 46434 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-concept.html 0644 root root 4977 51238 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-connect.html 0644 root root 10874 26161 1347419718 1 f none /usr/local/share/doc/postgresql/html/ecpg-cpp.html 0644 root root 9623 4026 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-descriptors.html 0644 root root 34904 61899 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-develop.html 0644 root root 7962 2461 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-dynamic.html 0644 root root 6513 22690 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-errors.html 0644 root root 25735 3805 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-informix-compat.html 0644 root root 52757 50983 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-library.html 0644 root root 5796 37521 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-lo.html 0644 root root 5525 6736 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-pgtypes.html 0644 root root 54455 61511 1347419718 1 f none /usr/local/share/doc/postgresql/html/ecpg-preproc.html 0644 root root 8983 59454 1347419718 1 f none /usr/local/share/doc/postgresql/html/ecpg-process.html 0644 root root 5384 15551 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-allocate-descriptor.html 0644 root root 3981 19073 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-commands.html 0644 root root 4696 28092 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-connect.html 0644 root root 9383 22336 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-deallocate-descriptor.html 0644 root root 3771 1260 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-declare.html 0644 root root 5395 56651 1347419718 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-describe.html 0644 root root 4593 62165 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-disconnect.html 0644 root root 4731 2607 1347419718 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-execute-immediate.html 0644 root root 3875 11383 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-get-descriptor.html 0644 root root 7707 36308 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-open.html 0644 root root 4640 506 1347419718 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-prepare.html 0644 root root 4175 32331 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-set-autocommit.html 0644 root root 3331 42661 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-set-connection.html 0644 root root 3927 13044 1347419718 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-set-descriptor.html 0644 root root 5503 64400 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-type.html 0644 root root 5024 23620 1347419718 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-var.html 0644 root root 3496 45517 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-whenever.html 0644 root root 4684 6135 1347419718 1 f none /usr/local/share/doc/postgresql/html/ecpg-variables.html 0644 root root 40692 13486 1347419719 1 f none /usr/local/share/doc/postgresql/html/ecpg.html 0644 root root 10342 56555 1347419719 1 f none /usr/local/share/doc/postgresql/html/encryption-options.html 0644 root root 7493 14418 1347419718 1 f none /usr/local/share/doc/postgresql/html/errcodes-appendix.html 0644 root root 36962 54129 1347419718 1 f none /usr/local/share/doc/postgresql/html/error-message-reporting.html 0644 root root 14122 51893 1347419718 1 f none /usr/local/share/doc/postgresql/html/error-style-guide.html 0644 root root 16767 16343 1347419718 1 f none /usr/local/share/doc/postgresql/html/event-log-registration.html 0644 root root 4186 46312 1347419719 1 f none /usr/local/share/doc/postgresql/html/executor.html 0644 root root 6610 59293 1347419718 1 f none /usr/local/share/doc/postgresql/html/explicit-joins.html 0644 root root 11017 34463 1347419719 1 f none /usr/local/share/doc/postgresql/html/explicit-locking.html 0644 root root 25071 7541 1347419718 1 f none /usr/local/share/doc/postgresql/html/extend-extensions.html 0644 root root 30976 29531 1347419719 1 f none /usr/local/share/doc/postgresql/html/extend-how.html 0644 root root 4550 19370 1347419719 1 f none /usr/local/share/doc/postgresql/html/extend-pgxs.html 0644 root root 11759 16607 1347419719 1 f none /usr/local/share/doc/postgresql/html/extend-type-system.html 0644 root root 10091 8272 1347419719 1 f none /usr/local/share/doc/postgresql/html/extend.html 0644 root root 9962 9826 1347419719 1 f none /usr/local/share/doc/postgresql/html/external-admin-tools.html 0644 root root 2720 3004 1347419718 1 f none /usr/local/share/doc/postgresql/html/external-extensions.html 0644 root root 3265 48261 1347419718 1 f none /usr/local/share/doc/postgresql/html/external-interfaces.html 0644 root root 5034 49972 1347419718 1 f none /usr/local/share/doc/postgresql/html/external-pl.html 0644 root root 4684 27128 1347419719 1 f none /usr/local/share/doc/postgresql/html/external-projects.html 0644 root root 3002 23635 1347419719 1 f none /usr/local/share/doc/postgresql/html/fdw-callbacks.html 0644 root root 12903 27799 1347419718 1 f none /usr/local/share/doc/postgresql/html/fdw-functions.html 0644 root root 4494 19533 1347419719 1 f none /usr/local/share/doc/postgresql/html/fdw-helpers.html 0644 root root 5991 4452 1347419719 1 f none /usr/local/share/doc/postgresql/html/fdw-planning.html 0644 root root 9778 47332 1347419719 1 f none /usr/local/share/doc/postgresql/html/fdwhandler.html 0644 root root 3988 41385 1347419718 1 f none /usr/local/share/doc/postgresql/html/features-sql-standard.html 0644 root root 39103 14481 1347419719 1 f none /usr/local/share/doc/postgresql/html/features.html 0644 root root 7564 9625 1347419718 1 f none /usr/local/share/doc/postgresql/html/file-fdw.html 0644 root root 7712 58087 1347419719 1 f none /usr/local/share/doc/postgresql/html/functions-admin.html 0644 root root 49493 36162 1347419718 1 f none /usr/local/share/doc/postgresql/html/functions-aggregate.html 0644 root root 21859 13759 1347419719 1 f none /usr/local/share/doc/postgresql/html/functions-array.html 0644 root root 13519 45754 1347419718 1 f none /usr/local/share/doc/postgresql/html/functions-binarystring.html 0644 root root 12398 12560 1347419719 1 f none /usr/local/share/doc/postgresql/html/functions-bitstring.html 0644 root root 6784 22860 1347419718 1 f none /usr/local/share/doc/postgresql/html/functions-comparison.html 0644 root root 10613 57307 1347419719 1 f none /usr/local/share/doc/postgresql/html/functions-comparisons.html 0644 root root 13529 58586 1347419718 1 f none /usr/local/share/doc/postgresql/html/functions-conditional.html 0644 root root 10304 32310 1347419719 1 f none /usr/local/share/doc/postgresql/html/functions-datetime.html 0644 root root 47937 53236 1347419719 1 f none /usr/local/share/doc/postgresql/html/functions-enum.html 0644 root root 5489 20297 1347419719 1 f none /usr/local/share/doc/postgresql/html/functions-formatting.html 0644 root root 32857 32734 1347419719 1 f none /usr/local/share/doc/postgresql/html/functions-geometry.html 0644 root root 20333 63933 1347419718 1 f none /usr/local/share/doc/postgresql/html/functions-info.html 0644 root root 56697 53931 1347419718 1 f none /usr/local/share/doc/postgresql/html/functions-json.html 0644 root root 3812 13080 1347419719 1 f none /usr/local/share/doc/postgresql/html/functions-logical.html 0644 root root 4663 60054 1347419718 1 f none /usr/local/share/doc/postgresql/html/functions-matching.html 0644 root root 72431 51062 1347419719 1 f none /usr/local/share/doc/postgresql/html/functions-math.html 0644 root root 19762 13875 1347419718 1 f none /usr/local/share/doc/postgresql/html/functions-net.html 0644 root root 13500 9178 1347419719 1 f none /usr/local/share/doc/postgresql/html/functions-range.html 0644 root root 10855 35465 1347419719 1 f none /usr/local/share/doc/postgresql/html/functions-sequence.html 0644 root root 12974 6610 1347419719 1 f none /usr/local/share/doc/postgresql/html/functions-srf.html 0644 root root 8838 42184 1347419719 1 f none /usr/local/share/doc/postgresql/html/functions-string.html 0644 root root 58886 5516 1347419719 1 f none /usr/local/share/doc/postgresql/html/functions-subquery.html 0644 root root 16379 38152 1347419719 1 f none /usr/local/share/doc/postgresql/html/functions-textsearch.html 0644 root root 20486 54268 1347419719 1 f none /usr/local/share/doc/postgresql/html/functions-trigger.html 0644 root root 4546 26651 1347419718 1 f none /usr/local/share/doc/postgresql/html/functions-window.html 0644 root root 11863 2448 1347419719 1 f none /usr/local/share/doc/postgresql/html/functions-xml.html 0644 root root 32167 12340 1347419719 1 f none /usr/local/share/doc/postgresql/html/functions.html 0644 root root 9937 28693 1347419718 1 f none /usr/local/share/doc/postgresql/html/fuzzystrmatch.html 0644 root root 8059 30085 1347419719 1 f none /usr/local/share/doc/postgresql/html/geqo-biblio.html 0644 root root 3457 56106 1347419719 1 f none /usr/local/share/doc/postgresql/html/geqo-intro.html 0644 root root 4413 13599 1347419719 1 f none /usr/local/share/doc/postgresql/html/geqo-intro2.html 0644 root root 5625 11761 1347419718 1 f none /usr/local/share/doc/postgresql/html/geqo-pg-intro.html 0644 root root 8783 33494 1347419718 1 f none /usr/local/share/doc/postgresql/html/geqo.html 0644 root root 3614 2769 1347419719 1 f none /usr/local/share/doc/postgresql/html/gin-examples.html 0644 root root 3320 44018 1347419719 1 f none /usr/local/share/doc/postgresql/html/gin-extensibility.html 0644 root root 14400 5995 1347419718 1 f none /usr/local/share/doc/postgresql/html/gin-implementation.html 0644 root root 6562 57976 1347419719 1 f none /usr/local/share/doc/postgresql/html/gin-intro.html 0644 root root 4660 30600 1347419719 1 f none /usr/local/share/doc/postgresql/html/gin-limit.html 0644 root root 2815 9420 1347419719 1 f none /usr/local/share/doc/postgresql/html/gin-tips.html 0644 root root 5711 46617 1347419719 1 f none /usr/local/share/doc/postgresql/html/gin.html 0644 root root 2927 13426 1347419718 1 f none /usr/local/share/doc/postgresql/html/gist-examples.html 0644 root root 3750 13009 1347419719 1 f none /usr/local/share/doc/postgresql/html/gist-extensibility.html 0644 root root 24352 48602 1347419719 1 f none /usr/local/share/doc/postgresql/html/gist-implementation.html 0644 root root 4099 56141 1347419719 1 f none /usr/local/share/doc/postgresql/html/gist-intro.html 0644 root root 3614 10519 1347419718 1 f none /usr/local/share/doc/postgresql/html/gist.html 0644 root root 2677 62929 1347419719 1 f none /usr/local/share/doc/postgresql/html/git.html 0644 root root 4560 16401 1347419719 1 f none /usr/local/share/doc/postgresql/html/high-availability.html 0644 root root 7805 41316 1347419718 1 f none /usr/local/share/doc/postgresql/html/history.html 0644 root root 11916 57230 1347419719 1 f none /usr/local/share/doc/postgresql/html/hot-standby.html 0644 root root 36067 40101 1347419718 1 f none /usr/local/share/doc/postgresql/html/hstore.html 0644 root root 22627 59773 1347419718 1 f none /usr/local/share/doc/postgresql/html/index-catalog.html 0644 root root 7994 50917 1347419719 1 f none /usr/local/share/doc/postgresql/html/index-cost-estimation.html 0644 root root 9989 3066 1347419718 1 f none /usr/local/share/doc/postgresql/html/index-functions.html 0644 root root 19112 24480 1347419718 1 f none /usr/local/share/doc/postgresql/html/index-locking.html 0644 root root 8047 59264 1347419718 1 f none /usr/local/share/doc/postgresql/html/index-scanning.html 0644 root root 10705 13228 1347419719 1 f none /usr/local/share/doc/postgresql/html/index-unique-checks.html 0644 root root 9190 19093 1347419719 1 f none /usr/local/share/doc/postgresql/html/index.html 0644 root root 8069 9966 1347419718 1 f none /usr/local/share/doc/postgresql/html/indexam.html 0644 root root 5245 18834 1347419719 1 f none /usr/local/share/doc/postgresql/html/indexes-bitmap-scans.html 0644 root root 6578 63228 1347419719 1 f none /usr/local/share/doc/postgresql/html/indexes-collations.html 0644 root root 3638 10565 1347419719 1 f none /usr/local/share/doc/postgresql/html/indexes-examine.html 0644 root root 7159 45831 1347419718 1 f none /usr/local/share/doc/postgresql/html/indexes-expressional.html 0644 root root 4811 45369 1347419718 1 f none /usr/local/share/doc/postgresql/html/indexes-intro.html 0644 root root 6311 36733 1347419719 1 f none /usr/local/share/doc/postgresql/html/indexes-multicolumn.html 0644 root root 6296 36601 1347419719 1 f none /usr/local/share/doc/postgresql/html/indexes-opclass.html 0644 root root 7334 45520 1347419719 1 f none /usr/local/share/doc/postgresql/html/indexes-ordering.html 0644 root root 6478 42167 1347419719 1 f none /usr/local/share/doc/postgresql/html/indexes-partial.html 0644 root root 11810 33444 1347419719 1 f none /usr/local/share/doc/postgresql/html/indexes-types.html 0644 root root 10075 41424 1347419719 1 f none /usr/local/share/doc/postgresql/html/indexes-unique.html 0644 root root 4000 42738 1347419719 1 f none /usr/local/share/doc/postgresql/html/indexes.html 0644 root root 3617 5642 1347419719 1 f none /usr/local/share/doc/postgresql/html/information-schema.html 0644 root root 11175 8620 1347419718 1 f none /usr/local/share/doc/postgresql/html/infoschema-administrable-role-authorizations.html 0644 root root 3749 15714 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-applicable-roles.html 0644 root root 3968 32621 1347419718 1 f none /usr/local/share/doc/postgresql/html/infoschema-attributes.html 0644 root root 12805 57623 1347419718 1 f none /usr/local/share/doc/postgresql/html/infoschema-character-sets.html 0644 root root 7048 12874 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-check-constraint-routine-usage.html 0644 root root 4347 62462 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-check-constraints.html 0644 root root 3874 26607 1347419718 1 f none /usr/local/share/doc/postgresql/html/infoschema-collation-character-set-applicab.html 0644 root root 4423 5684 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-collations.html 0644 root root 3883 24865 1347419718 1 f none /usr/local/share/doc/postgresql/html/infoschema-column-domain-usage.html 0644 root root 4320 59814 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-column-options.html 0644 root root 4107 42303 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-column-privileges.html 0644 root root 5027 42711 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-column-udt-usage.html 0644 root root 4581 10125 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-columns.html 0644 root root 17623 36921 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-constraint-column-usage.html 0644 root root 4871 39769 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-constraint-table-usage.html 0644 root root 4772 35319 1347419718 1 f none /usr/local/share/doc/postgresql/html/infoschema-data-type-privileges.html 0644 root root 5087 61687 1347419718 1 f none /usr/local/share/doc/postgresql/html/infoschema-datatypes.html 0644 root root 4227 55379 1347419718 1 f none /usr/local/share/doc/postgresql/html/infoschema-domain-constraints.html 0644 root root 4662 19431 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-domain-udt-usage.html 0644 root root 4169 45635 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-domains.html 0644 root root 11365 11653 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-element-types.html 0644 root root 11372 12813 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-enabled-roles.html 0644 root root 3778 20722 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-foreign-data-wrapper-options.html 0644 root root 3908 29633 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-foreign-data-wrappers.html 0644 root root 4225 58014 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-foreign-server-options.html 0644 root root 3851 24815 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-foreign-servers.html 0644 root root 4569 18820 1347419718 1 f none /usr/local/share/doc/postgresql/html/infoschema-foreign-table-options.html 0644 root root 4345 61703 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-foreign-tables.html 0644 root root 4070 41660 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-information-schema-catalog-name.html 0644 root root 3355 53876 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-key-column-usage.html 0644 root root 5183 60818 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-parameters.html 0644 root root 10797 30414 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-referential-constraints.html 0644 root root 5662 22898 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-role-column-grants.html 0644 root root 5015 45521 1347419718 1 f none /usr/local/share/doc/postgresql/html/infoschema-role-routine-grants.html 0644 root root 5358 8199 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-role-table-grants.html 0644 root root 5425 4616 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-role-udt-grants.html 0644 root root 4779 27252 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-role-usage-grants.html 0644 root root 5008 41909 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-routine-privileges.html 0644 root root 5030 45839 1347419718 1 f none /usr/local/share/doc/postgresql/html/infoschema-routines.html 0644 root root 23050 34943 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-schema.html 0644 root root 3178 44529 1347419718 1 f none /usr/local/share/doc/postgresql/html/infoschema-schemata.html 0644 root root 4246 47900 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-sequences.html 0644 root root 6109 60560 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-sql-features.html 0644 root root 4706 22139 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-sql-implementation-info.html 0644 root root 4501 11723 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-sql-languages.html 0644 root root 5092 47020 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-sql-packages.html 0644 root root 4176 43129 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-sql-parts.html 0644 root root 4078 34192 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-sql-sizing-profiles.html 0644 root root 4175 47302 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-sql-sizing.html 0644 root root 4099 43401 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-table-constraints.html 0644 root root 4912 33315 1347419718 1 f none /usr/local/share/doc/postgresql/html/infoschema-table-privileges.html 0644 root root 5095 41865 1347419718 1 f none /usr/local/share/doc/postgresql/html/infoschema-tables.html 0644 root root 5955 46037 1347419718 1 f none /usr/local/share/doc/postgresql/html/infoschema-triggered-update-columns.html 0644 root root 4552 10443 1347419718 1 f none /usr/local/share/doc/postgresql/html/infoschema-triggers.html 0644 root root 9445 58764 1347419718 1 f none /usr/local/share/doc/postgresql/html/infoschema-udt-privileges.html 0644 root root 4509 4659 1347419718 1 f none /usr/local/share/doc/postgresql/html/infoschema-usage-privileges.html 0644 root root 5510 16156 1347419718 1 f none /usr/local/share/doc/postgresql/html/infoschema-user-defined-types.html 0644 root root 9751 12358 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-user-mapping-options.html 0644 root root 4447 6842 1347419718 1 f none /usr/local/share/doc/postgresql/html/infoschema-user-mappings.html 0644 root root 3831 23756 1347419718 1 f none /usr/local/share/doc/postgresql/html/infoschema-view-column-usage.html 0644 root root 4726 22243 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-view-routine-usage.html 0644 root root 4366 61771 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-view-table-usage.html 0644 root root 4387 58862 1347419719 1 f none /usr/local/share/doc/postgresql/html/infoschema-views.html 0644 root root 5527 3259 1347419719 1 f none /usr/local/share/doc/postgresql/html/install-getsource.html 0644 root root 3473 64928 1347419719 1 f none /usr/local/share/doc/postgresql/html/install-post.html 0644 root root 8068 20979 1347419719 1 f none /usr/local/share/doc/postgresql/html/install-procedure.html 0644 root root 45024 63785 1347419719 1 f none /usr/local/share/doc/postgresql/html/install-requirements.html 0644 root root 14392 39522 1347419718 1 f none /usr/local/share/doc/postgresql/html/install-short.html 0644 root root 2868 18122 1347419719 1 f none /usr/local/share/doc/postgresql/html/install-windows-full.html 0644 root root 18981 34755 1347419719 1 f none /usr/local/share/doc/postgresql/html/install-windows-libpq.html 0644 root root 6281 13266 1347419719 1 f none /usr/local/share/doc/postgresql/html/install-windows.html 0644 root root 6620 46278 1347419719 1 f none /usr/local/share/doc/postgresql/html/installation-platform-notes.html 0644 root root 39366 53400 1347419718 1 f none /usr/local/share/doc/postgresql/html/installation.html 0644 root root 4158 46609 1347419718 1 f none /usr/local/share/doc/postgresql/html/intagg.html 0644 root root 6252 22527 1347419719 1 f none /usr/local/share/doc/postgresql/html/intarray.html 0644 root root 13751 34439 1347419719 1 f none /usr/local/share/doc/postgresql/html/internals.html 0644 root root 15544 34175 1347419719 1 f none /usr/local/share/doc/postgresql/html/intro-whatis.html 0644 root root 4009 32997 1347419719 1 f none /usr/local/share/doc/postgresql/html/isn.html 0644 root root 13354 22377 1347419719 1 f none /usr/local/share/doc/postgresql/html/kernel-resources.html 0644 root root 37936 61251 1347419718 1 f none /usr/local/share/doc/postgresql/html/largeobjects.html 0644 root root 4673 22851 1347419719 1 f none /usr/local/share/doc/postgresql/html/libpq-async.html 0644 root root 20513 50045 1347419719 1 f none /usr/local/share/doc/postgresql/html/libpq-build.html 0644 root root 6367 22860 1347419718 1 f none /usr/local/share/doc/postgresql/html/libpq-cancel.html 0644 root root 6775 44727 1347419719 1 f none /usr/local/share/doc/postgresql/html/libpq-connect.html 0644 root root 51022 1143 1347419719 1 f none /usr/local/share/doc/postgresql/html/libpq-control.html 0644 root root 6278 8328 1347419719 1 f none /usr/local/share/doc/postgresql/html/libpq-copy.html 0644 root root 22440 60308 1347419718 1 f none /usr/local/share/doc/postgresql/html/libpq-envars.html 0644 root root 10176 25815 1347419719 1 f none /usr/local/share/doc/postgresql/html/libpq-events.html 0644 root root 23091 39346 1347419719 1 f none /usr/local/share/doc/postgresql/html/libpq-example.html 0644 root root 16022 59905 1347419719 1 f none /usr/local/share/doc/postgresql/html/libpq-exec.html 0644 root root 64802 23972 1347419719 1 f none /usr/local/share/doc/postgresql/html/libpq-fastpath.html 0644 root root 5654 39060 1347419719 1 f none /usr/local/share/doc/postgresql/html/libpq-ldap.html 0644 root root 5504 28999 1347419718 1 f none /usr/local/share/doc/postgresql/html/libpq-misc.html 0644 root root 13813 3094 1347419718 1 f none /usr/local/share/doc/postgresql/html/libpq-notice-processing.html 0644 root root 6282 36285 1347419718 1 f none /usr/local/share/doc/postgresql/html/libpq-notify.html 0644 root root 6713 54290 1347419719 1 f none /usr/local/share/doc/postgresql/html/libpq-pgpass.html 0644 root root 4859 42499 1347419719 1 f none /usr/local/share/doc/postgresql/html/libpq-pgservice.html 0644 root root 3882 31953 1347419719 1 f none /usr/local/share/doc/postgresql/html/libpq-single-row-mode.html 0644 root root 6351 28724 1347419718 1 f none /usr/local/share/doc/postgresql/html/libpq-ssl.html 0644 root root 19969 48565 1347419719 1 f none /usr/local/share/doc/postgresql/html/libpq-status.html 0644 root root 17693 21816 1347419719 1 f none /usr/local/share/doc/postgresql/html/libpq-threading.html 0644 root root 5542 27026 1347419719 1 f none /usr/local/share/doc/postgresql/html/libpq.html 0644 root root 7916 4769 1347419718 1 f none /usr/local/share/doc/postgresql/html/lo-examplesect.html 0644 root root 8694 29565 1347419718 1 f none /usr/local/share/doc/postgresql/html/lo-funcs.html 0644 root root 4219 57571 1347419719 1 f none /usr/local/share/doc/postgresql/html/lo-implementation.html 0644 root root 3351 52804 1347419718 1 f none /usr/local/share/doc/postgresql/html/lo-interfaces.html 0644 root root 15153 27811 1347419719 1 f none /usr/local/share/doc/postgresql/html/lo-intro.html 0644 root root 3204 41975 1347419719 1 f none /usr/local/share/doc/postgresql/html/lo.html 0644 root root 6625 45931 1347419718 1 f none /usr/local/share/doc/postgresql/html/locale.html 0644 root root 13689 24185 1347419718 1 f none /usr/local/share/doc/postgresql/html/locking-indexes.html 0644 root root 4495 17132 1347419719 1 f none /usr/local/share/doc/postgresql/html/log-shipping-alternative.html 0644 root root 11055 39202 1347419719 1 f none /usr/local/share/doc/postgresql/html/logfile-maintenance.html 0644 root root 7144 36285 1347419718 1 f none /usr/local/share/doc/postgresql/html/ltree.html 0644 root root 27293 8462 1347419719 1 f none /usr/local/share/doc/postgresql/html/maintenance.html 0644 root root 5539 35988 1347419719 1 f none /usr/local/share/doc/postgresql/html/manage-ag-config.html 0644 root root 3744 20458 1347419718 1 f none /usr/local/share/doc/postgresql/html/manage-ag-createdb.html 0644 root root 6308 22091 1347419719 1 f none /usr/local/share/doc/postgresql/html/manage-ag-dropdb.html 0644 root root 3603 5981 1347419719 1 f none /usr/local/share/doc/postgresql/html/manage-ag-overview.html 0644 root root 5142 4927 1347419718 1 f none /usr/local/share/doc/postgresql/html/manage-ag-tablespaces.html 0644 root root 9156 14126 1347419718 1 f none /usr/local/share/doc/postgresql/html/manage-ag-templatedbs.html 0644 root root 8160 44006 1347419719 1 f none /usr/local/share/doc/postgresql/html/managing-databases.html 0644 root root 3271 44618 1347419719 1 f none /usr/local/share/doc/postgresql/html/monitoring-locks.html 0644 root root 3671 14216 1347419718 1 f none /usr/local/share/doc/postgresql/html/monitoring-ps.html 0644 root root 6780 61275 1347419719 1 f none /usr/local/share/doc/postgresql/html/monitoring-stats.html 0644 root root 58061 37060 1347419718 1 f none /usr/local/share/doc/postgresql/html/monitoring.html 0644 root root 4456 6630 1347419719 1 f none /usr/local/share/doc/postgresql/html/multibyte.html 0644 root root 32225 45488 1347419719 1 f none /usr/local/share/doc/postgresql/html/mvcc-intro.html 0644 root root 4550 26454 1347419719 1 f none /usr/local/share/doc/postgresql/html/mvcc.html 0644 root root 4242 55528 1347419719 1 f none /usr/local/share/doc/postgresql/html/nls-programmer.html 0644 root root 10076 47254 1347419719 1 f none /usr/local/share/doc/postgresql/html/nls-translator.html 0644 root root 14528 41982 1347419718 1 f none /usr/local/share/doc/postgresql/html/nls.html 0644 root root 3132 30388 1347419719 1 f none /usr/local/share/doc/postgresql/html/non-durability.html 0644 root root 4483 12023 1347419718 1 f none /usr/local/share/doc/postgresql/html/notation.html 0644 root root 4413 8982 1347419718 1 f none /usr/local/share/doc/postgresql/html/oid2name.html 0644 root root 11960 8478 1347419718 1 f none /usr/local/share/doc/postgresql/html/overview.html 0644 root root 4091 44521 1347419718 1 f none /usr/local/share/doc/postgresql/html/pageinspect.html 0644 root root 8046 59655 1347419719 1 f none /usr/local/share/doc/postgresql/html/parser-stage.html 0644 root root 8115 31206 1347419719 1 f none /usr/local/share/doc/postgresql/html/passwordcheck.html 0644 root root 4786 42384 1347419719 1 f none /usr/local/share/doc/postgresql/html/performance-tips.html 0644 root root 4499 64617 1347419719 1 f none /usr/local/share/doc/postgresql/html/perm-functions.html 0644 root root 3348 59492 1347419719 1 f none /usr/local/share/doc/postgresql/html/pgarchivecleanup.html 0644 root root 9153 32166 1347419718 1 f none /usr/local/share/doc/postgresql/html/pgbench.html 0644 root root 30830 20817 1347419719 1 f none /usr/local/share/doc/postgresql/html/pgbuffercache.html 0644 root root 7633 34911 1347419719 1 f none /usr/local/share/doc/postgresql/html/pgcrypto.html 0644 root root 38487 31742 1347419719 1 f none /usr/local/share/doc/postgresql/html/pgfreespacemap.html 0644 root root 5228 53380 1347419719 1 f none /usr/local/share/doc/postgresql/html/pgrowlocks.html 0644 root root 6076 49410 1347419718 1 f none /usr/local/share/doc/postgresql/html/pgstandby.html 0644 root root 15202 38310 1347419718 1 f none /usr/local/share/doc/postgresql/html/pgstatstatements.html 0644 root root 16066 48547 1347419719 1 f none /usr/local/share/doc/postgresql/html/pgstattuple.html 0644 root root 8654 40398 1347419718 1 f none /usr/local/share/doc/postgresql/html/pgtestfsync.html 0644 root root 5252 54958 1347419718 1 f none /usr/local/share/doc/postgresql/html/pgtesttiming.html 0644 root root 12474 62936 1347419719 1 f none /usr/local/share/doc/postgresql/html/pgtrgm.html 0644 root root 12331 22245 1347419719 1 f none /usr/local/share/doc/postgresql/html/pgupgrade.html 0644 root root 24293 33768 1347419719 1 f none /usr/local/share/doc/postgresql/html/planner-optimizer.html 0644 root root 9394 33298 1347419718 1 f none /usr/local/share/doc/postgresql/html/planner-stats-details.html 0644 root root 3024 31396 1347419719 1 f none /usr/local/share/doc/postgresql/html/planner-stats.html 0644 root root 9056 20122 1347419719 1 f none /usr/local/share/doc/postgresql/html/plhandler.html 0644 root root 12836 50845 1347419719 1 f none /usr/local/share/doc/postgresql/html/plperl-builtins.html 0644 root root 18274 40619 1347419719 1 f none /usr/local/share/doc/postgresql/html/plperl-data.html 0644 root root 2876 15594 1347419719 1 f none /usr/local/share/doc/postgresql/html/plperl-funcs.html 0644 root root 13367 58177 1347419719 1 f none /usr/local/share/doc/postgresql/html/plperl-global.html 0644 root root 5065 56645 1347419719 1 f none /usr/local/share/doc/postgresql/html/plperl-triggers.html 0644 root root 6444 64627 1347419719 1 f none /usr/local/share/doc/postgresql/html/plperl-trusted.html 0644 root root 6710 62670 1347419719 1 f none /usr/local/share/doc/postgresql/html/plperl-under-the-hood.html 0644 root root 8989 39328 1347419719 1 f none /usr/local/share/doc/postgresql/html/plperl.html 0644 root root 4928 43554 1347419718 1 f none /usr/local/share/doc/postgresql/html/plpgsql-control-structures.html 0644 root root 46184 30959 1347419719 1 f none /usr/local/share/doc/postgresql/html/plpgsql-cursors.html 0644 root root 25584 59790 1347419719 1 f none /usr/local/share/doc/postgresql/html/plpgsql-declarations.html 0644 root root 21731 29608 1347419718 1 f none /usr/local/share/doc/postgresql/html/plpgsql-development-tips.html 0644 root root 9509 7499 1347419718 1 f none /usr/local/share/doc/postgresql/html/plpgsql-errors-and-messages.html 0644 root root 10092 23678 1347419718 1 f none /usr/local/share/doc/postgresql/html/plpgsql-expressions.html 0644 root root 4660 18503 1347419719 1 f none /usr/local/share/doc/postgresql/html/plpgsql-implementation.html 0644 root root 18041 49004 1347419718 1 f none /usr/local/share/doc/postgresql/html/plpgsql-overview.html 0644 root root 9030 33993 1347419718 1 f none /usr/local/share/doc/postgresql/html/plpgsql-porting.html 0644 root root 27092 22236 1347419718 1 f none /usr/local/share/doc/postgresql/html/plpgsql-statements.html 0644 root root 32219 23055 1347419719 1 f none /usr/local/share/doc/postgresql/html/plpgsql-structure.html 0644 root root 7372 31104 1347419718 1 f none /usr/local/share/doc/postgresql/html/plpgsql-trigger.html 0644 root root 22320 60092 1347419719 1 f none /usr/local/share/doc/postgresql/html/plpgsql.html 0644 root root 6963 61431 1347419719 1 f none /usr/local/share/doc/postgresql/html/plpython-data.html 0644 root root 14646 63134 1347419719 1 f none /usr/local/share/doc/postgresql/html/plpython-database.html 0644 root root 15347 4877 1347419719 1 f none /usr/local/share/doc/postgresql/html/plpython-do.html 0644 root root 2769 6934 1347419718 1 f none /usr/local/share/doc/postgresql/html/plpython-envar.html 0644 root root 3883 24959 1347419718 1 f none /usr/local/share/doc/postgresql/html/plpython-funcs.html 0644 root root 5476 24342 1347419718 1 f none /usr/local/share/doc/postgresql/html/plpython-python23.html 0644 root root 7205 40471 1347419719 1 f none /usr/local/share/doc/postgresql/html/plpython-sharing.html 0644 root root 3030 26970 1347419719 1 f none /usr/local/share/doc/postgresql/html/plpython-subtransaction.html 0644 root root 7886 32353 1347419718 1 f none /usr/local/share/doc/postgresql/html/plpython-trigger.html 0644 root root 5067 30321 1347419719 1 f none /usr/local/share/doc/postgresql/html/plpython-util.html 0644 root root 5102 54240 1347419718 1 f none /usr/local/share/doc/postgresql/html/plpython.html 0644 root root 6065 2245 1347419719 1 f none /usr/local/share/doc/postgresql/html/pltcl-data.html 0644 root root 2904 16638 1347419719 1 f none /usr/local/share/doc/postgresql/html/pltcl-dbaccess.html 0644 root root 13579 18915 1347419719 1 f none /usr/local/share/doc/postgresql/html/pltcl-functions.html 0644 root root 6175 4328 1347419719 1 f none /usr/local/share/doc/postgresql/html/pltcl-global.html 0644 root root 5064 63960 1347419719 1 f none /usr/local/share/doc/postgresql/html/pltcl-overview.html 0644 root root 5284 12177 1347419718 1 f none /usr/local/share/doc/postgresql/html/pltcl-procnames.html 0644 root root 3220 43397 1347419719 1 f none /usr/local/share/doc/postgresql/html/pltcl-trigger.html 0644 root root 8738 50578 1347419718 1 f none /usr/local/share/doc/postgresql/html/pltcl-unknown.html 0644 root root 5073 57673 1347419719 1 f none /usr/local/share/doc/postgresql/html/pltcl.html 0644 root root 3398 52290 1347419719 1 f none /usr/local/share/doc/postgresql/html/populate.html 0644 root root 17112 23059 1347419719 1 f none /usr/local/share/doc/postgresql/html/postgres-user.html 0644 root root 3312 52082 1347419718 1 f none /usr/local/share/doc/postgresql/html/preface.html 0644 root root 5065 53060 1347419719 1 f none /usr/local/share/doc/postgresql/html/preventing-server-spoofing.html 0644 root root 4598 32846 1347419719 1 f none /usr/local/share/doc/postgresql/html/protocol-changes.html 0644 root root 6648 20146 1347419719 1 f none /usr/local/share/doc/postgresql/html/protocol-error-fields.html 0644 root root 6129 5619 1347419719 1 f none /usr/local/share/doc/postgresql/html/protocol-flow.html 0644 root root 46200 36869 1347419719 1 f none /usr/local/share/doc/postgresql/html/protocol-message-formats.html 0644 root root 40842 51631 1347419719 1 f none /usr/local/share/doc/postgresql/html/protocol-message-types.html 0644 root root 4931 25761 1347419718 1 f none /usr/local/share/doc/postgresql/html/protocol-overview.html 0644 root root 9668 9077 1347419718 1 f none /usr/local/share/doc/postgresql/html/protocol-replication.html 0644 root root 14262 22077 1347419718 1 f none /usr/local/share/doc/postgresql/html/protocol.html 0644 root root 5650 38271 1347419719 1 f none /usr/local/share/doc/postgresql/html/queries-limit.html 0644 root root 5333 2072 1347419719 1 f none /usr/local/share/doc/postgresql/html/queries-order.html 0644 root root 7367 26762 1347419718 1 f none /usr/local/share/doc/postgresql/html/queries-overview.html 0644 root root 5066 56278 1347419719 1 f none /usr/local/share/doc/postgresql/html/queries-select-lists.html 0644 root root 9216 53254 1347419718 1 f none /usr/local/share/doc/postgresql/html/queries-table-expressions.html 0644 root root 36620 34313 1347419719 1 f none /usr/local/share/doc/postgresql/html/queries-union.html 0644 root root 5112 45989 1347419718 1 f none /usr/local/share/doc/postgresql/html/queries-values.html 0644 root root 4928 36021 1347419719 1 f none /usr/local/share/doc/postgresql/html/queries-with.html 0644 root root 20819 39895 1347419719 1 f none /usr/local/share/doc/postgresql/html/queries.html 0644 root root 4347 52593 1347419719 1 f none /usr/local/share/doc/postgresql/html/query-path.html 0644 root root 5468 20161 1347419718 1 f none /usr/local/share/doc/postgresql/html/querytree.html 0644 root root 11134 4033 1347419718 1 f none /usr/local/share/doc/postgresql/html/rangetypes.html 0644 root root 22687 25382 1347419719 1 f none /usr/local/share/doc/postgresql/html/recovery-config.html 0644 root root 3548 1950 1347419719 1 f none /usr/local/share/doc/postgresql/html/recovery-target-settings.html 0644 root root 7760 7853 1347419718 1 f none /usr/local/share/doc/postgresql/html/reference-client.html 0644 root root 6100 1481 1347419719 1 f none /usr/local/share/doc/postgresql/html/reference-server.html 0644 root root 3962 30986 1347419719 1 f none /usr/local/share/doc/postgresql/html/reference.html 0644 root root 23160 2318 1347419719 1 f none /usr/local/share/doc/postgresql/html/regress-coverage.html 0644 root root 3323 52205 1347419719 1 f none /usr/local/share/doc/postgresql/html/regress-evaluation.html 0644 root root 11604 11110 1347419718 1 f none /usr/local/share/doc/postgresql/html/regress-run.html 0644 root root 12226 188 1347419719 1 f none /usr/local/share/doc/postgresql/html/regress-variant.html 0644 root root 7175 41158 1347419718 1 f none /usr/local/share/doc/postgresql/html/regress.html 0644 root root 4100 38612 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-0-01.html 0644 root root 2587 51644 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-0-02.html 0644 root root 4323 61994 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-0-03.html 0644 root root 7830 33307 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-1-0.html 0644 root root 4261 60988 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-1-01.html 0644 root root 9378 20962 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-1-02.html 0644 root root 6521 40750 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-1-09.html 0644 root root 2557 48014 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-6-0.html 0644 root root 7952 2794 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-6-1-1.html 0644 root root 3751 21175 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-6-1.html 0644 root root 9059 27582 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-6-2-1.html 0644 root root 4437 7259 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-6-2.html 0644 root root 8915 5084 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-6-3-1.html 0644 root root 4476 14574 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-6-3-2.html 0644 root root 4189 54647 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-6-3.html 0644 root root 16344 40850 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-6-4-1.html 0644 root root 4093 46925 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-6-4-2.html 0644 root root 2940 8890 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-6-4.html 0644 root root 14765 5239 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-6-5-1.html 0644 root root 3874 25241 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-6-5-2.html 0644 root root 4134 48685 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-6-5-3.html 0644 root root 3085 18900 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-6-5.html 0644 root root 17419 56598 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-0-1.html 0644 root root 3952 31008 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-0-2.html 0644 root root 2919 5086 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-7-0-3.html 0644 root root 4688 30216 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-7-0.html 0644 root root 23136 25041 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-7-1-1.html 0644 root root 3294 37433 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-7-1-2.html 0644 root root 3007 13119 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-1-3.html 0644 root root 3171 27581 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-1.html 0644 root root 13049 27112 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-7-2-1.html 0644 root root 4043 31682 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-2-2.html 0644 root root 3825 11351 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-2-3.html 0644 root root 3396 44903 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-7-2-4.html 0644 root root 3619 64971 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-2-5.html 0644 root root 3778 13693 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-2-6.html 0644 root root 3656 6039 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-2-7.html 0644 root root 3758 13926 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-7-2-8.html 0644 root root 3980 30556 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-2.html 0644 root root 27130 38107 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-3-1.html 0644 root root 4200 44473 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-7-3-10.html 0644 root root 7525 63600 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-3-11.html 0644 root root 4122 38225 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-7-3-12.html 0644 root root 3538 57017 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-3-13.html 0644 root root 4629 18899 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-3-14.html 0644 root root 3942 25854 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-3-15.html 0644 root root 6326 25539 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-7-3-16.html 0644 root root 3435 47422 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-3-17.html 0644 root root 3561 51809 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-3-18.html 0644 root root 3658 963 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-7-3-19.html 0644 root root 3697 1312 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-7-3-2.html 0644 root root 5237 536 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-3-20.html 0644 root root 3535 51596 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-7-3-21.html 0644 root root 6227 4984 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-3-3.html 0644 root root 10322 3045 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-3-4.html 0644 root root 3534 56477 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-3-5.html 0644 root root 4525 9287 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-7-3-6.html 0644 root root 4460 9581 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-3-7.html 0644 root root 3384 48231 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-3-8.html 0644 root root 3603 1839 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-7-3-9.html 0644 root root 4111 44070 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-7-3.html 0644 root root 33085 20492 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-1.html 0644 root root 7148 19769 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-10.html 0644 root root 3817 14760 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-11.html 0644 root root 4868 38903 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-12.html 0644 root root 4232 48333 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-7-4-13.html 0644 root root 6972 12724 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-14.html 0644 root root 3684 739 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-15.html 0644 root root 4281 38908 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-16.html 0644 root root 3983 26575 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-7-4-17.html 0644 root root 4024 25423 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-18.html 0644 root root 3938 16700 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-19.html 0644 root root 7253 16511 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-2.html 0644 root root 8292 46338 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-7-4-20.html 0644 root root 6616 26933 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-21.html 0644 root root 3933 20065 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-22.html 0644 root root 4082 28479 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-23.html 0644 root root 4434 60084 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-7-4-24.html 0644 root root 4300 43570 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-25.html 0644 root root 4517 4669 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-26.html 0644 root root 5466 85 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-27.html 0644 root root 5175 53062 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-7-4-28.html 0644 root root 5640 22180 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-29.html 0644 root root 6971 383 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-3.html 0644 root root 4647 16143 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-30.html 0644 root root 6222 14189 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-4.html 0644 root root 4117 40254 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-5.html 0644 root root 3226 33531 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-6.html 0644 root root 4763 28567 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-7-4-7.html 0644 root root 4306 60111 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-8.html 0644 root root 10188 16285 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4-9.html 0644 root root 5129 52969 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-7-4.html 0644 root root 57409 5729 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-0-1.html 0644 root root 4776 31681 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-0-10.html 0644 root root 4762 9634 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-0-11.html 0644 root root 3980 25763 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-0-12.html 0644 root root 3145 23832 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-0-13.html 0644 root root 4129 33438 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-0-14.html 0644 root root 4529 62735 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-0-15.html 0644 root root 9112 29063 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-0-16.html 0644 root root 8957 5122 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-0-17.html 0644 root root 3931 20001 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-0-18.html 0644 root root 5590 13313 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-0-19.html 0644 root root 4987 36425 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-0-2.html 0644 root root 9598 15885 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-0-20.html 0644 root root 4323 46637 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-0-21.html 0644 root root 4515 4462 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-0-22.html 0644 root root 6451 6542 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-0-23.html 0644 root root 6034 54441 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-0-24.html 0644 root root 7013 63923 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-0-25.html 0644 root root 7438 36790 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-0-26.html 0644 root root 8037 21518 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-0-3.html 0644 root root 7457 55820 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-0-4.html 0644 root root 6691 43668 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-0-5.html 0644 root root 4827 33150 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-0-6.html 0644 root root 5705 46499 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-0-7.html 0644 root root 5920 47699 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-0-8.html 0644 root root 7236 34033 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-0-9.html 0644 root root 4317 48486 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-0.html 0644 root root 66850 58259 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-1-1.html 0644 root root 5488 19717 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-1-10.html 0644 root root 4789 16921 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-1-11.html 0644 root root 9954 26297 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-1-12.html 0644 root root 9349 35284 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-1-13.html 0644 root root 4300 45828 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-1-14.html 0644 root root 6909 52277 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-1-15.html 0644 root root 6282 3536 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-1-16.html 0644 root root 5286 60129 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-1-17.html 0644 root root 6043 59072 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-1-18.html 0644 root root 6450 6594 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-1-19.html 0644 root root 6620 34498 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-1-2.html 0644 root root 6364 32977 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-1-20.html 0644 root root 7306 21622 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-1-21.html 0644 root root 7221 19219 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-1-22.html 0644 root root 8332 44893 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-1-23.html 0644 root root 7941 65292 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-1-3.html 0644 root root 7034 5858 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-1-4.html 0644 root root 8881 37956 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-1-5.html 0644 root root 5487 9479 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-1-6.html 0644 root root 5345 53556 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-1-7.html 0644 root root 4566 6310 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-1-8.html 0644 root root 3124 22933 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-1-9.html 0644 root root 4396 54424 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-1.html 0644 root root 62145 26657 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-2-1.html 0644 root root 5093 34876 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-2-10.html 0644 root root 8187 19095 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-2-11.html 0644 root root 7154 3172 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-2-12.html 0644 root root 6755 41908 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-2-13.html 0644 root root 7355 26235 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-2-14.html 0644 root root 7883 51717 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-2-15.html 0644 root root 8162 25663 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-2-16.html 0644 root root 9300 43262 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-2-17.html 0644 root root 8221 29892 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-2-18.html 0644 root root 10284 892 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-2-19.html 0644 root root 8596 44938 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-2-2.html 0644 root root 5830 33832 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-2-20.html 0644 root root 6251 4157 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-2-21.html 0644 root root 5600 19524 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-2-22.html 0644 root root 9624 61231 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-2-23.html 0644 root root 9566 7862 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-2-3.html 0644 root root 3123 22178 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-2-4.html 0644 root root 5456 113 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-2-5.html 0644 root root 6023 41215 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-2-6.html 0644 root root 10579 1772 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-2-7.html 0644 root root 9339 44374 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-2-8.html 0644 root root 7528 25429 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-2-9.html 0644 root root 4288 45331 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-2.html 0644 root root 69408 31634 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-3-1.html 0644 root root 10613 9735 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-3-10.html 0644 root root 10732 23609 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-3-11.html 0644 root root 8970 23302 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-3-12.html 0644 root root 12126 8914 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-3-13.html 0644 root root 9513 53023 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-3-14.html 0644 root root 6249 4075 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-3-15.html 0644 root root 6388 17750 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-3-16.html 0644 root root 11022 34364 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-3-17.html 0644 root root 10597 20734 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-3-18.html 0644 root root 11272 20494 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-3-19.html 0644 root root 8473 49605 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-3-2.html 0644 root root 12210 52383 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-3-20.html 0644 root root 9240 45065 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-3-3.html 0644 root root 4282 44983 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-3-4.html 0644 root root 11280 61259 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-3-5.html 0644 root root 8696 50558 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-3-6.html 0644 root root 9204 32920 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-3-7.html 0644 root root 9736 18658 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-3-8.html 0644 root root 9267 21877 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-3-9.html 0644 root root 10213 52510 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-3.html 0644 root root 69776 613 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-4-1.html 0644 root root 9607 43986 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-4-10.html 0644 root root 11944 64047 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-4-11.html 0644 root root 13799 30085 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-4-12.html 0644 root root 9999 36083 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-4-13.html 0644 root root 9708 6282 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-4-2.html 0644 root root 15729 4441 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-4-3.html 0644 root root 13940 5763 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-4-4.html 0644 root root 10748 27438 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-4-5.html 0644 root root 15945 39253 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-4-6.html 0644 root root 10442 60671 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-8-4-7.html 0644 root root 6232 3293 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-4-8.html 0644 root root 8876 15359 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-4-9.html 0644 root root 14540 42424 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-8-4.html 0644 root root 88008 12741 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-9-0-1.html 0644 root root 5978 57177 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-9-0-2.html 0644 root root 13668 48818 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-9-0-3.html 0644 root root 7288 19259 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-9-0-4.html 0644 root root 11391 12508 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-9-0-5.html 0644 root root 17927 40399 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-9-0-6.html 0644 root root 13438 49292 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-9-0-7.html 0644 root root 18103 41778 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-9-0-8.html 0644 root root 11002 48734 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-9-0-9.html 0644 root root 11734 33904 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-9-0.html 0644 root root 96159 47009 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-9-1-1.html 0644 root root 3698 428 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-9-1-2.html 0644 root root 21602 31917 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-9-1-3.html 0644 root root 21161 6996 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-9-1-4.html 0644 root root 16026 48826 1347419718 1 f none /usr/local/share/doc/postgresql/html/release-9-1-5.html 0644 root root 14038 16693 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-9-1.html 0644 root root 79097 6835 1347419719 1 f none /usr/local/share/doc/postgresql/html/release-9-2.html 0644 root root 79601 61842 1347419719 1 f none /usr/local/share/doc/postgresql/html/release.html 0644 root root 18194 55284 1347419718 1 f none /usr/local/share/doc/postgresql/html/resources.html 0644 root root 4220 54030 1347419719 1 f none /usr/local/share/doc/postgresql/html/role-attributes.html 0644 root root 7860 2927 1347419719 1 f none /usr/local/share/doc/postgresql/html/role-membership.html 0644 root root 8616 8859 1347419719 1 f none /usr/local/share/doc/postgresql/html/routine-reindex.html 0644 root root 3626 18749 1347419719 1 f none /usr/local/share/doc/postgresql/html/routine-vacuuming.html 0644 root root 37670 11511 1347419719 1 f none /usr/local/share/doc/postgresql/html/row-estimation-examples.html 0644 root root 20657 59939 1347419718 1 f none /usr/local/share/doc/postgresql/html/rowtypes.html 0644 root root 14320 27824 1347419719 1 f none /usr/local/share/doc/postgresql/html/rule-system.html 0644 root root 4115 45741 1347419718 1 f none /usr/local/share/doc/postgresql/html/rules-privileges.html 0644 root root 11661 20801 1347419718 1 f none /usr/local/share/doc/postgresql/html/rules-status.html 0644 root root 4510 14587 1347419719 1 f none /usr/local/share/doc/postgresql/html/rules-triggers.html 0644 root root 9474 29156 1347419719 1 f none /usr/local/share/doc/postgresql/html/rules-update.html 0644 root root 32613 44373 1347419719 1 f none /usr/local/share/doc/postgresql/html/rules-views.html 0644 root root 26886 24545 1347419719 1 f none /usr/local/share/doc/postgresql/html/rules.html 0644 root root 4946 44594 1347419718 1 f none /usr/local/share/doc/postgresql/html/runtime-config-autovacuum.html 0644 root root 10972 55471 1347419719 1 f none /usr/local/share/doc/postgresql/html/runtime-config-client.html 0644 root root 32538 1553 1347419718 1 f none /usr/local/share/doc/postgresql/html/runtime-config-compatible.html 0644 root root 14087 10695 1347419718 1 f none /usr/local/share/doc/postgresql/html/runtime-config-connection.html 0644 root root 22109 40418 1347419719 1 f none /usr/local/share/doc/postgresql/html/runtime-config-custom.html 0644 root root 3546 9645 1347419719 1 f none /usr/local/share/doc/postgresql/html/runtime-config-developer.html 0644 root root 14068 9524 1347419719 1 f none /usr/local/share/doc/postgresql/html/runtime-config-error-handling.html 0644 root root 3568 2933 1347419719 1 f none /usr/local/share/doc/postgresql/html/runtime-config-file-locations.html 0644 root root 6965 4101 1347419718 1 f none /usr/local/share/doc/postgresql/html/runtime-config-locks.html 0644 root root 7632 7462 1347419719 1 f none /usr/local/share/doc/postgresql/html/runtime-config-logging.html 0644 root root 45385 54413 1347419718 1 f none /usr/local/share/doc/postgresql/html/runtime-config-preset.html 0644 root root 8708 56077 1347419719 1 f none /usr/local/share/doc/postgresql/html/runtime-config-query.html 0644 root root 24948 22344 1347419719 1 f none /usr/local/share/doc/postgresql/html/runtime-config-replication.html 0644 root root 18292 5594 1347419719 1 f none /usr/local/share/doc/postgresql/html/runtime-config-resource.html 0644 root root 27899 22680 1347419718 1 f none /usr/local/share/doc/postgresql/html/runtime-config-short.html 0644 root root 6679 4191 1347419719 1 f none /usr/local/share/doc/postgresql/html/runtime-config-statistics.html 0644 root root 8614 65351 1347419719 1 f none /usr/local/share/doc/postgresql/html/runtime-config-wal.html 0644 root root 27091 9949 1347419719 1 f none /usr/local/share/doc/postgresql/html/runtime-config.html 0644 root root 8247 34161 1347419718 1 f none /usr/local/share/doc/postgresql/html/runtime.html 0644 root root 4996 39962 1347419718 1 f none /usr/local/share/doc/postgresql/html/seg.html 0644 root root 15468 34859 1347419719 1 f none /usr/local/share/doc/postgresql/html/sepgsql.html 0644 root root 30825 34849 1347419718 1 f none /usr/local/share/doc/postgresql/html/server-programming.html 0644 root root 9616 2053 1347419719 1 f none /usr/local/share/doc/postgresql/html/server-shutdown.html 0644 root root 6467 39377 1347419719 1 f none /usr/local/share/doc/postgresql/html/server-start.html 0644 root root 14189 1159 1347419718 1 f none /usr/local/share/doc/postgresql/html/source-format.html 0644 root root 5131 65212 1347419718 1 f none /usr/local/share/doc/postgresql/html/source.html 0644 root root 4069 35153 1347419718 1 f none /usr/local/share/doc/postgresql/html/sourcerepo.html 0644 root root 3382 57222 1347419719 1 f none /usr/local/share/doc/postgresql/html/spgist-examples.html 0644 root root 2701 194 1347419719 1 f none /usr/local/share/doc/postgresql/html/spgist-extensibility.html 0644 root root 31280 30209 1347419718 1 f none /usr/local/share/doc/postgresql/html/spgist-implementation.html 0644 root root 8096 50414 1347419718 1 f none /usr/local/share/doc/postgresql/html/spgist-intro.html 0644 root root 4321 7328 1347419719 1 f none /usr/local/share/doc/postgresql/html/spgist.html 0644 root root 2964 17057 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-examples.html 0644 root root 6215 49607 1347419718 1 f none /usr/local/share/doc/postgresql/html/spi-interface-support.html 0644 root root 3768 25517 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-interface.html 0644 root root 5996 14865 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-memory.html 0644 root root 7087 35196 1347419718 1 f none /usr/local/share/doc/postgresql/html/spi-realloc.html 0644 root root 3625 63293 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-connect.html 0644 root root 4050 32314 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-copytuple.html 0644 root root 3451 50690 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-cursor-close.html 0644 root root 3334 46296 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-cursor-fetch.html 0644 root root 4108 32573 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-cursor-find.html 0644 root root 3462 55871 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-cursor-move.html 0644 root root 3888 18856 1347419718 1 f none /usr/local/share/doc/postgresql/html/spi-spi-cursor-open-with-args.html 0644 root root 6176 57572 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-cursor-open-with-paramlist.html 0644 root root 5033 43677 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-cursor-open.html 0644 root root 5730 30345 1347419718 1 f none /usr/local/share/doc/postgresql/html/spi-spi-exec.html 0644 root root 3548 55542 1347419718 1 f none /usr/local/share/doc/postgresql/html/spi-spi-execp.html 0644 root root 4823 20623 1347419718 1 f none /usr/local/share/doc/postgresql/html/spi-spi-execute-plan-with-paramlist.html 0644 root root 4850 24289 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-execute-plan.html 0644 root root 5858 29270 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-execute-with-args.html 0644 root root 6178 56255 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-execute.html 0644 root root 12172 43426 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-finish.html 0644 root root 3653 3806 1347419718 1 f none /usr/local/share/doc/postgresql/html/spi-spi-fname.html 0644 root root 3765 8727 1347419718 1 f none /usr/local/share/doc/postgresql/html/spi-spi-fnumber.html 0644 root root 3934 23517 1347419718 1 f none /usr/local/share/doc/postgresql/html/spi-spi-freeplan.html 0644 root root 3503 53705 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-freetuple.html 0644 root root 3275 40622 1347419718 1 f none /usr/local/share/doc/postgresql/html/spi-spi-freetupletable.html 0644 root root 3626 2540 1347419718 1 f none /usr/local/share/doc/postgresql/html/spi-spi-getargcount.html 0644 root root 3696 4183 1347419718 1 f none /usr/local/share/doc/postgresql/html/spi-spi-getargtypeid.html 0644 root root 4139 36765 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-getbinval.html 0644 root root 4285 46025 1347419718 1 f none /usr/local/share/doc/postgresql/html/spi-spi-getnspname.html 0644 root root 3465 54323 1347419718 1 f none /usr/local/share/doc/postgresql/html/spi-spi-getrelname.html 0644 root root 3349 44366 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-gettype.html 0644 root root 3712 4601 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-gettypeid.html 0644 root root 3716 3149 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-getvalue.html 0644 root root 4164 36889 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-is-cursor-plan.html 0644 root root 4558 4231 1347419718 1 f none /usr/local/share/doc/postgresql/html/spi-spi-keepplan.html 0644 root root 3882 19275 1347419718 1 f none /usr/local/share/doc/postgresql/html/spi-spi-modifytuple.html 0644 root root 5629 7378 1347419718 1 f none /usr/local/share/doc/postgresql/html/spi-spi-palloc.html 0644 root root 3155 27314 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-pfree.html 0644 root root 3273 37308 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-pop.html 0644 root root 2741 64108 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-prepare-cursor.html 0644 root root 5053 34838 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-prepare-params.html 0644 root root 4410 57827 1347419718 1 f none /usr/local/share/doc/postgresql/html/spi-spi-prepare.html 0644 root root 7659 61366 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-push.html 0644 root root 3735 14192 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-returntuple.html 0644 root root 4095 35687 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-saveplan.html 0644 root root 4574 6903 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-scroll-cursor-fetch.html 0644 root root 4807 15886 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-spi-scroll-cursor-move.html 0644 root root 4897 23019 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi-visibility.html 0644 root root 4150 50098 1347419719 1 f none /usr/local/share/doc/postgresql/html/spi.html 0644 root root 10841 25901 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-abort.html 0644 root root 4175 35015 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-alteraggregate.html 0644 root root 6109 45094 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-altercollation.html 0644 root root 5082 32720 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-alterconversion.html 0644 root root 5168 41251 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-alterdatabase.html 0644 root root 8776 58357 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-alterdefaultprivileges.html 0644 root root 9453 33643 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-alterdomain.html 0644 root root 11111 17312 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-alterextension.html 0644 root root 11743 54685 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-alterforeigndatawrapper.html 0644 root root 7376 7604 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-alterforeigntable.html 0644 root root 12705 61003 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-alterfunction.html 0644 root root 12778 9336 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-altergroup.html 0644 root root 5237 47553 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-alterindex.html 0644 root root 7647 23806 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-alterlanguage.html 0644 root root 4020 18788 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-alterlargeobject.html 0644 root root 3728 64999 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-alteropclass.html 0644 root root 5112 37000 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-alteroperator.html 0644 root root 5433 61164 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-alteropfamily.html 0644 root root 13562 30490 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-alterrole.html 0644 root root 13026 49987 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-alterschema.html 0644 root root 4312 41915 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-altersequence.html 0644 root root 13029 27214 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-alterserver.html 0644 root root 5926 28351 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-altertable.html 0644 root root 42806 52233 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-altertablespace.html 0644 root root 5864 27956 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-altertrigger.html 0644 root root 4645 1555 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-altertsconfig.html 0644 root root 8124 62109 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-altertsdictionary.html 0644 root root 6510 16092 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-altertsparser.html 0644 root root 4255 37715 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-altertstemplate.html 0644 root root 4221 35094 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-altertype.html 0644 root root 11191 27629 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-alteruser.html 0644 root root 4438 45841 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-alterusermapping.html 0644 root root 5720 15089 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-alterview.html 0644 root root 6966 35081 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-analyze.html 0644 root root 10672 49339 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-begin.html 0644 root root 6693 39832 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-checkpoint.html 0644 root root 3756 11075 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-close.html 0644 root root 4982 30530 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-cluster.html 0644 root root 9402 593 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-commands.html 0644 root root 18808 55687 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-comment.html 0644 root root 13797 32566 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-commit-prepared.html 0644 root root 4514 273 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-commit.html 0644 root root 3990 20489 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-copy.html 0644 root root 37443 11367 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-createaggregate.html 0644 root root 13827 13816 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-createcast.html 0644 root root 19630 46801 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-createcollation.html 0644 root root 6737 31192 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-createconversion.html 0644 root root 6536 16737 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-createdatabase.html 0644 root root 12383 13042 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-createdomain.html 0644 root root 8542 42518 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-createextension.html 0644 root root 8823 9327 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-createforeigndatawrapper.html 0644 root root 8057 10911 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-createforeigntable.html 0644 root root 7716 38858 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-createfunction.html 0644 root root 30952 17301 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-creategroup.html 0644 root root 4010 13119 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-createindex.html 0644 root root 25738 52890 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-createlanguage.html 0644 root root 14886 37135 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-createopclass.html 0644 root root 12674 34466 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-createoperator.html 0644 root root 10686 2015 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-createopfamily.html 0644 root root 5624 27814 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-createrole.html 0644 root root 19508 12286 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-createrule.html 0644 root root 12654 25019 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-createschema.html 0644 root root 8159 18288 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-createsequence.html 0644 root root 14070 3745 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-createserver.html 0644 root root 6249 58577 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-createtable.html 0644 root root 58375 24680 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-createtableas.html 0644 root root 12770 14235 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-createtablespace.html 0644 root root 6102 47594 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-createtrigger.html 0644 root root 23173 43336 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-createtsconfig.html 0644 root root 5350 65388 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-createtsdictionary.html 0644 root root 5531 11145 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-createtsparser.html 0644 root root 5945 43537 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-createtstemplate.html 0644 root root 5435 10386 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-createtype.html 0644 root root 39458 38119 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-createuser.html 0644 root root 4522 51543 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-createusermapping.html 0644 root root 5501 4479 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-createview.html 0644 root root 10305 53050 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-deallocate.html 0644 root root 3783 3960 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-declare.html 0644 root root 15398 60627 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-delete.html 0644 root root 11792 15900 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-discard.html 0644 root root 4307 45870 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-do.html 0644 root root 5202 48974 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-drop-owned.html 0644 root root 4798 20348 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-dropaggregate.html 0644 root root 4559 59826 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-dropcast.html 0644 root root 4342 42855 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-dropcollation.html 0644 root root 4407 48169 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-dropconversion.html 0644 root root 4435 51890 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-dropdatabase.html 0644 root root 4342 48314 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-dropdomain.html 0644 root root 4255 36186 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-dropextension.html 0644 root root 4783 14378 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-dropforeigndatawrapper.html 0644 root root 4524 57528 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-dropforeigntable.html 0644 root root 4558 61588 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-dropfunction.html 0644 root root 5836 24799 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-dropgroup.html 0644 root root 3045 15469 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-dropindex.html 0644 root root 5255 52569 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-droplanguage.html 0644 root root 4839 15570 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-dropopclass.html 0644 root root 5676 17956 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-dropoperator.html 0644 root root 5220 41797 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-dropopfamily.html 0644 root root 5277 53921 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-droprole.html 0644 root root 5064 41173 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-droprule.html 0644 root root 4149 25961 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-dropschema.html 0644 root root 4527 59300 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-dropsequence.html 0644 root root 4365 45496 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-dropserver.html 0644 root root 4263 36348 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-droptable.html 0644 root root 5026 34551 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-droptablespace.html 0644 root root 4583 203 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-droptrigger.html 0644 root root 4709 5467 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-droptsconfig.html 0644 root root 4770 14824 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-droptsdictionary.html 0644 root root 4687 7501 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-droptsparser.html 0644 root root 4593 65445 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-droptstemplate.html 0644 root root 4565 63010 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-droptype.html 0644 root root 4461 53790 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-dropuser.html 0644 root root 3164 25310 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-dropusermapping.html 0644 root root 4677 2505 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-dropview.html 0644 root root 4260 37957 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-end.html 0644 root root 4155 32990 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-execute.html 0644 root root 5071 42620 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-explain.html 0644 root root 17092 20392 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-expressions.html 0644 root root 45028 16684 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-fetch.html 0644 root root 14249 30491 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-grant.html 0644 root root 28864 42335 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-insert.html 0644 root root 12858 29330 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-keywords-appendix.html 0644 root root 106531 8660 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-listen.html 0644 root root 5901 44835 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-load.html 0644 root root 4205 46333 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-lock.html 0644 root root 11689 28605 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-move.html 0644 root root 4982 20769 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-notify.html 0644 root root 10946 21048 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-prepare-transaction.html 0644 root root 8599 3617 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-prepare.html 0644 root root 9179 55879 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-reassign-owned.html 0644 root root 5240 52956 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-reindex.html 0644 root root 11098 63798 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-release-savepoint.html 0644 root root 5003 37567 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-reset.html 0644 root root 4991 36825 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-revoke.html 0644 root root 14877 51654 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-rollback-prepared.html 0644 root root 4625 8579 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-rollback-to.html 0644 root root 6399 14505 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-rollback.html 0644 root root 3994 19367 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-savepoint.html 0644 root root 5603 18892 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-security-label.html 0644 root root 8877 57783 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-select.html 0644 root root 78892 29071 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-selectinto.html 0644 root root 7632 16069 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-set-constraints.html 0644 root root 7066 9502 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-set-role.html 0644 root root 6913 58164 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-set-session-authorization.html 0644 root root 6060 58988 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-set-transaction.html 0644 root root 12694 51704 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-set.html 0644 root root 12055 30128 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-show.html 0644 root root 6849 31804 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-start-transaction.html 0644 root root 4981 34758 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-syntax-calling-funcs.html 0644 root root 7802 11227 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql-syntax-lexical.html 0644 root root 43368 15565 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-syntax.html 0644 root root 5428 13261 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-truncate.html 0644 root root 9996 42434 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-unlisten.html 0644 root root 4921 24680 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-update.html 0644 root root 15483 52503 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-vacuum.html 0644 root root 11932 63998 1347419719 1 f none /usr/local/share/doc/postgresql/html/sql-values.html 0644 root root 10638 53825 1347419718 1 f none /usr/local/share/doc/postgresql/html/sql.html 0644 root root 13425 38646 1347419719 1 f none /usr/local/share/doc/postgresql/html/ssh-tunnels.html 0644 root root 6261 26784 1347419719 1 f none /usr/local/share/doc/postgresql/html/ssl-tcp.html 0644 root root 13475 18397 1347419719 1 f none /usr/local/share/doc/postgresql/html/sslinfo.html 0644 root root 7592 90 1347419719 1 f none /usr/local/share/doc/postgresql/html/standby-settings.html 0644 root root 5425 10388 1347419719 1 f none /usr/local/share/doc/postgresql/html/storage-file-layout.html 0644 root root 12899 40984 1347419719 1 f none /usr/local/share/doc/postgresql/html/storage-fsm.html 0644 root root 3819 28976 1347419719 1 f none /usr/local/share/doc/postgresql/html/storage-init.html 0644 root root 2758 8936 1347419719 1 f none /usr/local/share/doc/postgresql/html/storage-page-layout.html 0644 root root 13889 48106 1347419718 1 f none /usr/local/share/doc/postgresql/html/storage-toast.html 0644 root root 11476 14635 1347419718 1 f none /usr/local/share/doc/postgresql/html/storage-vm.html 0644 root root 3538 10557 1347419719 1 f none /usr/local/share/doc/postgresql/html/storage.html 0644 root root 2950 17901 1347419718 1 f none /usr/local/share/doc/postgresql/html/stylesheet.css 0644 root root 1538 52916 1347419719 1 f none /usr/local/share/doc/postgresql/html/supported-platforms.html 0644 root root 5039 2500 1347419719 1 f none /usr/local/share/doc/postgresql/html/tablefunc.html 0644 root root 32191 53466 1347419719 1 f none /usr/local/share/doc/postgresql/html/tcn.html 0644 root root 4972 51087 1347419719 1 f none /usr/local/share/doc/postgresql/html/test-parser.html 0644 root root 4528 3833 1347419719 1 f none /usr/local/share/doc/postgresql/html/textsearch-configuration.html 0644 root root 6255 22329 1347419719 1 f none /usr/local/share/doc/postgresql/html/textsearch-controls.html 0644 root root 26963 34711 1347419719 1 f none /usr/local/share/doc/postgresql/html/textsearch-debugging.html 0644 root root 17225 21468 1347419719 1 f none /usr/local/share/doc/postgresql/html/textsearch-dictionaries.html 0644 root root 31265 48482 1347419718 1 f none /usr/local/share/doc/postgresql/html/textsearch-features.html 0644 root root 21308 49075 1347419718 1 f none /usr/local/share/doc/postgresql/html/textsearch-indexes.html 0644 root root 7385 51309 1347419718 1 f none /usr/local/share/doc/postgresql/html/textsearch-intro.html 0644 root root 18451 30569 1347419719 1 f none /usr/local/share/doc/postgresql/html/textsearch-limitations.html 0644 root root 3857 23462 1347419719 1 f none /usr/local/share/doc/postgresql/html/textsearch-migration.html 0644 root root 5032 57480 1347419719 1 f none /usr/local/share/doc/postgresql/html/textsearch-parsers.html 0644 root root 9208 25293 1347419719 1 f none /usr/local/share/doc/postgresql/html/textsearch-psql.html 0644 root root 9343 43987 1347419719 1 f none /usr/local/share/doc/postgresql/html/textsearch-tables.html 0644 root root 9748 47182 1347419718 1 f none /usr/local/share/doc/postgresql/html/textsearch.html 0644 root root 5876 43941 1347419718 1 f none /usr/local/share/doc/postgresql/html/transaction-iso.html 0644 root root 26729 4486 1347419719 1 f none /usr/local/share/doc/postgresql/html/trigger-datachanges.html 0644 root root 5070 58495 1347419719 1 f none /usr/local/share/doc/postgresql/html/trigger-definition.html 0644 root root 15505 48285 1347419719 1 f none /usr/local/share/doc/postgresql/html/trigger-example.html 0644 root root 7747 40969 1347419719 1 f none /usr/local/share/doc/postgresql/html/trigger-interface.html 0644 root root 10717 3827 1347419719 1 f none /usr/local/share/doc/postgresql/html/triggers.html 0644 root root 3796 25110 1347419719 1 f none /usr/local/share/doc/postgresql/html/tsearch2.html 0644 root root 9948 55577 1347419719 1 f none /usr/local/share/doc/postgresql/html/tutorial-accessdb.html 0644 root root 7023 57950 1347419719 1 f none /usr/local/share/doc/postgresql/html/tutorial-advanced-intro.html 0644 root root 3339 52498 1347419718 1 f none /usr/local/share/doc/postgresql/html/tutorial-advanced.html 0644 root root 2854 10995 1347419719 1 f none /usr/local/share/doc/postgresql/html/tutorial-agg.html 0644 root root 7592 44928 1347419718 1 f none /usr/local/share/doc/postgresql/html/tutorial-arch.html 0644 root root 4850 47198 1347419719 1 f none /usr/local/share/doc/postgresql/html/tutorial-concepts.html 0644 root root 3837 24614 1347419718 1 f none /usr/local/share/doc/postgresql/html/tutorial-conclusion.html 0644 root root 2846 12072 1347419719 1 f none /usr/local/share/doc/postgresql/html/tutorial-createdb.html 0644 root root 9198 65487 1347419719 1 f none /usr/local/share/doc/postgresql/html/tutorial-delete.html 0644 root root 3515 56740 1347419719 1 f none /usr/local/share/doc/postgresql/html/tutorial-fk.html 0644 root root 4420 4627 1347419718 1 f none /usr/local/share/doc/postgresql/html/tutorial-inheritance.html 0644 root root 6135 61093 1347419719 1 f none /usr/local/share/doc/postgresql/html/tutorial-install.html 0644 root root 4520 24421 1347419719 1 f none /usr/local/share/doc/postgresql/html/tutorial-join.html 0644 root root 9683 9202 1347419719 1 f none /usr/local/share/doc/postgresql/html/tutorial-populate.html 0644 root root 4837 37213 1347419718 1 f none /usr/local/share/doc/postgresql/html/tutorial-select.html 0644 root root 8031 52292 1347419719 1 f none /usr/local/share/doc/postgresql/html/tutorial-sql-intro.html 0644 root root 4902 33168 1347419719 1 f none /usr/local/share/doc/postgresql/html/tutorial-sql.html 0644 root root 3058 25615 1347419718 1 f none /usr/local/share/doc/postgresql/html/tutorial-start.html 0644 root root 2627 58222 1347419718 1 f none /usr/local/share/doc/postgresql/html/tutorial-table.html 0644 root root 5702 30762 1347419719 1 f none /usr/local/share/doc/postgresql/html/tutorial-transactions.html 0644 root root 9946 13892 1347419719 1 f none /usr/local/share/doc/postgresql/html/tutorial-update.html 0644 root root 3157 26920 1347419719 1 f none /usr/local/share/doc/postgresql/html/tutorial-views.html 0644 root root 3373 56776 1347419719 1 f none /usr/local/share/doc/postgresql/html/tutorial-window.html 0644 root root 12479 23583 1347419718 1 f none /usr/local/share/doc/postgresql/html/tutorial.html 0644 root root 5207 64909 1347419718 1 f none /usr/local/share/doc/postgresql/html/typeconv-func.html 0644 root root 11995 55805 1347419719 1 f none /usr/local/share/doc/postgresql/html/typeconv-oper.html 0644 root root 12013 55871 1347419719 1 f none /usr/local/share/doc/postgresql/html/typeconv-overview.html 0644 root root 8288 14912 1347419719 1 f none /usr/local/share/doc/postgresql/html/typeconv-query.html 0644 root root 5448 29685 1347419718 1 f none /usr/local/share/doc/postgresql/html/typeconv-union-case.html 0644 root root 5785 37862 1347419719 1 f none /usr/local/share/doc/postgresql/html/typeconv.html 0644 root root 3719 18586 1347419718 1 f none /usr/local/share/doc/postgresql/html/unaccent.html 0644 root root 6740 43397 1347419719 1 f none /usr/local/share/doc/postgresql/html/unsupported-features-sql-standard.html 0644 root root 35113 18896 1347419719 1 f none /usr/local/share/doc/postgresql/html/upgrading.html 0644 root root 12792 25885 1347419718 1 f none /usr/local/share/doc/postgresql/html/user-manag.html 0644 root root 3902 34660 1347419719 1 f none /usr/local/share/doc/postgresql/html/using-explain.html 0644 root root 41822 50889 1347419718 1 f none /usr/local/share/doc/postgresql/html/uuid-ossp.html 0644 root root 7226 2960 1347419719 1 f none /usr/local/share/doc/postgresql/html/vacuumlo.html 0644 root root 7546 34525 1347419718 1 f none /usr/local/share/doc/postgresql/html/view-pg-available-extension-versions.html 0644 root root 4640 14380 1347419718 1 f none /usr/local/share/doc/postgresql/html/view-pg-available-extensions.html 0644 root root 3942 27963 1347419719 1 f none /usr/local/share/doc/postgresql/html/view-pg-cursors.html 0644 root root 5667 23723 1347419719 1 f none /usr/local/share/doc/postgresql/html/view-pg-group.html 0644 root root 3895 18031 1347419718 1 f none /usr/local/share/doc/postgresql/html/view-pg-indexes.html 0644 root root 4153 34180 1347419719 1 f none /usr/local/share/doc/postgresql/html/view-pg-locks.html 0644 root root 14020 50330 1347419718 1 f none /usr/local/share/doc/postgresql/html/view-pg-prepared-statements.html 0644 root root 5058 47011 1347419719 1 f none /usr/local/share/doc/postgresql/html/view-pg-prepared-xacts.html 0644 root root 4910 37739 1347419719 1 f none /usr/local/share/doc/postgresql/html/view-pg-roles.html 0644 root root 6071 48813 1347419718 1 f none /usr/local/share/doc/postgresql/html/view-pg-rules.html 0644 root root 3997 23567 1347419719 1 f none /usr/local/share/doc/postgresql/html/view-pg-seclabels.html 0644 root root 5121 40126 1347419718 1 f none /usr/local/share/doc/postgresql/html/view-pg-settings.html 0644 root root 10598 14750 1347419719 1 f none /usr/local/share/doc/postgresql/html/view-pg-shadow.html 0644 root root 5379 62827 1347419718 1 f none /usr/local/share/doc/postgresql/html/view-pg-stats.html 0644 root root 8885 17377 1347419719 1 f none /usr/local/share/doc/postgresql/html/view-pg-tables.html 0644 root root 4834 20823 1347419719 1 f none /usr/local/share/doc/postgresql/html/view-pg-timezone-abbrevs.html 0644 root root 3574 64443 1347419719 1 f none /usr/local/share/doc/postgresql/html/view-pg-timezone-names.html 0644 root root 4175 45632 1347419719 1 f none /usr/local/share/doc/postgresql/html/view-pg-user-mappings.html 0644 root root 4691 10406 1347419719 1 f none /usr/local/share/doc/postgresql/html/view-pg-user.html 0644 root root 4515 64021 1347419719 1 f none /usr/local/share/doc/postgresql/html/view-pg-views.html 0644 root root 3851 13982 1347419719 1 f none /usr/local/share/doc/postgresql/html/views-overview.html 0644 root root 6540 37642 1347419718 1 f none /usr/local/share/doc/postgresql/html/wal-async-commit.html 0644 root root 9014 15912 1347419719 1 f none /usr/local/share/doc/postgresql/html/wal-configuration.html 0644 root root 14958 61441 1347419719 1 f none /usr/local/share/doc/postgresql/html/wal-internals.html 0644 root root 6149 26113 1347419719 1 f none /usr/local/share/doc/postgresql/html/wal-intro.html 0644 root root 5532 41896 1347419719 1 f none /usr/local/share/doc/postgresql/html/wal-reliability.html 0644 root root 11477 1053 1347419718 1 f none /usr/local/share/doc/postgresql/html/wal.html 0644 root root 2926 14956 1347419719 1 f none /usr/local/share/doc/postgresql/html/warm-standby-failover.html 0644 root root 6100 37261 1347419719 1 f none /usr/local/share/doc/postgresql/html/warm-standby.html 0644 root root 34549 2904 1347419719 1 f none /usr/local/share/doc/postgresql/html/xaggr.html 0644 root root 9900 1755 1347419719 1 f none /usr/local/share/doc/postgresql/html/xfunc-c.html 0644 root root 78710 28145 1347419719 1 f none /usr/local/share/doc/postgresql/html/xfunc-internal.html 0644 root root 4002 35905 1347419719 1 f none /usr/local/share/doc/postgresql/html/xfunc-overload.html 0644 root root 5909 3036 1347419718 1 f none /usr/local/share/doc/postgresql/html/xfunc-pl.html 0644 root root 2989 23841 1347419719 1 f none /usr/local/share/doc/postgresql/html/xfunc-sql.html 0644 root root 38566 3138 1347419718 1 f none /usr/local/share/doc/postgresql/html/xfunc-volatility.html 0644 root root 9837 50930 1347419719 1 f none /usr/local/share/doc/postgresql/html/xfunc.html 0644 root root 4516 9504 1347419719 1 f none /usr/local/share/doc/postgresql/html/xindex.html 0644 root root 44591 17481 1347419719 1 f none /usr/local/share/doc/postgresql/html/xml2.html 0644 root root 16794 15041 1347419719 1 f none /usr/local/share/doc/postgresql/html/xoper-optimization.html 0644 root root 23141 21241 1347419718 1 f none /usr/local/share/doc/postgresql/html/xoper.html 0644 root root 4833 41866 1347419718 1 f none /usr/local/share/doc/postgresql/html/xplang-install.html 0644 root root 11125 59353 1347419719 1 f none /usr/local/share/doc/postgresql/html/xplang.html 0644 root root 4233 62375 1347419719 1 f none /usr/local/share/doc/postgresql/html/xtypes.html 0644 root root 12112 39397 1347419719 1 d none /usr/local/share/man 0755 root root 1 d none /usr/local/share/man/man1 0755 root root 1 f none /usr/local/share/man/man1/clusterdb.1 0644 root root 5811 26853 1347419720 1 f none /usr/local/share/man/man1/createdb.1 0644 root root 7419 32174 1347419720 1 f none /usr/local/share/man/man1/createlang.1 0644 root root 5419 55483 1347419720 1 f none /usr/local/share/man/man1/createuser.1 0644 root root 9329 64941 1347419720 1 f none /usr/local/share/man/man1/dropdb.1 0644 root root 5369 51493 1347419720 1 f none /usr/local/share/man/man1/droplang.1 0644 root root 5211 36534 1347419720 1 f none /usr/local/share/man/man1/dropuser.1 0644 root root 5347 51714 1347419720 1 f none /usr/local/share/man/man1/ecpg.1 0644 root root 5326 48861 1347419720 1 f none /usr/local/share/man/man1/initdb.1 0644 root root 9340 23215 1347419720 1 f none /usr/local/share/man/man1/oid2name.1 0644 root root 8874 33070 1347419720 1 f none /usr/local/share/man/man1/pg_archivecleanup.1 0644 root root 5749 22088 1347419720 1 f none /usr/local/share/man/man1/pg_basebackup.1 0644 root root 13194 36714 1347419720 1 f none /usr/local/share/man/man1/pg_config.1 0644 root root 6800 49813 1347419720 1 f none /usr/local/share/man/man1/pg_controldata.1 0644 root root 2293 51640 1347419720 1 f none /usr/local/share/man/man1/pg_ctl.1 0644 root root 12877 64039 1347419720 1 f none /usr/local/share/man/man1/pg_dump.1 0644 root root 28996 61703 1347419720 1 f none /usr/local/share/man/man1/pg_dumpall.1 0644 root root 12881 5591 1347419720 1 f none /usr/local/share/man/man1/pg_receivexlog.1 0644 root root 6776 58497 1347419720 1 f none /usr/local/share/man/man1/pg_resetxlog.1 0644 root root 8233 49916 1347419720 1 f none /usr/local/share/man/man1/pg_restore.1 0644 root root 19578 58308 1347419720 1 f none /usr/local/share/man/man1/pg_standby.1 0644 root root 10596 47700 1347419720 1 f none /usr/local/share/man/man1/pg_test_fsync.1 0644 root root 2807 29256 1347419720 1 f none /usr/local/share/man/man1/pg_test_timing.1 0644 root root 9816 39715 1347419720 1 f none /usr/local/share/man/man1/pg_upgrade.1 0644 root root 17916 17702 1347419720 1 f none /usr/local/share/man/man1/pgbench.1 0644 root root 21411 43673 1347419720 1 f none /usr/local/share/man/man1/postgres.1 0644 root root 20851 8000 1347419720 1 f none /usr/local/share/man/man1/postmaster.1 0644 root root 1535 47114 1347419720 1 f none /usr/local/share/man/man1/psql.1 0644 root root 87146 36253 1347419720 1 f none /usr/local/share/man/man1/reindexdb.1 0644 root root 6128 52103 1347419720 1 f none /usr/local/share/man/man1/vacuumdb.1 0644 root root 7090 2079 1347419720 1 f none /usr/local/share/man/man1/vacuumlo.1 0644 root root 4314 31093 1347419720 1 d none /usr/local/share/man/man3 0755 root root 1 f none /usr/local/share/man/man3/SPI_connect.3 0644 root root 2261 45257 1347419720 1 f none /usr/local/share/man/man3/SPI_copytuple.3 0644 root root 1834 7398 1347419720 1 f none /usr/local/share/man/man3/SPI_cursor_close.3 0644 root root 1784 4490 1347419720 1 f none /usr/local/share/man/man3/SPI_cursor_fetch.3 0644 root root 2137 33539 1347419720 1 f none /usr/local/share/man/man3/SPI_cursor_find.3 0644 root root 1779 2587 1347419720 1 f none /usr/local/share/man/man3/SPI_cursor_move.3 0644 root root 2003 22323 1347419720 1 f none /usr/local/share/man/man3/SPI_cursor_open.3 0644 root root 3353 9921 1347419720 1 f none /usr/local/share/man/man3/SPI_cursor_open_with_args.3 0644 root root 3426 11406 1347419720 1 f none /usr/local/share/man/man3/SPI_cursor_open_with_paramlist.3 0644 root root 2890 32520 1347419720 1 f none /usr/local/share/man/man3/SPI_exec.3 0644 root root 1778 1451 1347419720 1 f none /usr/local/share/man/man3/SPI_execp.3 0644 root root 2474 62739 1347419720 1 f none /usr/local/share/man/man3/SPI_execute.3 0644 root root 7476 32494 1347419720 1 f none /usr/local/share/man/man3/SPI_execute_plan.3 0644 root root 2985 41007 1347419720 1 f none /usr/local/share/man/man3/SPI_execute_plan_with_paramlist.3 0644 root root 2733 18601 1347419720 1 f none /usr/local/share/man/man3/SPI_execute_with_args.3 0644 root root 3516 22953 1347419720 1 f none /usr/local/share/man/man3/SPI_finish.3 0644 root root 2128 33446 1347419720 1 f none /usr/local/share/man/man3/SPI_fname.3 0644 root root 1934 14950 1347419720 1 f none /usr/local/share/man/man3/SPI_fnumber.3 0644 root root 2176 37587 1347419720 1 f none /usr/local/share/man/man3/SPI_freeplan.3 0644 root root 1766 869 1347419720 1 f none /usr/local/share/man/man3/SPI_freetuple.3 0644 root root 1752 1128 1347419720 1 f none /usr/local/share/man/man3/SPI_freetuptable.3 0644 root root 2053 28399 1347419720 1 f none /usr/local/share/man/man3/SPI_getargcount.3 0644 root root 1909 13940 1347419720 1 f none /usr/local/share/man/man3/SPI_getargtypeid.3 0644 root root 2176 37262 1347419720 1 f none /usr/local/share/man/man3/SPI_getbinval.3 0644 root root 2321 48094 1347419720 1 f none /usr/local/share/man/man3/SPI_getnspname.3 0644 root root 1853 9394 1347419720 1 f none /usr/local/share/man/man3/SPI_getrelname.3 0644 root root 1757 95 1347419720 1 f none /usr/local/share/man/man3/SPI_gettype.3 0644 root root 1948 16448 1347419720 1 f none /usr/local/share/man/man3/SPI_gettypeid.3 0644 root root 1868 9322 1347419720 1 f none /usr/local/share/man/man3/SPI_getvalue.3 0644 root root 2192 38190 1347419720 1 f none /usr/local/share/man/man3/SPI_is_cursor_plan.3 0644 root root 2424 60306 1347419720 1 f none /usr/local/share/man/man3/SPI_keepplan.3 0644 root root 2101 31120 1347419720 1 f none /usr/local/share/man/man3/SPI_modifytuple.3 0644 root root 2938 34893 1347419720 1 f none /usr/local/share/man/man3/SPI_palloc.3 0644 root root 1664 57738 1347419720 1 f none /usr/local/share/man/man3/SPI_pfree.3 0644 root root 1752 658 1347419720 1 f none /usr/local/share/man/man3/SPI_pop.3 0644 root root 1508 44478 1347419720 1 f none /usr/local/share/man/man3/SPI_prepare.3 0644 root root 4742 8009 1347419720 1 f none /usr/local/share/man/man3/SPI_prepare_cursor.3 0644 root root 2626 8929 1347419720 1 f none /usr/local/share/man/man3/SPI_prepare_params.3 0644 root root 2432 57597 1347419720 1 f none /usr/local/share/man/man3/SPI_push.3 0644 root root 2274 49164 1347419720 1 f none /usr/local/share/man/man3/SPI_repalloc.3 0644 root root 1987 21471 1347419720 1 f none /usr/local/share/man/man3/SPI_returntuple.3 0644 root root 2209 41611 1347419720 1 f none /usr/local/share/man/man3/SPI_saveplan.3 0644 root root 2498 1103 1347419720 1 f none /usr/local/share/man/man3/SPI_scroll_cursor_fetch.3 0644 root root 2462 58627 1347419720 1 f none /usr/local/share/man/man3/SPI_scroll_cursor_move.3 0644 root root 2510 63003 1347419720 1 f none /usr/local/share/man/man3/dblink.3 0644 root root 6485 11858 1347419720 1 f none /usr/local/share/man/man3/dblink_build_sql_delete.3 0644 root root 3351 2690 1347419720 1 f none /usr/local/share/man/man3/dblink_build_sql_insert.3 0644 root root 3955 55290 1347419720 1 f none /usr/local/share/man/man3/dblink_build_sql_update.3 0644 root root 4208 11649 1347419720 1 f none /usr/local/share/man/man3/dblink_cancel_query.3 0644 root root 2162 36823 1347419720 1 f none /usr/local/share/man/man3/dblink_close.3 0644 root root 2756 19156 1347419720 1 f none /usr/local/share/man/man3/dblink_connect.3 0644 root root 5597 57568 1347419720 1 f none /usr/local/share/man/man3/dblink_connect_u.3 0644 root root 2810 35901 1347419720 1 f none /usr/local/share/man/man3/dblink_disconnect.3 0644 root root 2155 33368 1347419720 1 f none /usr/local/share/man/man3/dblink_error_message.3 0644 root root 1877 10710 1347419720 1 f none /usr/local/share/man/man3/dblink_exec.3 0644 root root 3831 41899 1347419720 1 f none /usr/local/share/man/man3/dblink_fetch.3 0644 root root 4238 14975 1347419720 1 f none /usr/local/share/man/man3/dblink_get_connections.3 0644 root root 1756 509 1347419720 1 f none /usr/local/share/man/man3/dblink_get_notify.3 0644 root root 2547 64712 1347419720 1 f none /usr/local/share/man/man3/dblink_get_pkey.3 0644 root root 2711 13092 1347419720 1 f none /usr/local/share/man/man3/dblink_get_result.3 0644 root root 4993 8095 1347419720 1 f none /usr/local/share/man/man3/dblink_is_busy.3 0644 root root 1871 9466 1347419720 1 f none /usr/local/share/man/man3/dblink_open.3 0644 root root 3270 1427 1347419720 1 f none /usr/local/share/man/man3/dblink_send_query.3 0644 root root 2389 56536 1347419720 1 d none /usr/local/share/man/man5 0755 root root 1 f none /usr/local/share/man/man5/ABORT.5sql 0644 root root 2249 38840 1347419720 1 f none /usr/local/share/man/man5/ALTER_AGGREGATE.5sql 0644 root root 3614 21849 1347419720 1 f none /usr/local/share/man/man5/ALTER_COLLATION.5sql 0644 root root 2867 22957 1347419720 1 f none /usr/local/share/man/man5/ALTER_CONVERSION.5sql 0644 root root 2965 32729 1347419720 1 f none /usr/local/share/man/man5/ALTER_DATABASE.5sql 0644 root root 5407 52474 1347419720 1 f none /usr/local/share/man/man5/ALTER_DEFAULT_PRIVILEGES.5sql 0644 root root 6528 51584 1347419720 1 f none /usr/local/share/man/man5/ALTER_DOMAIN.5sql 0644 root root 6949 33855 1347419720 1 f none /usr/local/share/man/man5/ALTER_EXTENSION.5sql 0644 root root 6703 26197 1347419720 1 f none /usr/local/share/man/man5/ALTER_FOREIGN_DATA_WRAPPER.5sql 0644 root root 4479 27521 1347419720 1 f none /usr/local/share/man/man5/ALTER_FOREIGN_TABLE.5sql 0644 root root 7785 36653 1347419720 1 f none /usr/local/share/man/man5/ALTER_FUNCTION.5sql 0644 root root 7774 42956 1347419720 1 f none /usr/local/share/man/man5/ALTER_GROUP.5sql 0644 root root 3077 42258 1347419720 1 f none /usr/local/share/man/man5/ALTER_INDEX.5sql 0644 root root 4623 38935 1347419720 1 f none /usr/local/share/man/man5/ALTER_LANGUAGE.5sql 0644 root root 2148 28538 1347419720 1 f none /usr/local/share/man/man5/ALTER_LARGE_OBJECT.5sql 0644 root root 2020 19525 1347419720 1 f none /usr/local/share/man/man5/ALTER_OPERATOR.5sql 0644 root root 3082 44361 1347419720 1 f none /usr/local/share/man/man5/ALTER_OPERATOR_CLASS.5sql 0644 root root 2917 29823 1347419720 1 f none /usr/local/share/man/man5/ALTER_OPERATOR_FAMILY.5sql 0644 root root 9305 50336 1347419720 1 f none /usr/local/share/man/man5/ALTER_ROLE.5sql 0644 root root 8431 36513 1347419720 1 f none /usr/local/share/man/man5/ALTER_SCHEMA.5sql 0644 root root 2368 48567 1347419720 1 f none /usr/local/share/man/man5/ALTER_SEQUENCE.5sql 0644 root root 7703 50439 1347419720 1 f none /usr/local/share/man/man5/ALTER_SERVER.5sql 0644 root root 3487 9196 1347419720 1 f none /usr/local/share/man/man5/ALTER_TABLE.5sql 0644 root root 30596 55413 1347419720 1 f none /usr/local/share/man/man5/ALTER_TABLESPACE.5sql 0644 root root 3349 940 1347419720 1 f none /usr/local/share/man/man5/ALTER_TEXT_SEARCH_CONFIGURATION.5sql 0644 root root 4919 65482 1347419720 1 f none /usr/local/share/man/man5/ALTER_TEXT_SEARCH_DICTIONARY.5sql 0644 root root 4131 875 1347419720 1 f none /usr/local/share/man/man5/ALTER_TEXT_SEARCH_PARSER.5sql 0644 root root 2325 42773 1347419720 1 f none /usr/local/share/man/man5/ALTER_TEXT_SEARCH_TEMPLATE.5sql 0644 root root 2363 45874 1347419720 1 f none /usr/local/share/man/man5/ALTER_TRIGGER.5sql 0644 root root 2567 65013 1347419720 1 f none /usr/local/share/man/man5/ALTER_TYPE.5sql 0644 root root 7035 49202 1347419720 1 f none /usr/local/share/man/man5/ALTER_USER.5sql 0644 root root 2410 46578 1347419720 1 f none /usr/local/share/man/man5/ALTER_USER_MAPPING.5sql 0644 root root 3378 65480 1347419720 1 f none /usr/local/share/man/man5/ALTER_VIEW.5sql 0644 root root 3987 51260 1347419720 1 f none /usr/local/share/man/man5/ANALYZE.5sql 0644 root root 7700 7433 1347419720 1 f none /usr/local/share/man/man5/BEGIN.5sql 0644 root root 4184 9843 1347419720 1 f none /usr/local/share/man/man5/CHECKPOINT.5sql 0644 root root 2372 54926 1347419720 1 f none /usr/local/share/man/man5/CLOSE.5sql 0644 root root 2827 24655 1347419720 1 f none /usr/local/share/man/man5/CLUSTER.5sql 0644 root root 6414 19024 1347419720 1 f none /usr/local/share/man/man5/COMMENT.5sql 0644 root root 9213 39363 1347419720 1 f none /usr/local/share/man/man5/COMMIT.5sql 0644 root root 2173 32141 1347419720 1 f none /usr/local/share/man/man5/COMMIT_PREPARED.5sql 0644 root root 2677 12751 1347419720 1 f none /usr/local/share/man/man5/COPY.5sql 0644 root root 26759 31964 1347419720 1 f none /usr/local/share/man/man5/CREATE_AGGREGATE.5sql 0644 root root 9672 46164 1347419720 1 f none /usr/local/share/man/man5/CREATE_CAST.5sql 0644 root root 14412 12550 1347419720 1 f none /usr/local/share/man/man5/CREATE_COLLATION.5sql 0644 root root 4102 65406 1347419720 1 f none /usr/local/share/man/man5/CREATE_CONVERSION.5sql 0644 root root 3914 48756 1347419720 1 f none /usr/local/share/man/man5/CREATE_DATABASE.5sql 0644 root root 8246 35212 1347419720 1 f none /usr/local/share/man/man5/CREATE_DOMAIN.5sql 0644 root root 5501 59781 1347419720 1 f none /usr/local/share/man/man5/CREATE_EXTENSION.5sql 0644 root root 5594 11144 1347419720 1 f none /usr/local/share/man/man5/CREATE_FOREIGN_DATA_WRAPPER.5sql 0644 root root 5205 32783 1347419720 1 f none /usr/local/share/man/man5/CREATE_FOREIGN_TABLE.5sql 0644 root root 4818 55354 1347419720 1 f none /usr/local/share/man/man5/CREATE_FUNCTION.5sql 0644 root root 22095 64284 1347419720 1 f none /usr/local/share/man/man5/CREATE_GROUP.5sql 0644 root root 2222 27733 1347419720 1 f none /usr/local/share/man/man5/CREATE_INDEX.5sql 0644 root root 18915 8517 1347419720 1 f none /usr/local/share/man/man5/CREATE_LANGUAGE.5sql 0644 root root 10100 18650 1347419720 1 f none /usr/local/share/man/man5/CREATE_OPERATOR.5sql 0644 root root 7086 50814 1347419720 1 f none /usr/local/share/man/man5/CREATE_OPERATOR_CLASS.5sql 0644 root root 8748 5282 1347419720 1 f none /usr/local/share/man/man5/CREATE_OPERATOR_FAMILY.5sql 0644 root root 3727 40122 1347419720 1 f none /usr/local/share/man/man5/CREATE_ROLE.5sql 0644 root root 12625 12988 1347419720 1 f none /usr/local/share/man/man5/CREATE_RULE.5sql 0644 root root 8102 19993 1347419720 1 f none /usr/local/share/man/man5/CREATE_SCHEMA.5sql 0644 root root 5428 50496 1347419720 1 f none /usr/local/share/man/man5/CREATE_SEQUENCE.5sql 0644 root root 9505 10557 1347419720 1 f none /usr/local/share/man/man5/CREATE_SERVER.5sql 0644 root root 3771 34572 1347419720 1 f none /usr/local/share/man/man5/CREATE_TABLE.5sql 0644 root root 40334 13745 1347419720 1 f none /usr/local/share/man/man5/CREATE_TABLESPACE.5sql 0644 root root 3604 21823 1347419720 1 f none /usr/local/share/man/man5/CREATE_TABLE_AS.5sql 0644 root root 8135 63490 1347419720 1 f none /usr/local/share/man/man5/CREATE_TEXT_SEARCH_CONFIGURATION.5sql 0644 root root 3323 1958 1347419720 1 f none /usr/local/share/man/man5/CREATE_TEXT_SEARCH_DICTIONARY.5sql 0644 root root 3473 12442 1347419720 1 f none /usr/local/share/man/man5/CREATE_TEXT_SEARCH_PARSER.5sql 0644 root root 3696 34425 1347419720 1 f none /usr/local/share/man/man5/CREATE_TEXT_SEARCH_TEMPLATE.5sql 0644 root root 3512 20464 1347419720 1 f none /usr/local/share/man/man5/CREATE_TRIGGER.5sql 0644 root root 15476 61047 1347419720 1 f none /usr/local/share/man/man5/CREATE_TYPE.5sql 0644 root root 29012 7556 1347419720 1 f none /usr/local/share/man/man5/CREATE_USER.5sql 0644 root root 2539 54653 1347419720 1 f none /usr/local/share/man/man5/CREATE_USER_MAPPING.5sql 0644 root root 3387 1899 1347419720 1 f none /usr/local/share/man/man5/CREATE_VIEW.5sql 0644 root root 7109 64218 1347419720 1 f none /usr/local/share/man/man5/DEALLOCATE.5sql 0644 root root 2096 26204 1347419720 1 f none /usr/local/share/man/man5/DECLARE.5sql 0644 root root 10504 43117 1347419720 1 f none /usr/local/share/man/man5/DELETE.5sql 0644 root root 7576 35293 1347419720 1 f none /usr/local/share/man/man5/DISCARD.5sql 0644 root root 2591 3176 1347419720 1 f none /usr/local/share/man/man5/DO.5sql 0644 root root 3200 54407 1347419720 1 f none /usr/local/share/man/man5/DROP_AGGREGATE.5sql 0644 root root 2639 4243 1347419720 1 f none /usr/local/share/man/man5/DROP_CAST.5sql 0644 root root 2340 44264 1347419720 1 f none /usr/local/share/man/man5/DROP_COLLATION.5sql 0644 root root 2393 47845 1347419720 1 f none /usr/local/share/man/man5/DROP_CONVERSION.5sql 0644 root root 2454 53663 1347419720 1 f none /usr/local/share/man/man5/DROP_DATABASE.5sql 0644 root root 2468 57872 1347419720 1 f none /usr/local/share/man/man5/DROP_DOMAIN.5sql 0644 root root 2302 39464 1347419720 1 f none /usr/local/share/man/man5/DROP_EXTENSION.5sql 0644 root root 2705 10644 1347419720 1 f none /usr/local/share/man/man5/DROP_FOREIGN_DATA_WRAPPER.5sql 0644 root root 2577 61275 1347419720 1 f none /usr/local/share/man/man5/DROP_FOREIGN_TABLE.5sql 0644 root root 2564 61586 1347419720 1 f none /usr/local/share/man/man5/DROP_FUNCTION.5sql 0644 root root 3344 339 1347419720 1 f none /usr/local/share/man/man5/DROP_GROUP.5sql 0644 root root 1638 51591 1347419720 1 f none /usr/local/share/man/man5/DROP_INDEX.5sql 0644 root root 3177 53363 1347419720 1 f none /usr/local/share/man/man5/DROP_LANGUAGE.5sql 0644 root root 2835 18953 1347419720 1 f none /usr/local/share/man/man5/DROP_OPERATOR.5sql 0644 root root 2968 30322 1347419720 1 f none /usr/local/share/man/man5/DROP_OPERATOR_CLASS.5sql 0644 root root 3461 9115 1347419720 1 f none /usr/local/share/man/man5/DROP_OPERATOR_FAMILY.5sql 0644 root root 3235 54559 1347419720 1 f none /usr/local/share/man/man5/DROP_OWNED.5sql 0644 root root 2854 26469 1347419720 1 f none /usr/local/share/man/man5/DROP_ROLE.5sql 0644 root root 3055 42553 1347419720 1 f none /usr/local/share/man/man5/DROP_RULE.5sql 0644 root root 2248 35865 1347419720 1 f none /usr/local/share/man/man5/DROP_SCHEMA.5sql 0644 root root 2612 1707 1347419720 1 f none /usr/local/share/man/man5/DROP_SEQUENCE.5sql 0644 root root 2433 51499 1347419720 1 f none /usr/local/share/man/man5/DROP_SERVER.5sql 0644 root root 2353 44067 1347419720 1 f none /usr/local/share/man/man5/DROP_TABLE.5sql 0644 root root 2945 31785 1347419720 1 f none /usr/local/share/man/man5/DROP_TABLESPACE.5sql 0644 root root 2576 78 1347419720 1 f none /usr/local/share/man/man5/DROP_TEXT_SEARCH_CONFIGURATION.5sql 0644 root root 2830 20437 1347419720 1 f none /usr/local/share/man/man5/DROP_TEXT_SEARCH_DICTIONARY.5sql 0644 root root 2739 12229 1347419720 1 f none /usr/local/share/man/man5/DROP_TEXT_SEARCH_PARSER.5sql 0644 root root 2639 3401 1347419720 1 f none /usr/local/share/man/man5/DROP_TEXT_SEARCH_TEMPLATE.5sql 0644 root root 2677 6542 1347419720 1 f none /usr/local/share/man/man5/DROP_TRIGGER.5sql 0644 root root 2576 65449 1347419720 1 f none /usr/local/share/man/man5/DROP_TYPE.5sql 0644 root root 2490 57187 1347419720 1 f none /usr/local/share/man/man5/DROP_USER.5sql 0644 root root 1702 57707 1347419720 1 f none /usr/local/share/man/man5/DROP_USER_MAPPING.5sql 0644 root root 2657 4306 1347419720 1 f none /usr/local/share/man/man5/DROP_VIEW.5sql 0644 root root 2394 48866 1347419720 1 f none /usr/local/share/man/man5/END.5sql 0644 root root 2265 40199 1347419720 1 f none /usr/local/share/man/man5/EXECUTE.5sql 0644 root root 3034 46233 1347419720 1 f none /usr/local/share/man/man5/EXPLAIN.5sql 0644 root root 13203 13114 1347419720 1 f none /usr/local/share/man/man5/FETCH.5sql 0644 root root 8727 47513 1347419720 1 f none /usr/local/share/man/man5/GRANT.5sql 0644 root root 21607 44659 1347419720 1 f none /usr/local/share/man/man5/INSERT.5sql 0644 root root 8951 8641 1347419720 1 f none /usr/local/share/man/man5/LISTEN.5sql 0644 root root 3621 35096 1347419720 1 f none /usr/local/share/man/man5/LOAD.5sql 0644 root root 2645 13315 1347419720 1 f none /usr/local/share/man/man5/LOCK.5sql 0644 root root 7972 8098 1347419720 1 f none /usr/local/share/man/man5/MOVE.5sql 0644 root root 3034 30914 1347419720 1 f none /usr/local/share/man/man5/NOTIFY.5sql 0644 root root 8154 56763 1347419720 1 f none /usr/local/share/man/man5/PREPARE.5sql 0644 root root 6352 15495 1347419720 1 f none /usr/local/share/man/man5/PREPARE_TRANSACTION.5sql 0644 root root 5900 37134 1347419720 1 f none /usr/local/share/man/man5/REASSIGN_OWNED.5sql 0644 root root 3134 49730 1347419720 1 f none /usr/local/share/man/man5/REINDEX.5sql 0644 root root 8039 21596 1347419720 1 f none /usr/local/share/man/man5/RELEASE_SAVEPOINT.5sql 0644 root root 3139 49779 1347419720 1 f none /usr/local/share/man/man5/RESET.5sql 0644 root root 3029 44847 1347419720 1 f none /usr/local/share/man/man5/REVOKE.5sql 0644 root root 10714 6386 1347419720 1 f none /usr/local/share/man/man5/ROLLBACK.5sql 0644 root root 2172 30471 1347419720 1 f none /usr/local/share/man/man5/ROLLBACK_PREPARED.5sql 0644 root root 2702 14383 1347419720 1 f none /usr/local/share/man/man5/ROLLBACK_TO_SAVEPOINT.5sql 0644 root root 4102 64973 1347419720 1 f none /usr/local/share/man/man5/SAVEPOINT.5sql 0644 root root 3639 23106 1347419720 1 f none /usr/local/share/man/man5/SECURITY_LABEL.5sql 0644 root root 5421 52744 1347419720 1 f none /usr/local/share/man/man5/SELECT.5sql 0644 root root 53674 35360 1347419720 1 f none /usr/local/share/man/man5/SELECT_INTO.5sql 0644 root root 4635 30826 1347419720 1 f none /usr/local/share/man/man5/SET.5sql 0644 root root 7642 44585 1347419720 1 f none /usr/local/share/man/man5/SET_CONSTRAINTS.5sql 0644 root root 4669 59825 1347419720 1 f none /usr/local/share/man/man5/SET_ROLE.5sql 0644 root root 4486 35384 1347419720 1 f none /usr/local/share/man/man5/SET_SESSION_AUTHORIZATION.5sql 0644 root root 4013 61308 1347419720 1 f none /usr/local/share/man/man5/SET_TRANSACTION.5sql 0644 root root 8646 13385 1347419720 1 f none /usr/local/share/man/man5/SHOW.5sql 0644 root root 4347 14736 1347419720 1 f none /usr/local/share/man/man5/START_TRANSACTION.5sql 0644 root root 3004 36805 1347419720 1 f none /usr/local/share/man/man5/TABLE.5sql 0644 root root 21 1613 1347419720 1 f none /usr/local/share/man/man5/TRUNCATE.5sql 0644 root root 6924 58938 1347419720 1 f none /usr/local/share/man/man5/UNLISTEN.5sql 0644 root root 2842 24918 1347419720 1 f none /usr/local/share/man/man5/UPDATE.5sql 0644 root root 10747 48240 1347419720 1 f none /usr/local/share/man/man5/VACUUM.5sql 0644 root root 8613 4580 1347419720 1 f none /usr/local/share/man/man5/VALUES.5sql 0644 root root 7140 46198 1347419720 1 f none /usr/local/share/man/man5/WITH.5sql 0644 root root 21 1613 1347419720 1 d none /usr/local/share/postgresql 0755 root root 1 f none /usr/local/share/postgresql/conversion_create.sql 0644 root root 74932 16952 1347419722 1 d none /usr/local/share/postgresql/extension 0755 root root 1 f none /usr/local/share/postgresql/extension/adminpack--1.0.sql 0644 root root 1535 55172 1347419725 1 f none /usr/local/share/postgresql/extension/adminpack.control 0644 root root 176 15922 1347419725 1 f none /usr/local/share/postgresql/extension/autoinc--1.0.sql 0644 root root 249 19868 1347419728 1 f none /usr/local/share/postgresql/extension/autoinc--unpackaged--1.0.sql 0644 root root 234 19493 1347419728 1 f none /usr/local/share/postgresql/extension/autoinc.control 0644 root root 149 13551 1347419728 1 f none /usr/local/share/postgresql/extension/btree_gin--1.0.sql 0644 root root 24818 50641 1347419726 1 f none /usr/local/share/postgresql/extension/btree_gin--unpackaged--1.0.sql 0644 root root 10091 1722 1347419726 1 f none /usr/local/share/postgresql/extension/btree_gin.control 0644 root root 160 14395 1347419725 1 f none /usr/local/share/postgresql/extension/btree_gist--1.0.sql 0644 root root 37814 841 1347419726 1 f none /usr/local/share/postgresql/extension/btree_gist--unpackaged--1.0.sql 0644 root root 21463 53290 1347419726 1 f none /usr/local/share/postgresql/extension/btree_gist.control 0644 root root 163 14758 1347419726 1 f none /usr/local/share/postgresql/extension/chkpass--1.0.sql 0644 root root 1154 22673 1347419726 1 f none /usr/local/share/postgresql/extension/chkpass--unpackaged--1.0.sql 0644 root root 619 52275 1347419726 1 f none /usr/local/share/postgresql/extension/chkpass.control 0644 root root 150 13549 1347419726 1 f none /usr/local/share/postgresql/extension/citext--1.0.sql 0644 root root 12337 52626 1347419726 1 f none /usr/local/share/postgresql/extension/citext--unpackaged--1.0.sql 0644 root root 8694 17079 1347419726 1 f none /usr/local/share/postgresql/extension/citext.control 0644 root root 158 14316 1347419726 1 f none /usr/local/share/postgresql/extension/cube--1.0.sql 0644 root root 7831 54747 1347419726 1 f none /usr/local/share/postgresql/extension/cube--unpackaged--1.0.sql 0644 root root 3179 6767 1347419726 1 f none /usr/local/share/postgresql/extension/cube.control 0644 root root 142 12679 1347419726 1 f none /usr/local/share/postgresql/extension/dblink--1.0.sql 0644 root root 5569 50377 1347419726 1 f none /usr/local/share/postgresql/extension/dblink--unpackaged--1.0.sql 0644 root root 2847 52141 1347419726 1 f none /usr/local/share/postgresql/extension/dblink.control 0644 root root 170 15238 1347419726 1 f none /usr/local/share/postgresql/extension/dict_int--1.0.sql 0644 root root 711 54377 1347419726 1 f none /usr/local/share/postgresql/extension/dict_int--unpackaged--1.0.sql 0644 root root 477 41646 1347419726 1 f none /usr/local/share/postgresql/extension/dict_int.control 0644 root root 158 14343 1347419726 1 f none /usr/local/share/postgresql/extension/dict_xsyn--1.0.sql 0644 root root 694 52924 1347419726 1 f none /usr/local/share/postgresql/extension/dict_xsyn--unpackaged--1.0.sql 0644 root root 472 41451 1347419726 1 f none /usr/local/share/postgresql/extension/dict_xsyn.control 0644 root root 179 16543 1347419726 1 f none /usr/local/share/postgresql/extension/earthdistance--1.0.sql 0644 root root 3096 46938 1347419726 1 f none /usr/local/share/postgresql/extension/earthdistance--unpackaged--1.0.sql 0644 root root 943 17025 1347419726 1 f none /usr/local/share/postgresql/extension/earthdistance.control 0644 root root 202 18215 1347419726 1 f none /usr/local/share/postgresql/extension/file_fdw--1.0.sql 0644 root root 475 37941 1347419726 1 f none /usr/local/share/postgresql/extension/file_fdw.control 0644 root root 155 13864 1347419726 1 f none /usr/local/share/postgresql/extension/fuzzystrmatch--1.0.sql 0644 root root 1436 48605 1347419726 1 f none /usr/local/share/postgresql/extension/fuzzystrmatch--unpackaged--1.0.sql 0644 root root 1092 29830 1347419726 1 f none /usr/local/share/postgresql/extension/fuzzystrmatch.control 0644 root root 175 16272 1347419726 1 f none /usr/local/share/postgresql/extension/hstore--1.0--1.1.sql 0644 root root 280 22033 1347419726 1 f none /usr/local/share/postgresql/extension/hstore--1.1.sql 0644 root root 12322 63009 1347419726 1 f none /usr/local/share/postgresql/extension/hstore--unpackaged--1.0.sql 0644 root root 5493 19041 1347419726 1 f none /usr/local/share/postgresql/extension/hstore.control 0644 root root 158 14016 1347419726 1 f none /usr/local/share/postgresql/extension/insert_username--1.0.sql 0644 root root 273 22463 1347419728 1 f none /usr/local/share/postgresql/extension/insert_username--unpackaged--1.0.sql 0644 root root 266 22953 1347419728 1 f none /usr/local/share/postgresql/extension/insert_username.control 0644 root root 170 15538 1347419728 1 f none /usr/local/share/postgresql/extension/intagg--1.0.sql 0644 root root 1041 22141 1347419726 1 f none /usr/local/share/postgresql/extension/intagg--unpackaged--1.0.sql 0644 root root 452 39006 1347419726 1 f none /usr/local/share/postgresql/extension/intagg.control 0644 root root 119 10675 1347419726 1 f none /usr/local/share/postgresql/extension/intarray--1.0.sql 0644 root root 10473 62938 1347419726 1 f none /usr/local/share/postgresql/extension/intarray--unpackaged--1.0.sql 0644 root root 6755 4808 1347419726 1 f none /usr/local/share/postgresql/extension/intarray.control 0644 root root 176 15795 1347419726 1 f none /usr/local/share/postgresql/extension/isn--1.0.sql 0644 root root 66205 43539 1347419726 1 f none /usr/local/share/postgresql/extension/isn--unpackaged--1.0.sql 0644 root root 23689 63473 1347419726 1 f none /usr/local/share/postgresql/extension/isn.control 0644 root root 160 14532 1347419726 1 f none /usr/local/share/postgresql/extension/lo--1.0.sql 0644 root root 708 57927 1347419727 1 f none /usr/local/share/postgresql/extension/lo--unpackaged--1.0.sql 0644 root root 298 24051 1347419727 1 f none /usr/local/share/postgresql/extension/lo.control 0644 root root 126 11025 1347419727 1 f none /usr/local/share/postgresql/extension/ltree--1.0.sql 0644 root root 18297 17636 1347419727 1 f none /usr/local/share/postgresql/extension/ltree--unpackaged--1.0.sql 0644 root root 7982 33494 1347419727 1 f none /usr/local/share/postgresql/extension/ltree.control 0644 root root 155 13974 1347419727 1 f none /usr/local/share/postgresql/extension/moddatetime--1.0.sql 0644 root root 261 21098 1347419728 1 f none /usr/local/share/postgresql/extension/moddatetime--unpackaged--1.0.sql 0644 root root 250 21133 1347419728 1 f none /usr/local/share/postgresql/extension/moddatetime.control 0644 root root 165 15068 1347419728 1 f none /usr/local/share/postgresql/extension/pageinspect--1.0.sql 0644 root root 2339 49575 1347419727 1 f none /usr/local/share/postgresql/extension/pageinspect--unpackaged--1.0.sql 0644 root root 1100 28168 1347419727 1 f none /usr/local/share/postgresql/extension/pageinspect.control 0644 root root 173 15611 1347419727 1 f none /usr/local/share/postgresql/extension/pg_buffercache--1.0.sql 0644 root root 755 63160 1347419727 1 f none /usr/local/share/postgresql/extension/pg_buffercache--unpackaged--1.0.sql 0644 root root 335 28822 1347419727 1 f none /usr/local/share/postgresql/extension/pg_buffercache.control 0644 root root 157 14123 1347419727 1 f none /usr/local/share/postgresql/extension/pg_freespacemap--1.0.sql 0644 root root 871 6061 1347419727 1 f none /usr/local/share/postgresql/extension/pg_freespacemap--unpackaged--1.0.sql 0644 root root 359 31338 1347419727 1 f none /usr/local/share/postgresql/extension/pg_freespacemap.control 0644 root root 160 14213 1347419727 1 f none /usr/local/share/postgresql/extension/pg_stat_statements--1.0--1.1.sql 0644 root root 1237 36608 1347419727 1 f none /usr/local/share/postgresql/extension/pg_stat_statements--1.1.sql 0644 root root 1205 33384 1347419727 1 f none /usr/local/share/postgresql/extension/pg_stat_statements--unpackaged--1.0.sql 0644 root root 433 38696 1347419727 1 f none /usr/local/share/postgresql/extension/pg_stat_statements.control 0644 root root 191 17722 1347419727 1 f none /usr/local/share/postgresql/extension/pg_trgm--1.0.sql 0644 root root 4977 46103 1347419727 1 f none /usr/local/share/postgresql/extension/pg_trgm--unpackaged--1.0.sql 0644 root root 4230 23225 1347419727 1 f none /usr/local/share/postgresql/extension/pg_trgm.control 0644 root root 177 16172 1347419727 1 f none /usr/local/share/postgresql/extension/pgcrypto--1.0.sql 0644 root root 4812 52313 1347419727 1 f none /usr/local/share/postgresql/extension/pgcrypto--unpackaged--1.0.sql 0644 root root 2433 19577 1347419727 1 f none /usr/local/share/postgresql/extension/pgcrypto.control 0644 root root 137 12478 1347419727 1 f none /usr/local/share/postgresql/extension/pgrowlocks--1.0.sql 0644 root root 534 41617 1347419727 1 f none /usr/local/share/postgresql/extension/pgrowlocks--unpackaged--1.0.sql 0644 root root 257 22089 1347419727 1 f none /usr/local/share/postgresql/extension/pgrowlocks.control 0644 root root 152 13879 1347419727 1 f none /usr/local/share/postgresql/extension/pgstattuple--1.0.sql 0644 root root 1910 20325 1347419728 1 f none /usr/local/share/postgresql/extension/pgstattuple--unpackaged--1.0.sql 0644 root root 441 38463 1347419728 1 f none /usr/local/share/postgresql/extension/pgstattuple.control 0644 root root 147 13451 1347419728 1 f none /usr/local/share/postgresql/extension/plpgsql--1.0.sql 0644 root root 332 27082 1347419725 1 f none /usr/local/share/postgresql/extension/plpgsql--unpackaged--1.0.sql 0644 root root 381 31702 1347419725 1 f none /usr/local/share/postgresql/extension/plpgsql.control 0644 root root 179 15991 1347419725 1 f none /usr/local/share/postgresql/extension/pltcl--1.0.sql 0644 root root 316 25411 1347419725 1 f none /usr/local/share/postgresql/extension/pltcl--unpackaged--1.0.sql 0644 root root 231 18450 1347419725 1 f none /usr/local/share/postgresql/extension/pltcl.control 0644 root root 173 15371 1347419725 1 f none /usr/local/share/postgresql/extension/pltclu--1.0.sql 0644 root root 330 26885 1347419725 1 f none /usr/local/share/postgresql/extension/pltclu--unpackaged--1.0.sql 0644 root root 236 19035 1347419725 1 f none /usr/local/share/postgresql/extension/pltclu.control 0644 root root 184 16536 1347419725 1 f none /usr/local/share/postgresql/extension/refint--1.0.sql 0644 root root 343 27206 1347419728 1 f none /usr/local/share/postgresql/extension/refint--unpackaged--1.0.sql 0644 root root 298 25099 1347419728 1 f none /usr/local/share/postgresql/extension/refint.control 0644 root root 169 15437 1347419728 1 f none /usr/local/share/postgresql/extension/seg--1.0.sql 0644 root root 7726 37487 1347419728 1 f none /usr/local/share/postgresql/extension/seg--unpackaged--1.0.sql 0644 root root 2766 32953 1347419728 1 f none /usr/local/share/postgresql/extension/seg.control 0644 root root 172 15615 1347419728 1 f none /usr/local/share/postgresql/extension/sslinfo--1.0.sql 0644 root root 1153 25468 1347419728 1 f none /usr/local/share/postgresql/extension/sslinfo--unpackaged--1.0.sql 0644 root root 830 3606 1347419728 1 f none /usr/local/share/postgresql/extension/sslinfo.control 0644 root root 146 13147 1347419728 1 f none /usr/local/share/postgresql/extension/tablefunc--1.0.sql 0644 root root 2153 42550 1347419728 1 f none /usr/local/share/postgresql/extension/tablefunc--unpackaged--1.0.sql 0644 root root 1144 34768 1347419728 1 f none /usr/local/share/postgresql/extension/tablefunc.control 0644 root root 174 15900 1347419728 1 f none /usr/local/share/postgresql/extension/tcn--1.0.sql 0644 root root 274 22381 1347419728 1 f none /usr/local/share/postgresql/extension/tcn.control 0644 root root 134 11933 1347419728 1 f none /usr/local/share/postgresql/extension/test_parser--1.0.sql 0644 root root 814 64847 1347419728 1 f none /usr/local/share/postgresql/extension/test_parser--unpackaged--1.0.sql 0644 root root 559 49683 1347419728 1 f none /usr/local/share/postgresql/extension/test_parser.control 0644 root root 167 15162 1347419728 1 f none /usr/local/share/postgresql/extension/timetravel--1.0.sql 0644 root root 486 37699 1347419728 1 f none /usr/local/share/postgresql/extension/timetravel--unpackaged--1.0.sql 0644 root root 378 32539 1347419728 1 f none /usr/local/share/postgresql/extension/timetravel.control 0644 root root 156 14262 1347419728 1 f none /usr/local/share/postgresql/extension/tsearch2--1.0.sql 0644 root root 15712 61127 1347419728 1 f none /usr/local/share/postgresql/extension/tsearch2--unpackaged--1.0.sql 0644 root root 9090 13125 1347419728 1 f none /usr/local/share/postgresql/extension/tsearch2.control 0644 root root 313 28094 1347419728 1 f none /usr/local/share/postgresql/extension/unaccent--1.0.sql 0644 root root 854 1374 1347419728 1 f none /usr/local/share/postgresql/extension/unaccent--unpackaged--1.0.sql 0644 root root 750 64613 1347419728 1 f none /usr/local/share/postgresql/extension/unaccent.control 0644 root root 157 14236 1347419728 1 f none /usr/local/share/postgresql/extension/xml2--1.0.sql 0644 root root 1867 15364 1347419728 1 f none /usr/local/share/postgresql/extension/xml2--unpackaged--1.0.sql 0644 root root 1325 48085 1347419728 1 f none /usr/local/share/postgresql/extension/xml2.control 0644 root root 208 18230 1347419728 1 f none /usr/local/share/postgresql/information_schema.sql 0644 root root 106299 41008 1347419721 1 f none /usr/local/share/postgresql/pg_hba.conf.sample 0644 root root 4420 35114 1347419721 1 f none /usr/local/share/postgresql/pg_ident.conf.sample 0644 root root 1636 5990 1347419721 1 f none /usr/local/share/postgresql/pg_service.conf.sample 0644 root root 604 53878 1347419723 1 f none /usr/local/share/postgresql/postgres.bki 0644 root root 519298 5463 1347419721 1 f none /usr/local/share/postgresql/postgres.description 0644 root root 98573 8879 1347419721 1 f none /usr/local/share/postgresql/postgres.shdescription 0644 root root 49 4530 1347419721 1 f none /usr/local/share/postgresql/postgresql.conf.sample 0644 root root 19579 64258 1347419721 1 f none /usr/local/share/postgresql/psqlrc.sample 0644 root root 211 18203 1347419724 1 f none /usr/local/share/postgresql/recovery.conf.sample 0644 root root 4704 50755 1347419721 1 f none /usr/local/share/postgresql/snowball_create.sql 0644 root root 13337 37703 1347419723 1 f none /usr/local/share/postgresql/sql_features.txt 0644 root root 33035 51692 1347419721 1 f none /usr/local/share/postgresql/system_views.sql 0644 root root 27302 25797 1347419721 1 d none /usr/local/share/postgresql/timezone 0755 root root 1 d none /usr/local/share/postgresql/timezone/Africa 0755 root root 1 f none /usr/local/share/postgresql/timezone/Africa/Abidjan 0644 root root 156 5984 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Accra 0644 root root 378 37100 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Addis_Ababa 0644 root root 180 7157 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Algiers 0644 root root 734 62353 1347419720 1 l none /usr/local/share/postgresql/timezone/Africa/Asmara=/usr/local/share/postgresql/timezone/Africa/Asmera 1 f none /usr/local/share/postgresql/timezone/Africa/Asmera 0644 root root 201 9012 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Bamako 0644 root root 208 12622 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Bangui 0644 root root 157 4570 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Banjul 0644 root root 232 14560 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Bissau 0644 root root 194 8834 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Blantyre 0644 root root 157 4901 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Brazzaville 0644 root root 157 4570 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Bujumbura 0644 root root 140 3870 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Cairo 0644 root root 1906 36864 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Casablanca 0644 root root 1346 27095 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Ceuta 0644 root root 2049 1023 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Conakry 0644 root root 208 12712 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Dakar 0644 root root 194 10846 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Dar_es_Salaam 0644 root root 213 11094 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Djibouti 0644 root root 157 4878 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Douala 0644 root root 157 4570 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/El_Aaiun 0644 root root 194 10028 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Freetown 0644 root root 665 11978 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Gaborone 0644 root root 194 8500 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Harare 0644 root root 157 4391 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Johannesburg 0644 root root 245 14912 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Juba 0644 root root 669 33364 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Kampala 0644 root root 253 13934 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Khartoum 0644 root root 669 32854 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Kigali 0644 root root 157 4481 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Kinshasa 0644 root root 140 3539 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Lagos 0644 root root 157 4510 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Libreville 0644 root root 157 5080 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Lome 0644 root root 139 3391 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Luanda 0644 root root 178 6113 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Lubumbashi 0644 root root 140 3540 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Lusaka 0644 root root 157 4901 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Malabo 0644 root root 195 7532 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Maputo 0644 root root 157 4901 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Maseru 0644 root root 204 9670 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Mbabane 0644 root root 160 4690 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Mogadishu 0644 root root 194 9300 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Monrovia 0644 root root 215 12455 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Nairobi 0644 root root 253 14654 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Ndjamena 0644 root root 211 6812 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Niamey 0644 root root 225 11818 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Nouakchott 0644 root root 208 13432 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Ouagadougou 0644 root root 156 6494 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Porto-Novo 0644 root root 195 7382 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Sao_Tome 0644 root root 173 7551 1347419720 1 l none /usr/local/share/postgresql/timezone/Africa/Timbuktu=/usr/local/share/postgresql/timezone/Africa/Bamako 1 f none /usr/local/share/postgresql/timezone/Africa/Tripoli 0644 root root 599 40497 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Tunis 0644 root root 684 51500 1347419720 1 f none /usr/local/share/postgresql/timezone/Africa/Windhoek 0644 root root 1556 23610 1347419720 1 d none /usr/local/share/postgresql/timezone/America 0755 root root 1 l none /usr/local/share/postgresql/timezone/America/Adak=/usr/local/share/postgresql/timezone/America/Atka 1 f none /usr/local/share/postgresql/timezone/America/Anchorage 0644 root root 2358 26983 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Anguilla 0644 root root 156 7400 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Antigua 0644 root root 194 11842 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Araguaina 0644 root root 854 15298 1347419720 1 d none /usr/local/share/postgresql/timezone/America/Argentina 0755 root root 1 f none /usr/local/share/postgresql/timezone/America/Argentina/Buenos_Aires 0644 root root 1061 57344 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Argentina/Catamarca 0644 root root 1087 59834 1347419720 1 l none /usr/local/share/postgresql/timezone/America/Argentina/ComodRivadavia=/usr/local/share/postgresql/timezone/America/Argentina/Catamarca 1 f none /usr/local/share/postgresql/timezone/America/Argentina/Cordoba 0644 root root 1087 60145 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Argentina/Jujuy 0644 root root 1087 61777 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Argentina/La_Rioja 0644 root root 1101 60325 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Argentina/Mendoza 0644 root root 1115 63114 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Argentina/Rio_Gallegos 0644 root root 1087 59772 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Argentina/Salta 0644 root root 1059 58025 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Argentina/San_Juan 0644 root root 1101 60070 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Argentina/San_Luis 0644 root root 1125 64168 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Argentina/Tucuman 0644 root root 1115 62329 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Argentina/Ushuaia 0644 root root 1087 59697 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Aruba 0644 root root 194 11764 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Asuncion 0644 root root 2020 2515 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Atikokan 0644 root root 319 28726 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Atka 0644 root root 2353 31091 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Bahia 0644 root root 1777 8238 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Bahia_Banderas 0644 root root 1558 44889 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Barbados 0644 root root 330 21178 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Belem 0644 root root 574 63873 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Belize 0644 root root 962 59845 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Blanc-Sablon 0644 root root 281 24420 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Boa_Vista 0644 root root 630 2799 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Bogota 0644 root root 231 13834 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Boise 0644 root root 2377 27205 1347419720 1 l none /usr/local/share/postgresql/timezone/America/Buenos_Aires=/usr/local/share/postgresql/timezone/America/Argentina/Buenos_Aires 1 f none /usr/local/share/postgresql/timezone/America/Cambridge_Bay 0644 root root 2052 714 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Campo_Grande 0644 root root 2001 26193 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Cancun 0644 root root 1450 32355 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Caracas 0644 root root 224 14676 1347419720 1 l none /usr/local/share/postgresql/timezone/America/Catamarca=/usr/local/share/postgresql/timezone/America/Argentina/Catamarca 1 f none /usr/local/share/postgresql/timezone/America/Cayenne 0644 root root 186 12292 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Cayman 0644 root root 177 9618 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Chicago 0644 root root 3543 26898 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Chihuahua 0644 root root 1492 29758 1347419720 1 l none /usr/local/share/postgresql/timezone/America/Coral_Harbour=/usr/local/share/postgresql/timezone/America/Atikokan 1 l none /usr/local/share/postgresql/timezone/America/Cordoba=/usr/local/share/postgresql/timezone/America/Argentina/Cordoba 1 f none /usr/local/share/postgresql/timezone/America/Costa_Rica 0644 root root 315 18724 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Creston 0644 root root 191 12056 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Cuiaba 0644 root root 1973 24593 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Curacao 0644 root root 194 11764 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Danmarkshavn 0644 root root 700 40484 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Dawson 0644 root root 2067 10138 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Dawson_Creek 0644 root root 1033 62916 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Denver 0644 root root 2427 36179 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Detroit 0644 root root 2202 32128 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Dominica 0644 root root 156 7640 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Edmonton 0644 root root 2388 36832 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Eirunepe 0644 root root 640 4331 1347419720 1 f none /usr/local/share/postgresql/timezone/America/El_Salvador 0644 root root 236 13512 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Ensenada 0644 root root 2342 44117 1347419720 1 l none /usr/local/share/postgresql/timezone/America/Fort_Wayne=/usr/local/share/postgresql/timezone/America/Indianapolis 1 f none /usr/local/share/postgresql/timezone/America/Fortaleza 0644 root root 714 7958 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Glace_Bay 0644 root root 2192 25601 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Godthab 0644 root root 8296 56379 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Goose_Bay 0644 root root 3177 44944 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Grand_Turk 0644 root root 1871 63699 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Grenada 0644 root root 156 7520 1347419720 1 l none /usr/local/share/postgresql/timezone/America/Guadeloupe=/usr/local/share/postgresql/timezone/America/St_Barthelemy 1 f none /usr/local/share/postgresql/timezone/America/Guatemala 0644 root root 292 17312 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Guayaquil 0644 root root 177 9717 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Guyana 0644 root root 256 17404 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Halifax 0644 root root 3424 16864 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Havana 0644 root root 2411 62017 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Hermosillo 0644 root root 424 34895 1347419720 1 d none /usr/local/share/postgresql/timezone/America/Indiana 0755 root root 1 l none /usr/local/share/postgresql/timezone/America/Indiana/Indianapolis=/usr/local/share/postgresql/timezone/America/Indianapolis 1 l none /usr/local/share/postgresql/timezone/America/Indiana/Knox=/usr/local/share/postgresql/timezone/America/Knox_IN 1 f none /usr/local/share/postgresql/timezone/America/Indiana/Marengo 0644 root root 1705 23078 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Indiana/Petersburg 0644 root root 1887 44898 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Indiana/Tell_City 0644 root root 1677 27456 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Indiana/Vevay 0644 root root 1397 48217 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Indiana/Vincennes 0644 root root 1677 32576 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Indiana/Winamac 0644 root root 1761 46389 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Indianapolis 0644 root root 1649 27497 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Inuvik 0644 root root 1914 49021 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Iqaluit 0644 root root 2000 13720 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Jamaica 0644 root root 481 28533 1347419720 1 l none /usr/local/share/postgresql/timezone/America/Jujuy=/usr/local/share/postgresql/timezone/America/Argentina/Jujuy 1 f none /usr/local/share/postgresql/timezone/America/Juneau 0644 root root 2336 21616 1347419720 1 d none /usr/local/share/postgresql/timezone/America/Kentucky 0755 root root 1 f none /usr/local/share/postgresql/timezone/America/Kentucky/Louisville 0644 root root 2755 47219 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Kentucky/Monticello 0644 root root 2335 38401 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Knox_IN 0644 root root 2395 16709 1347419720 1 l none /usr/local/share/postgresql/timezone/America/Kralendijk=/usr/local/share/postgresql/timezone/America/Curacao 1 f none /usr/local/share/postgresql/timezone/America/La_Paz 0644 root root 217 14860 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Lima 0644 root root 395 32150 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Los_Angeles 0644 root root 2819 38311 1347419720 1 l none /usr/local/share/postgresql/timezone/America/Louisville=/usr/local/share/postgresql/timezone/America/Kentucky/Louisville 1 l none /usr/local/share/postgresql/timezone/America/Lower_Princes=/usr/local/share/postgresql/timezone/America/Curacao 1 f none /usr/local/share/postgresql/timezone/America/Maceio 0644 root root 742 9288 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Managua 0644 root root 421 25986 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Manaus 0644 root root 602 149 1347419720 1 l none /usr/local/share/postgresql/timezone/America/Marigot=/usr/local/share/postgresql/timezone/America/St_Barthelemy 1 f none /usr/local/share/postgresql/timezone/America/Martinique 0644 root root 231 14095 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Matamoros 0644 root root 1402 25394 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Mazatlan 0644 root root 1534 35102 1347419720 1 l none /usr/local/share/postgresql/timezone/America/Mendoza=/usr/local/share/postgresql/timezone/America/Argentina/Mendoza 1 f none /usr/local/share/postgresql/timezone/America/Menominee 0644 root root 2241 28442 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Merida 0644 root root 1426 28217 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Metlakatla 0644 root root 717 44064 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Mexico_City 0644 root root 1604 58057 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Miquelon 0644 root root 1670 44401 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Moncton 0644 root root 3137 47231 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Monterrey 0644 root root 1402 26265 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Montevideo 0644 root root 2118 63039 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Montreal 0644 root root 3477 38312 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Montserrat 0644 root root 156 7640 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Nassau 0644 root root 2270 40966 1347419720 1 f none /usr/local/share/postgresql/timezone/America/New_York 0644 root root 3519 46774 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Nipigon 0644 root root 2105 22275 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Nome 0644 root root 2350 28432 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Noronha 0644 root root 714 6427 1347419720 1 d none /usr/local/share/postgresql/timezone/America/North_Dakota 0755 root root 1 f none /usr/local/share/postgresql/timezone/America/North_Dakota/Beulah 0644 root root 2363 27674 1347419720 1 f none /usr/local/share/postgresql/timezone/America/North_Dakota/Center 0644 root root 2363 30762 1347419720 1 f none /usr/local/share/postgresql/timezone/America/North_Dakota/New_Salem 0644 root root 2363 28564 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Ojinaga 0644 root root 1492 33615 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Panama 0644 root root 177 10127 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Pangnirtung 0644 root root 2062 22092 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Paramaribo 0644 root root 294 21242 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Phoenix 0644 root root 327 31330 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Port-au-Prince 0644 root root 739 47005 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Port_of_Spain 0644 root root 156 7400 1347419720 1 l none /usr/local/share/postgresql/timezone/America/Porto_Acre=/usr/local/share/postgresql/timezone/America/Rio_Branco 1 f none /usr/local/share/postgresql/timezone/America/Porto_Velho 0644 root root 574 63874 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Puerto_Rico 0644 root root 229 17996 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Rainy_River 0644 root root 2105 12146 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Rankin_Inlet 0644 root root 1900 58156 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Recife 0644 root root 714 8078 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Regina 0644 root root 980 62715 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Resolute 0644 root root 1900 58640 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Rio_Branco 0644 root root 612 2401 1347419720 1 l none /usr/local/share/postgresql/timezone/America/Rosario=/usr/local/share/postgresql/timezone/America/Argentina/Cordoba 1 f none /usr/local/share/postgresql/timezone/America/Santa_Isabel 0644 root root 2342 40052 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Santarem 0644 root root 612 1408 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Santiago 0644 root root 9245 52728 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Santo_Domingo 0644 root root 463 34891 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Sao_Paulo 0644 root root 2001 22898 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Scoresbysund 0644 root root 1911 49060 1347419720 1 l none /usr/local/share/postgresql/timezone/America/Shiprock=/usr/local/share/postgresql/timezone/America/Denver 1 f none /usr/local/share/postgresql/timezone/America/Sitka 0644 root root 2324 20130 1347419720 1 f none /usr/local/share/postgresql/timezone/America/St_Barthelemy 0644 root root 156 8060 1347419720 1 f none /usr/local/share/postgresql/timezone/America/St_Johns 0644 root root 3622 48012 1347419720 1 f none /usr/local/share/postgresql/timezone/America/St_Kitts 0644 root root 156 7400 1347419720 1 f none /usr/local/share/postgresql/timezone/America/St_Lucia 0644 root root 177 10909 1347419720 1 l none /usr/local/share/postgresql/timezone/America/St_Thomas=/usr/local/share/postgresql/timezone/America/Virgin 1 f none /usr/local/share/postgresql/timezone/America/St_Vincent 0644 root root 177 10925 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Swift_Current 0644 root root 560 60208 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Tegucigalpa 0644 root root 264 15502 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Thule 0644 root root 1514 37722 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Thunder_Bay 0644 root root 2185 26584 1347419720 1 l none /usr/local/share/postgresql/timezone/America/Tijuana=/usr/local/share/postgresql/timezone/America/Ensenada 1 f none /usr/local/share/postgresql/timezone/America/Toronto 0644 root root 3477 35777 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Tortola 0644 root root 156 7520 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Vancouver 0644 root root 2875 45893 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Virgin 0644 root root 156 7520 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Whitehorse 0644 root root 2067 11400 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Winnipeg 0644 root root 2865 43735 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Yakutat 0644 root root 2288 18405 1347419720 1 f none /usr/local/share/postgresql/timezone/America/Yellowknife 0644 root root 1966 56841 1347419720 1 d none /usr/local/share/postgresql/timezone/Antarctica 0755 root root 1 f none /usr/local/share/postgresql/timezone/Antarctica/Casey 0644 root root 255 10901 1347419720 1 f none /usr/local/share/postgresql/timezone/Antarctica/Davis 0644 root root 276 13837 1347419720 1 f none /usr/local/share/postgresql/timezone/Antarctica/DumontDUrville 0644 root root 213 10559 1347419720 1 f none /usr/local/share/postgresql/timezone/Antarctica/Macquarie 0644 root root 1549 28221 1347419720 1 f none /usr/local/share/postgresql/timezone/Antarctica/Mawson 0644 root root 190 6045 1347419720 1 l none /usr/local/share/postgresql/timezone/Antarctica/McMurdo=/usr/local/share/postgresql/timezone/Antarctica/South_Pole 1 f none /usr/local/share/postgresql/timezone/Antarctica/Palmer 0644 root root 8780 8000 1347419720 1 f none /usr/local/share/postgresql/timezone/Antarctica/Rothera 0644 root root 159 4676 1347419720 1 f none /usr/local/share/postgresql/timezone/Antarctica/South_Pole 0644 root root 2001 440 1347419720 1 f none /usr/local/share/postgresql/timezone/Antarctica/Syowa 0644 root root 160 4949 1347419720 1 f none /usr/local/share/postgresql/timezone/Antarctica/Vostok 0644 root root 160 5303 1347419720 1 d none /usr/local/share/postgresql/timezone/Arctic 0755 root root 1 f none /usr/local/share/postgresql/timezone/Arctic/Longyearbyen 0644 root root 2225 22171 1347419720 1 d none /usr/local/share/postgresql/timezone/Asia 0755 root root 1 f none /usr/local/share/postgresql/timezone/Asia/Aden 0644 root root 157 4470 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Almaty 0644 root root 922 51675 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Amman 0644 root root 8504 1317 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Anadyr 0644 root root 1167 3739 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Aqtau 0644 root root 1112 60574 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Aqtobe 0644 root root 1038 55520 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Ashgabat 0644 root root 657 32693 1347419720 1 l none /usr/local/share/postgresql/timezone/Asia/Ashkhabad=/usr/local/share/postgresql/timezone/Asia/Ashgabat 1 f none /usr/local/share/postgresql/timezone/Asia/Baghdad 0644 root root 962 49998 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Bahrain 0644 root root 195 6572 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Baku 0644 root root 1942 41162 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Bangkok 0644 root root 178 7056 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Beirut 0644 root root 2149 31718 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Bishkek 0644 root root 1047 56925 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Brunei 0644 root root 187 7515 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Calcutta 0644 root root 265 15172 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Choibalsan 0644 root root 890 48551 1347419720 1 l none /usr/local/share/postgresql/timezone/Asia/Chongqing=/usr/local/share/postgresql/timezone/Asia/Chungking 1 f none /usr/local/share/postgresql/timezone/Asia/Chungking 0644 root root 389 16521 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Colombo 0644 root root 347 17779 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Dacca 0644 root root 364 20219 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Damascus 0644 root root 2306 42956 1347419720 1 l none /usr/local/share/postgresql/timezone/Asia/Dhaka=/usr/local/share/postgresql/timezone/Asia/Dacca 1 f none /usr/local/share/postgresql/timezone/Asia/Dili 0644 root root 277 14380 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Dubai 0644 root root 157 5449 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Dushanbe 0644 root root 597 30470 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Gaza 0644 root root 1562 8330 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Harbin 0644 root root 447 24821 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Hebron 0644 root root 1590 9332 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Ho_Chi_Minh 0644 root root 239 12906 1347419720 1 l none /usr/local/share/postgresql/timezone/Asia/Hong_Kong=/usr/local/share/postgresql/timezone/Hongkong 1 f none /usr/local/share/postgresql/timezone/Asia/Hovd 0644 root root 834 42789 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Irkutsk 0644 root root 1187 1658 1347419720 1 l none /usr/local/share/postgresql/timezone/Asia/Istanbul=/usr/local/share/postgresql/timezone/Europe/Istanbul 1 f none /usr/local/share/postgresql/timezone/Asia/Jakarta 0644 root root 344 23265 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Jayapura 0644 root root 209 11510 1347419720 1 l none /usr/local/share/postgresql/timezone/Asia/Jerusalem=/usr/local/share/postgresql/timezone/Israel 1 f none /usr/local/share/postgresql/timezone/Asia/Kabul 0644 root root 173 6935 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Kamchatka 0644 root root 1151 3578 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Karachi 0644 root root 389 21593 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Kashgar 0644 root root 419 18469 1347419720 1 l none /usr/local/share/postgresql/timezone/Asia/Kathmandu=/usr/local/share/postgresql/timezone/Asia/Katmandu 1 f none /usr/local/share/postgresql/timezone/Asia/Katmandu 0644 root root 198 7371 1347419720 1 l none /usr/local/share/postgresql/timezone/Asia/Kolkata=/usr/local/share/postgresql/timezone/Asia/Calcutta 1 f none /usr/local/share/postgresql/timezone/Asia/Krasnoyarsk 0644 root root 1166 64951 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Kuala_Lumpur 0644 root root 372 22800 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Kuching 0644 root root 505 46305 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Kuwait 0644 root root 157 4980 1347419720 1 l none /usr/local/share/postgresql/timezone/Asia/Macao=/usr/local/share/postgresql/timezone/Asia/Macau 1 f none /usr/local/share/postgresql/timezone/Asia/Macau 0644 root root 781 62419 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Magadan 0644 root root 1167 4334 1347419720 1 l none /usr/local/share/postgresql/timezone/Asia/Makassar=/usr/local/share/postgresql/timezone/Asia/Ujung_Pandang 1 f none /usr/local/share/postgresql/timezone/Asia/Manila 0644 root root 319 23444 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Muscat 0644 root root 157 5449 1347419720 1 l none /usr/local/share/postgresql/timezone/Asia/Nicosia=/usr/local/share/postgresql/timezone/Europe/Nicosia 1 f none /usr/local/share/postgresql/timezone/Asia/Novokuznetsk 0644 root root 1220 1920 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Novosibirsk 0644 root root 1180 2412 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Omsk 0644 root root 1166 1960 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Oral 0644 root root 1086 58276 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Phnom_Penh 0644 root root 239 12906 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Pontianak 0644 root root 359 22984 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Pyongyang 0644 root root 242 16670 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Qatar 0644 root root 195 6572 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Qyzylorda 0644 root root 1068 57571 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Rangoon 0644 root root 259 14324 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Riyadh 0644 root root 157 4980 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Riyadh87 0644 root root 8669 45903 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Riyadh88 0644 root root 8523 42059 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Riyadh89 0644 root root 8523 41415 1347419720 1 l none /usr/local/share/postgresql/timezone/Asia/Saigon=/usr/local/share/postgresql/timezone/Asia/Ho_Chi_Minh 1 f none /usr/local/share/postgresql/timezone/Asia/Sakhalin 0644 root root 1197 3067 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Samarkand 0644 root root 677 34551 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Seoul 0644 root root 380 27686 1347419720 1 l none /usr/local/share/postgresql/timezone/Asia/Shanghai=/usr/local/share/postgresql/timezone/PRC 1 f none /usr/local/share/postgresql/timezone/Asia/Singapore 0644 root root 402 25591 1347419720 1 l none /usr/local/share/postgresql/timezone/Asia/Taipei=/usr/local/share/postgresql/timezone/ROC 1 f none /usr/local/share/postgresql/timezone/Asia/Tashkent 0644 root root 667 33929 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Tbilisi 0644 root root 1100 58787 1347419720 1 l none /usr/local/share/postgresql/timezone/Asia/Tehran=/usr/local/share/postgresql/timezone/Iran 1 l none /usr/local/share/postgresql/timezone/Asia/Tel_Aviv=/usr/local/share/postgresql/timezone/Israel 1 f none /usr/local/share/postgresql/timezone/Asia/Thimbu 0644 root root 195 6525 1347419720 1 l none /usr/local/share/postgresql/timezone/Asia/Thimphu=/usr/local/share/postgresql/timezone/Asia/Thimbu 1 l none /usr/local/share/postgresql/timezone/Asia/Tokyo=/usr/local/share/postgresql/timezone/Japan 1 f none /usr/local/share/postgresql/timezone/Asia/Ujung_Pandang 0644 root root 247 14413 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Ulaanbaatar 0644 root root 834 44805 1347419720 1 l none /usr/local/share/postgresql/timezone/Asia/Ulan_Bator=/usr/local/share/postgresql/timezone/Asia/Ulaanbaatar 1 f none /usr/local/share/postgresql/timezone/Asia/Urumqi 0644 root root 389 16049 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Vientiane 0644 root root 239 12906 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Vladivostok 0644 root root 1181 62618 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Yakutsk 0644 root root 1167 63467 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Yekaterinburg 0644 root root 1252 5653 1347419720 1 f none /usr/local/share/postgresql/timezone/Asia/Yerevan 0644 root root 1263 5768 1347419720 1 d none /usr/local/share/postgresql/timezone/Atlantic 0755 root root 1 f none /usr/local/share/postgresql/timezone/Atlantic/Azores 0644 root root 3462 11487 1347419720 1 f none /usr/local/share/postgresql/timezone/Atlantic/Bermuda 0644 root root 1990 1965 1347419720 1 f none /usr/local/share/postgresql/timezone/Atlantic/Canary 0644 root root 1899 45340 1347419720 1 f none /usr/local/share/postgresql/timezone/Atlantic/Cape_Verde 0644 root root 240 17456 1347419720 1 l none /usr/local/share/postgresql/timezone/Atlantic/Faeroe=/usr/local/share/postgresql/timezone/Atlantic/Faroe 1 f none /usr/local/share/postgresql/timezone/Atlantic/Faroe 0644 root root 1815 38838 1347419720 1 l none /usr/local/share/postgresql/timezone/Atlantic/Jan_Mayen=/usr/local/share/postgresql/timezone/Arctic/Longyearbyen 1 f none /usr/local/share/postgresql/timezone/Atlantic/Madeira 0644 root root 3452 1316 1347419720 1 f none /usr/local/share/postgresql/timezone/Atlantic/Reykjavik 0644 root root 1141 18180 1347419720 1 f none /usr/local/share/postgresql/timezone/Atlantic/South_Georgia 0644 root root 139 6459 1347419720 1 f none /usr/local/share/postgresql/timezone/Atlantic/St_Helena 0644 root root 177 8952 1347419720 1 f none /usr/local/share/postgresql/timezone/Atlantic/Stanley 0644 root root 1204 27019 1347419720 1 d none /usr/local/share/postgresql/timezone/Australia 0755 root root 1 l none /usr/local/share/postgresql/timezone/Australia/ACT=/usr/local/share/postgresql/timezone/Australia/NSW 1 f none /usr/local/share/postgresql/timezone/Australia/Adelaide 0644 root root 2202 956 1347419720 1 f none /usr/local/share/postgresql/timezone/Australia/Brisbane 0644 root root 413 28218 1347419720 1 f none /usr/local/share/postgresql/timezone/Australia/Broken_Hill 0644 root root 2237 5034 1347419720 1 l none /usr/local/share/postgresql/timezone/Australia/Canberra=/usr/local/share/postgresql/timezone/Australia/NSW 1 f none /usr/local/share/postgresql/timezone/Australia/Currie 0644 root root 2183 62119 1347419720 1 l none /usr/local/share/postgresql/timezone/Australia/Darwin=/usr/local/share/postgresql/timezone/Australia/North 1 f none /usr/local/share/postgresql/timezone/Australia/Eucla 0644 root root 446 25452 1347419720 1 f none /usr/local/share/postgresql/timezone/Australia/Hobart 0644 root root 2295 8958 1347419720 1 l none /usr/local/share/postgresql/timezone/Australia/LHI=/usr/local/share/postgresql/timezone/Australia/Lord_Howe 1 f none /usr/local/share/postgresql/timezone/Australia/Lindeman 0644 root root 483 33220 1347419720 1 f none /usr/local/share/postgresql/timezone/Australia/Lord_Howe 0644 root root 1821 59909 1347419720 1 l none /usr/local/share/postgresql/timezone/Australia/Melbourne=/usr/local/share/postgresql/timezone/Australia/Victoria 1 f none /usr/local/share/postgresql/timezone/Australia/NSW 0644 root root 2183 64415 1347419720 1 f none /usr/local/share/postgresql/timezone/Australia/North 0644 root root 288 23683 1347419720 1 l none /usr/local/share/postgresql/timezone/Australia/Perth=/usr/local/share/postgresql/timezone/Australia/West 1 l none /usr/local/share/postgresql/timezone/Australia/Queensland=/usr/local/share/postgresql/timezone/Australia/Brisbane 1 l none /usr/local/share/postgresql/timezone/Australia/South=/usr/local/share/postgresql/timezone/Australia/Adelaide 1 l none /usr/local/share/postgresql/timezone/Australia/Sydney=/usr/local/share/postgresql/timezone/Australia/NSW 1 l none /usr/local/share/postgresql/timezone/Australia/Tasmania=/usr/local/share/postgresql/timezone/Australia/Hobart 1 f none /usr/local/share/postgresql/timezone/Australia/Victoria 0644 root root 2183 63395 1347419720 1 f none /usr/local/share/postgresql/timezone/Australia/West 0644 root root 440 28776 1347419720 1 l none /usr/local/share/postgresql/timezone/Australia/Yancowinna=/usr/local/share/postgresql/timezone/Australia/Broken_Hill 1 d none /usr/local/share/postgresql/timezone/Brazil 0755 root root 1 l none /usr/local/share/postgresql/timezone/Brazil/Acre=/usr/local/share/postgresql/timezone/America/Rio_Branco 1 l none /usr/local/share/postgresql/timezone/Brazil/DeNoronha=/usr/local/share/postgresql/timezone/America/Noronha 1 l none /usr/local/share/postgresql/timezone/Brazil/East=/usr/local/share/postgresql/timezone/America/Sao_Paulo 1 l none /usr/local/share/postgresql/timezone/Brazil/West=/usr/local/share/postgresql/timezone/America/Manaus 1 f none /usr/local/share/postgresql/timezone/CET 0644 root root 2102 3261 1347419720 1 f none /usr/local/share/postgresql/timezone/CST6CDT 0644 root root 2294 30587 1347419720 1 d none /usr/local/share/postgresql/timezone/Canada 0755 root root 1 l none /usr/local/share/postgresql/timezone/Canada/Atlantic=/usr/local/share/postgresql/timezone/America/Halifax 1 l none /usr/local/share/postgresql/timezone/Canada/Central=/usr/local/share/postgresql/timezone/America/Winnipeg 1 l none /usr/local/share/postgresql/timezone/Canada/East-Saskatchewan=/usr/local/share/postgresql/timezone/America/Regina 1 l none /usr/local/share/postgresql/timezone/Canada/Eastern=/usr/local/share/postgresql/timezone/America/Toronto 1 l none /usr/local/share/postgresql/timezone/Canada/Mountain=/usr/local/share/postgresql/timezone/America/Edmonton 1 l none /usr/local/share/postgresql/timezone/Canada/Newfoundland=/usr/local/share/postgresql/timezone/America/St_Johns 1 l none /usr/local/share/postgresql/timezone/Canada/Pacific=/usr/local/share/postgresql/timezone/America/Vancouver 1 l none /usr/local/share/postgresql/timezone/Canada/Saskatchewan=/usr/local/share/postgresql/timezone/America/Regina 1 l none /usr/local/share/postgresql/timezone/Canada/Yukon=/usr/local/share/postgresql/timezone/America/Whitehorse 1 d none /usr/local/share/postgresql/timezone/Chile 0755 root root 1 l none /usr/local/share/postgresql/timezone/Chile/Continental=/usr/local/share/postgresql/timezone/America/Santiago 1 l none /usr/local/share/postgresql/timezone/Chile/EasterIsland=/usr/local/share/postgresql/timezone/Pacific/Easter 1 l none /usr/local/share/postgresql/timezone/Cuba=/usr/local/share/postgresql/timezone/America/Havana 1 f none /usr/local/share/postgresql/timezone/EET 0644 root root 1876 39332 1347419720 1 f none /usr/local/share/postgresql/timezone/EST 0644 root root 118 3399 1347419720 1 f none /usr/local/share/postgresql/timezone/EST5EDT 0644 root root 2294 44916 1347419720 1 l none /usr/local/share/postgresql/timezone/Egypt=/usr/local/share/postgresql/timezone/Africa/Cairo 1 l none /usr/local/share/postgresql/timezone/Eire=/usr/local/share/postgresql/timezone/Europe/Dublin 1 d none /usr/local/share/postgresql/timezone/Etc 0755 root root 1 l none /usr/local/share/postgresql/timezone/Etc/GMT=/usr/local/share/postgresql/timezone/Etc/GMT0 1 l none /usr/local/share/postgresql/timezone/Etc/GMT+0=/usr/local/share/postgresql/timezone/Etc/GMT0 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+1 0644 root root 126 4025 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+10 0644 root root 130 3679 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+11 0644 root root 130 3623 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+12 0644 root root 130 3567 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+2 0644 root root 126 3969 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+3 0644 root root 126 3913 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+4 0644 root root 126 3857 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+5 0644 root root 126 3801 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+6 0644 root root 126 3745 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+7 0644 root root 126 3689 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+8 0644 root root 126 3633 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+9 0644 root root 126 3577 1347419720 1 l none /usr/local/share/postgresql/timezone/Etc/GMT-0=/usr/local/share/postgresql/timezone/Etc/GMT0 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-1 0644 root root 127 2154 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-10 0644 root root 131 2888 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-11 0644 root root 131 2952 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-12 0644 root root 131 3016 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-13 0644 root root 131 3080 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-14 0644 root root 131 3144 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-2 0644 root root 127 2218 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-3 0644 root root 127 2282 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-4 0644 root root 127 2346 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-5 0644 root root 127 2410 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-6 0644 root root 127 2474 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-7 0644 root root 127 2538 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-8 0644 root root 127 2602 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-9 0644 root root 127 2666 1347419720 1 f none /usr/local/share/postgresql/timezone/Etc/GMT0 0644 root root 118 1640 1347419720 1 l none /usr/local/share/postgresql/timezone/Etc/Greenwich=/usr/local/share/postgresql/timezone/Etc/GMT0 1 f none /usr/local/share/postgresql/timezone/Etc/UCT 0644 root root 118 1652 1347419720 1 l none /usr/local/share/postgresql/timezone/Etc/UTC=/usr/local/share/postgresql/timezone/UTC 1 l none /usr/local/share/postgresql/timezone/Etc/Universal=/usr/local/share/postgresql/timezone/UTC 1 l none /usr/local/share/postgresql/timezone/Etc/Zulu=/usr/local/share/postgresql/timezone/UTC 1 d none /usr/local/share/postgresql/timezone/Europe 0755 root root 1 f none /usr/local/share/postgresql/timezone/Europe/Amsterdam 0644 root root 2917 37182 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Andorra 0644 root root 1725 31329 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Athens 0644 root root 2245 8903 1347419720 1 l none /usr/local/share/postgresql/timezone/Europe/Belfast=/usr/local/share/postgresql/timezone/Europe/Guernsey 1 l none /usr/local/share/postgresql/timezone/Europe/Belgrade=/usr/local/share/postgresql/timezone/Europe/Podgorica 1 f none /usr/local/share/postgresql/timezone/Europe/Berlin 0644 root root 2309 31972 1347419720 1 l none /usr/local/share/postgresql/timezone/Europe/Bratislava=/usr/local/share/postgresql/timezone/Europe/Prague 1 f none /usr/local/share/postgresql/timezone/Europe/Brussels 0644 root root 2944 49652 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Bucharest 0644 root root 2195 15951 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Budapest 0644 root root 2407 54508 1347419720 1 l none /usr/local/share/postgresql/timezone/Europe/Chisinau=/usr/local/share/postgresql/timezone/Europe/Tiraspol 1 f none /usr/local/share/postgresql/timezone/Europe/Copenhagen 0644 root root 2134 9516 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Dublin 0644 root root 3533 62255 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Gibraltar 0644 root root 3035 21375 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Guernsey 0644 root root 3661 21636 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Helsinki 0644 root root 1883 44323 1347419720 1 l none /usr/local/share/postgresql/timezone/Europe/Isle_of_Man=/usr/local/share/postgresql/timezone/Europe/Guernsey 1 f none /usr/local/share/postgresql/timezone/Europe/Istanbul 0644 root root 2721 11692 1347419720 1 l none /usr/local/share/postgresql/timezone/Europe/Jersey=/usr/local/share/postgresql/timezone/Europe/Guernsey 1 f none /usr/local/share/postgresql/timezone/Europe/Kaliningrad 0644 root root 1494 30053 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Kiev 0644 root root 2057 60272 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Lisbon 0644 root root 3439 3130 1347419720 1 l none /usr/local/share/postgresql/timezone/Europe/Ljubljana=/usr/local/share/postgresql/timezone/Europe/Podgorica 1 l none /usr/local/share/postgresql/timezone/Europe/London=/usr/local/share/postgresql/timezone/Europe/Guernsey 1 f none /usr/local/share/postgresql/timezone/Europe/Luxembourg 0644 root root 2960 43302 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Madrid 0644 root root 2593 362 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Malta 0644 root root 2603 61829 1347419720 1 l none /usr/local/share/postgresql/timezone/Europe/Mariehamn=/usr/local/share/postgresql/timezone/Europe/Helsinki 1 f none /usr/local/share/postgresql/timezone/Europe/Minsk 0644 root root 1328 11431 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Monaco 0644 root root 2927 49386 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Moscow 0644 root root 1448 32492 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Nicosia 0644 root root 2002 52702 1347419720 1 l none /usr/local/share/postgresql/timezone/Europe/Oslo=/usr/local/share/postgresql/timezone/Arctic/Longyearbyen 1 f none /usr/local/share/postgresql/timezone/Europe/Paris 0644 root root 2945 47644 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Podgorica 0644 root root 1931 52265 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Prague 0644 root root 2246 22587 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Riga 0644 root root 2209 9765 1347419720 1 l none /usr/local/share/postgresql/timezone/Europe/Rome=/usr/local/share/postgresql/timezone/Europe/Vatican 1 f none /usr/local/share/postgresql/timezone/Europe/Samara 0644 root root 1314 6977 1347419720 1 l none /usr/local/share/postgresql/timezone/Europe/San_Marino=/usr/local/share/postgresql/timezone/Europe/Vatican 1 l none /usr/local/share/postgresql/timezone/Europe/Sarajevo=/usr/local/share/postgresql/timezone/Europe/Podgorica 1 f none /usr/local/share/postgresql/timezone/Europe/Simferopol 0644 root root 2113 64622 1347419720 1 l none /usr/local/share/postgresql/timezone/Europe/Skopje=/usr/local/share/postgresql/timezone/Europe/Podgorica 1 f none /usr/local/share/postgresql/timezone/Europe/Sofia 0644 root root 2104 59048 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Stockholm 0644 root root 1892 44662 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Tallinn 0644 root root 2175 4402 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Tirane 0644 root root 2084 58136 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Tiraspol 0644 root root 2407 39520 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Uzhgorod 0644 root root 2077 63323 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Vaduz 0644 root root 1799 36441 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Vatican 0644 root root 2652 3498 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Vienna 0644 root root 2211 22045 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Vilnius 0644 root root 2173 2489 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Volgograd 0644 root root 1218 8567 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Warsaw 0644 root root 2679 6024 1347419720 1 l none /usr/local/share/postgresql/timezone/Europe/Zagreb=/usr/local/share/postgresql/timezone/Europe/Podgorica 1 f none /usr/local/share/postgresql/timezone/Europe/Zaporozhye 0644 root root 2085 62452 1347419720 1 f none /usr/local/share/postgresql/timezone/Europe/Zurich 0644 root root 1892 46454 1347419720 1 f none /usr/local/share/postgresql/timezone/Factory 0644 root root 255 14338 1347419720 1 l none /usr/local/share/postgresql/timezone/GB=/usr/local/share/postgresql/timezone/Europe/Guernsey 1 l none /usr/local/share/postgresql/timezone/GB-Eire=/usr/local/share/postgresql/timezone/Europe/Guernsey 1 l none /usr/local/share/postgresql/timezone/GMT=/usr/local/share/postgresql/timezone/Etc/GMT0 1 l none /usr/local/share/postgresql/timezone/GMT+0=/usr/local/share/postgresql/timezone/Etc/GMT0 1 l none /usr/local/share/postgresql/timezone/GMT-0=/usr/local/share/postgresql/timezone/Etc/GMT0 1 l none /usr/local/share/postgresql/timezone/GMT0=/usr/local/share/postgresql/timezone/Etc/GMT0 1 l none /usr/local/share/postgresql/timezone/Greenwich=/usr/local/share/postgresql/timezone/Etc/GMT0 1 f none /usr/local/share/postgresql/timezone/HST 0644 root root 119 3152 1347419720 1 f none /usr/local/share/postgresql/timezone/Hongkong 0644 root root 1159 3228 1347419720 1 l none /usr/local/share/postgresql/timezone/Iceland=/usr/local/share/postgresql/timezone/Atlantic/Reykjavik 1 d none /usr/local/share/postgresql/timezone/Indian 0755 root root 1 f none /usr/local/share/postgresql/timezone/Indian/Antananarivo 0644 root root 227 11130 1347419720 1 f none /usr/local/share/postgresql/timezone/Indian/Chagos 0644 root root 187 7175 1347419720 1 f none /usr/local/share/postgresql/timezone/Indian/Christmas 0644 root root 140 4064 1347419720 1 f none /usr/local/share/postgresql/timezone/Indian/Cocos 0644 root root 143 4187 1347419720 1 f none /usr/local/share/postgresql/timezone/Indian/Comoro 0644 root root 157 5388 1347419720 1 f none /usr/local/share/postgresql/timezone/Indian/Kerguelen 0644 root root 157 4868 1347419720 1 f none /usr/local/share/postgresql/timezone/Indian/Mahe 0644 root root 157 5257 1347419720 1 f none /usr/local/share/postgresql/timezone/Indian/Maldives 0644 root root 178 7445 1347419720 1 f none /usr/local/share/postgresql/timezone/Indian/Mauritius 0644 root root 239 9549 1347419720 1 f none /usr/local/share/postgresql/timezone/Indian/Mayotte 0644 root root 157 4878 1347419720 1 f none /usr/local/share/postgresql/timezone/Indian/Reunion 0644 root root 157 4630 1347419720 1 f none /usr/local/share/postgresql/timezone/Iran 0644 root root 1622 35051 1347419720 1 f none /usr/local/share/postgresql/timezone/Israel 0644 root root 2197 52191 1347419720 1 l none /usr/local/share/postgresql/timezone/Jamaica=/usr/local/share/postgresql/timezone/America/Jamaica 1 f none /usr/local/share/postgresql/timezone/Japan 0644 root root 331 28605 1347419720 1 f none /usr/local/share/postgresql/timezone/Kwajalein 0644 root root 211 10091 1347419720 1 l none /usr/local/share/postgresql/timezone/Libya=/usr/local/share/postgresql/timezone/Africa/Tripoli 1 f none /usr/local/share/postgresql/timezone/MET 0644 root root 2102 3321 1347419720 1 f none /usr/local/share/postgresql/timezone/MST 0644 root root 118 3305 1347419720 1 f none /usr/local/share/postgresql/timezone/MST7MDT 0644 root root 2294 17398 1347419720 1 d none /usr/local/share/postgresql/timezone/Mexico 0755 root root 1 l none /usr/local/share/postgresql/timezone/Mexico/BajaNorte=/usr/local/share/postgresql/timezone/America/Ensenada 1 l none /usr/local/share/postgresql/timezone/Mexico/BajaSur=/usr/local/share/postgresql/timezone/America/Mazatlan 1 l none /usr/local/share/postgresql/timezone/Mexico/General=/usr/local/share/postgresql/timezone/America/Mexico_City 1 d none /usr/local/share/postgresql/timezone/Mideast 0755 root root 1 l none /usr/local/share/postgresql/timezone/Mideast/Riyadh87=/usr/local/share/postgresql/timezone/Asia/Riyadh87 1 l none /usr/local/share/postgresql/timezone/Mideast/Riyadh88=/usr/local/share/postgresql/timezone/Asia/Riyadh88 1 l none /usr/local/share/postgresql/timezone/Mideast/Riyadh89=/usr/local/share/postgresql/timezone/Asia/Riyadh89 1 f none /usr/local/share/postgresql/timezone/NZ 0644 root root 2434 2200 1347419720 1 f none /usr/local/share/postgresql/timezone/NZ-CHAT 0644 root root 2018 1082 1347419720 1 l none /usr/local/share/postgresql/timezone/Navajo=/usr/local/share/postgresql/timezone/America/Denver 1 f none /usr/local/share/postgresql/timezone/PRC 0644 root root 405 23461 1347419720 1 f none /usr/local/share/postgresql/timezone/PST8PDT 0644 root root 2294 21479 1347419720 1 d none /usr/local/share/postgresql/timezone/Pacific 0755 root root 1 f none /usr/local/share/postgresql/timezone/Pacific/Apia 0644 root root 343 21401 1347419720 1 l none /usr/local/share/postgresql/timezone/Pacific/Auckland=/usr/local/share/postgresql/timezone/NZ 1 l none /usr/local/share/postgresql/timezone/Pacific/Chatham=/usr/local/share/postgresql/timezone/NZ-CHAT 1 l none /usr/local/share/postgresql/timezone/Pacific/Chuuk=/usr/local/share/postgresql/timezone/Pacific/Yap 1 f none /usr/local/share/postgresql/timezone/Pacific/Easter 0644 root root 9007 15424 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Efate 0644 root root 464 25170 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Enderbury 0644 root root 204 8981 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Fakaofo 0644 root root 171 7664 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Fiji 0644 root root 324 16016 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Funafuti 0644 root root 141 4408 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Galapagos 0644 root root 197 10384 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Gambier 0644 root root 159 7002 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Guadalcanal 0644 root root 158 5540 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Guam 0644 root root 199 8566 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Honolulu 0644 root root 250 18837 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Johnston 0644 root root 119 3152 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Kiritimati 0644 root root 204 9030 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Kosrae 0644 root root 188 8020 1347419720 1 l none /usr/local/share/postgresql/timezone/Pacific/Kwajalein=/usr/local/share/postgresql/timezone/Kwajalein 1 f none /usr/local/share/postgresql/timezone/Pacific/Majuro 0644 root root 171 7032 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Marquesas 0644 root root 162 7162 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Midway 0644 root root 268 18659 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Nauru 0644 root root 240 12212 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Niue 0644 root root 200 11102 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Norfolk 0644 root root 182 7889 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Noumea 0644 root root 300 13682 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Pago_Pago 0644 root root 290 19545 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Palau 0644 root root 140 4177 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Pitcairn 0644 root root 177 8089 1347419720 1 l none /usr/local/share/postgresql/timezone/Pacific/Pohnpei=/usr/local/share/postgresql/timezone/Pacific/Ponape 1 f none /usr/local/share/postgresql/timezone/Pacific/Ponape 0644 root root 144 4550 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Port_Moresby 0644 root root 163 6758 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Rarotonga 0644 root root 548 28554 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Saipan 0644 root root 229 11262 1347419720 1 l none /usr/local/share/postgresql/timezone/Pacific/Samoa=/usr/local/share/postgresql/timezone/Pacific/Pago_Pago 1 f none /usr/local/share/postgresql/timezone/Pacific/Tahiti 0644 root root 160 7516 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Tarawa 0644 root root 144 4560 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Tongatapu 0644 root root 313 15767 1347419720 1 l none /usr/local/share/postgresql/timezone/Pacific/Truk=/usr/local/share/postgresql/timezone/Pacific/Yap 1 f none /usr/local/share/postgresql/timezone/Pacific/Wake 0644 root root 144 4581 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Wallis 0644 root root 141 4369 1347419720 1 f none /usr/local/share/postgresql/timezone/Pacific/Yap 0644 root root 144 4450 1347419720 1 l none /usr/local/share/postgresql/timezone/Poland=/usr/local/share/postgresql/timezone/Europe/Warsaw 1 l none /usr/local/share/postgresql/timezone/Portugal=/usr/local/share/postgresql/timezone/Europe/Lisbon 1 f none /usr/local/share/postgresql/timezone/ROC 0644 root root 724 21200 1347419720 1 l none /usr/local/share/postgresql/timezone/ROK=/usr/local/share/postgresql/timezone/Asia/Seoul 1 l none /usr/local/share/postgresql/timezone/Singapore=/usr/local/share/postgresql/timezone/Asia/Singapore 1 l none /usr/local/share/postgresql/timezone/Turkey=/usr/local/share/postgresql/timezone/Europe/Istanbul 1 l none /usr/local/share/postgresql/timezone/UCT=/usr/local/share/postgresql/timezone/Etc/UCT 1 d none /usr/local/share/postgresql/timezone/US 0755 root root 1 l none /usr/local/share/postgresql/timezone/US/Alaska=/usr/local/share/postgresql/timezone/America/Anchorage 1 l none /usr/local/share/postgresql/timezone/US/Aleutian=/usr/local/share/postgresql/timezone/America/Atka 1 l none /usr/local/share/postgresql/timezone/US/Arizona=/usr/local/share/postgresql/timezone/America/Phoenix 1 l none /usr/local/share/postgresql/timezone/US/Central=/usr/local/share/postgresql/timezone/America/Chicago 1 l none /usr/local/share/postgresql/timezone/US/East-Indiana=/usr/local/share/postgresql/timezone/America/Indianapolis 1 l none /usr/local/share/postgresql/timezone/US/Eastern=/usr/local/share/postgresql/timezone/America/New_York 1 l none /usr/local/share/postgresql/timezone/US/Hawaii=/usr/local/share/postgresql/timezone/Pacific/Honolulu 1 l none /usr/local/share/postgresql/timezone/US/Indiana-Starke=/usr/local/share/postgresql/timezone/America/Knox_IN 1 l none /usr/local/share/postgresql/timezone/US/Michigan=/usr/local/share/postgresql/timezone/America/Detroit 1 l none /usr/local/share/postgresql/timezone/US/Mountain=/usr/local/share/postgresql/timezone/America/Denver 1 l none /usr/local/share/postgresql/timezone/US/Pacific=/usr/local/share/postgresql/timezone/America/Los_Angeles 1 l none /usr/local/share/postgresql/timezone/US/Pacific-New=/usr/local/share/postgresql/timezone/America/Los_Angeles 1 l none /usr/local/share/postgresql/timezone/US/Samoa=/usr/local/share/postgresql/timezone/Pacific/Pago_Pago 1 f none /usr/local/share/postgresql/timezone/UTC 0644 root root 118 1652 1347419720 1 l none /usr/local/share/postgresql/timezone/Universal=/usr/local/share/postgresql/timezone/UTC 1 l none /usr/local/share/postgresql/timezone/W-SU=/usr/local/share/postgresql/timezone/Europe/Moscow 1 f none /usr/local/share/postgresql/timezone/WET 0644 root root 1873 39052 1347419720 1 l none /usr/local/share/postgresql/timezone/Zulu=/usr/local/share/postgresql/timezone/UTC 1 l none /usr/local/share/postgresql/timezone/posixrules=/usr/local/share/postgresql/timezone/America/New_York 1 d none /usr/local/share/postgresql/timezonesets 0755 root root 1 f none /usr/local/share/postgresql/timezonesets/Africa.txt 0644 root root 6973 6439 1347419720 1 f none /usr/local/share/postgresql/timezonesets/America.txt 0644 root root 12717 22411 1347419720 1 f none /usr/local/share/postgresql/timezonesets/Antarctica.txt 0644 root root 1478 34571 1347419720 1 f none /usr/local/share/postgresql/timezonesets/Asia.txt 0644 root root 9509 5304 1347419720 1 f none /usr/local/share/postgresql/timezonesets/Atlantic.txt 0644 root root 3774 43117 1347419720 1 f none /usr/local/share/postgresql/timezonesets/Australia 0644 root root 1404 38525 1347419720 1 f none /usr/local/share/postgresql/timezonesets/Australia.txt 0644 root root 2782 9096 1347419720 1 f none /usr/local/share/postgresql/timezonesets/Default 0644 root root 29620 49534 1347419720 1 f none /usr/local/share/postgresql/timezonesets/Etc.txt 0644 root root 1241 12088 1347419720 1 f none /usr/local/share/postgresql/timezonesets/Europe.txt 0644 root root 8301 24059 1347419720 1 f none /usr/local/share/postgresql/timezonesets/India 0644 root root 593 50003 1347419720 1 f none /usr/local/share/postgresql/timezonesets/Indian.txt 0644 root root 1566 37344 1347419720 1 f none /usr/local/share/postgresql/timezonesets/Pacific.txt 0644 root root 4150 8407 1347419720 1 d none /usr/local/share/postgresql/tsearch_data 0755 root root 1 f none /usr/local/share/postgresql/tsearch_data/danish.stop 0644 root root 424 37100 1347419723 1 f none /usr/local/share/postgresql/tsearch_data/dutch.stop 0644 root root 453 38763 1347419723 1 f none /usr/local/share/postgresql/tsearch_data/english.stop 0644 root root 622 54931 1347419723 1 f none /usr/local/share/postgresql/tsearch_data/finnish.stop 0644 root root 1579 33237 1347419723 1 f none /usr/local/share/postgresql/tsearch_data/french.stop 0644 root root 805 10912 1347419723 1 f none /usr/local/share/postgresql/tsearch_data/german.stop 0644 root root 1349 57331 1347419723 1 f none /usr/local/share/postgresql/tsearch_data/hungarian.stop 0644 root root 1227 57949 1347419723 1 f none /usr/local/share/postgresql/tsearch_data/hunspell_sample.affix 0644 root root 244 13989 1347419721 1 f none /usr/local/share/postgresql/tsearch_data/ispell_sample.affix 0644 root root 465 31429 1347419721 1 f none /usr/local/share/postgresql/tsearch_data/ispell_sample.dict 0644 root root 81 7108 1347419721 1 f none /usr/local/share/postgresql/tsearch_data/italian.stop 0644 root root 1654 20806 1347419723 1 f none /usr/local/share/postgresql/tsearch_data/norwegian.stop 0644 root root 851 11364 1347419723 1 f none /usr/local/share/postgresql/tsearch_data/portuguese.stop 0644 root root 1267 57350 1347419723 1 f none /usr/local/share/postgresql/tsearch_data/russian.stop 0644 root root 1235 9585 1347419723 1 f none /usr/local/share/postgresql/tsearch_data/spanish.stop 0644 root root 2178 21152 1347419723 1 f none /usr/local/share/postgresql/tsearch_data/swedish.stop 0644 root root 559 52354 1347419723 1 f none /usr/local/share/postgresql/tsearch_data/synonym_sample.syn 0644 root root 73 6890 1347419721 1 f none /usr/local/share/postgresql/tsearch_data/thesaurus_sample.ths 0644 root root 473 41646 1347419721 1 f none /usr/local/share/postgresql/tsearch_data/turkish.stop 0644 root root 260 25287 1347419723 1 f none /usr/local/share/postgresql/tsearch_data/unaccent.rules 0644 root root 937 22169 1347419728 1 f none /usr/local/share/postgresql/tsearch_data/xsyn_sample.rules 0644 root root 139 12006 1347419726 1 f none /usr/local/share/postgresql/unknown.pltcl 0644 root root 2406 25686 1347419725 1 i checkinstall 790 2504 1347428573 1 i pkginfo 301 24275 1347428573 0707010008a208000041ed000000000000000000000002505020de00000000000000b500010002ffffffffffffffff0000000800000000install0707010008a209000081ed000000000000000000000001505020dd00000316000000b500010002ffffffffffffffff0000001500000000install/checkinstall#!/bin/sh # expected_bits="64" expected_release="5.10" expected_platform="i386" # release=`uname -r` platform=`uname -p` bits=`isainfo -b` # if [ ${platform} != ${expected_platform} ]; then echo "\n\n\n\tThis package must be installed on a ${expected_platform} architecture\n" echo "\tAborting installation.\n\n\n" exit 1 fi if [ ${release} != ${expected_release} ]; then echo "\n\n\n\tThis package must be installed on a ${expected_release} machine\n" echo "\tAborting installation.\n\n\n" exit 1 fi #if [ ${bits} != ${expected_bits} ]; then # echo "\n\n\n\tThis package must be installed on a ${expected_bits} bit machine\n" # echo "\tYour machine is running a ${bits} bit O.S. currently\n" # echo "\tAborting installation.\n\n\n" # exit 1 #fi exit 0 070701000894c2000041ed000000000000000000000003505020dd00000000000000b500010002ffffffffffffffff0000000500000000root070701000894c3000041ed000000000000000000000003505020dd00000000000000b500010002ffffffffffffffff0000000900000000root/usr070701000894c4000041ed000000000000000000000006505020de00000000000000b500010002ffffffffffffffff0000000f00000000root/usr/local070701000894c5000041ed000000000000000000000002505020dd00000000000000b500010002ffffffffffffffff0000001300000000root/usr/local/bin070701000894ea000081ed000000000000000000000001504ffe5000009b70000000b500010002ffffffffffffffff0000001c00000000root/usr/local/bin/vacuumloELFp44 (44o@@@@pDPAPAP/usr/lib/ld.so.1ef  "#$&'*+-023458:<?@ADEGIJKLNOPTWXZ\]_acde !%(),./1679;=>BCFHMQRSUVY[^`bB# -4B!<T"T0 elFq$B.4@1 0 TF2 *d1;dB4*  V{ \01 iT*  05) B!.N 1p T( -( d$FP.V )<+ ;FBIp1 VTa5 gP0 tB|0 T Dp0 BPAt*  D* 25d?4OUt]d\50 o 3B,* @42t * D- t/F6?$F00 U_5 ep PtlP1 zBD0 _edataPQfinishstrtoulmainPQresultStatusfputs_environ_get_exit_frame_monitorget_pkglib_pathfprintf_endPQconnectionNeedsPasswordfopen64strtol__iob_GLOBAL_OFFSET_TABLE___fsr_init_valueget_locale_pathPQsetdbLoginget_pkginclude_pathstrlcpymallocatexitoptargget_parent_directorystrlenPQfreememstrcpyfirst_dir_separator__fsrget_doc_pathfirst_path_var_separatorpqStrerrorpath_is_prefix_of_pathabortPQerrorMessageget_home_pathgetoptstrstrtcsetattrpath_is_relative_and_below_cwd__fpstartfgetsopterrfflushget_prognamecanonicalize_pathoptoptstrdupget_man_pathPQgetvalue_initget_etc_path___Argvget_includeserver_path_PROCEDURE_LINKAGE_TABLE_PQclear__posix_getpwuid_rfclosegeteuidget_include_path__environ_lock_DYNAMIClast_dir_separatorPQntuplesjoin_path_components_lib_versionPQserverVersion_exitstrncmpstrcmppqGetpwuid__1cG__CrunMdo_exit_code6F_v_PQtransactionStatussnprintfhas_drive_prefixfileno_etexttcgetattrstrerror_rsimple_promptmake_native_pathpath_contains_parent_referencePQescapeIdentifieroptindPQstatusstrcatget_share_pathlo_unlink_fini_startget_html_pathPQexec__longdouble_usedstrchrget_lib_pathlibc.so.1SUNW_1.22SUNWprivate_1.1libpq.so.5libxslt.so.1libxml2.so.2libpam.so.1libssl.so.0.9.8libcrypto.so.0.9.8libkrb5.so.3libcom_err.so.3libgssapi_krb5.so.2libz.solibreadline.so.6libcurses.so.1libnsl.so.1librt.so.1libsocket.so.1libm.so.2/usr/local/lib:/usr/local/libyqN BLBFFYF2F.@,@`@@H@@Z@ @@F@b@@;@[@G@C@5@@X@O@@@/@&@]@N@ @J@3AAAd AAAIA)A% A>$A(A ,A=0AQ4AS8A*B5B3ujjss E8 Vue VtU=BuL{tF V jjdh>BP3Wjjss Z u  VM' ] {t0uh0>CVR{th>V;h=5V:p V5ƅh=P')=_}h@=Php=PPV Vh =PPEVJ VEh<P5h<P!h\<P h<<Ph<Ph;Ph;Ph;Ph;PPPVU V3jV` jVMjV3xt WVh\;hC W PWS  PSV PVSWQPh;hPPS Pu aWXJF ;v6hL;hCWyS0 VZh:'S, S'ƅh:PP P_ 3ۅDž,u 3jW j jP~t/Ph:hC6hC~(CNÅx;| …h\: P h: P G;Dž kh\:V=WB W=Vu ~t^~uBu! Suh9hC .uSh9hCuSh:hC~uu!3uht>hCk,_^[à Wh:hC9S Ph=hC?1S닃P|Chd:hC Ph=hC_h:hCb4 Ph=hCAcUh<:hC Ph=hC=DžBh<:CS~VU Ph=SfWVDh:CS4 Ph=S9h:CV Ph=VS7ht;CSY Ph=SjVCh<CS3 Ph=SV=h =CS Ph=SV;h=CS] Ph=SnVG PuhL>hC&UuhP9uh,9h 9h8h8h\8h$8h7h7h7h|7hP7sh$7fh6Yh6LE6E8:t.=Ft5Fh>hC?:E FFB>A FFF=F-tEB8uBF=Ft#E8:t5Fh>hC?9B>(BFB>B>[U3ÐUEt/t @u3UEt:t @u3UU 3t/uB uUÐUSVW ]ME ;thPQ.u{/u.u{/ttJE 8uL@P@ u^uQSWhT@+QuVV ] _^[USVW(u7]˅t,3/u t C/t;t/CAuuu3ۃ u}hD@E0Gu`hH@>P*hD@E0 |Eh>Pt\h@@E0tCE8tl PKE8,hD@P E0C E0mEK~gÅ3|AE0>WVCWV9WV/WV%}ͅ~uh>VKh@@u_^[ÐUSuh@@ut4jh>E0th8@E0t(}3h>EDP=[UE8/u3 PQUSuU Su uTuE /t 3[ÐUSV utXE St^[ÃSh$@hCHݐUSVW}M t2t;:t /u. -W force password prompt -w never prompt for password -U USERNAME user name to connect as -p PORT database server port -h HOSTNAME database server host or socket directory Connection options: -?, --help show this help, then exit -V, --version output version information, then exit -v write a lot of progress messages -n don't remove large objects, just show what would be done -l LIMIT commit after removing each LIMIT large objects Options: Usage: %s [OPTION]... DBNAME... %s removes unreferenced large objects from databases. Removal from database "%s" failed at object %ld of %ld. Successfully removed %ld large objects from database "%s". Would remove %ld large objects from database "%s". Failed to commit transaction: commit Failed to remove lo %u: Removing lo %6u Failed to read temp table: SELECT lo FROM vacuum_lFailed to start transaction: beginFailed to check %s in table %s.%s: DELETE FROM vacuum_l WHERE lo IN (SELECT %s FROM %s.%s)Out of memory Checking %s in %s.%s Failed to find OID columns: AND s.nspname !~ '^pg_' AND c.relkind = 'r' AND t.typname in ('oid', 'lo') AND c.relnamespace = s.oid AND a.atttypid = t.oid AND a.attrelid = c.oid WHERE a.attnum > 0 AND NOT a.attisdropped FROM pg_class c, pg_attribute a, pg_namespace s, pg_type t SELECT s.nspname, c.relname, a.attname Failed to vacuum temp table: ANALYZE vacuum_lFailed to create temp table: SELECT DISTINCT loid AS lo FROM pg_largeobjectSELECT oid AS lo FROM pg_largeobject_metadataCREATE TEMP TABLE vacuum_l AS %sFailed to set search_path: SET search_path = pg_catalogTest run: no large objects will be removed! Connected to database "%s" Connection to database "%s" failed: %sConnection to database "%s" failed Password: option requires an argument -- %c illegal option -- %c ..//../usr/local/share/man/usr/local/share/doc//postgresql/usr/local/share/locale/usr/local/lib/postgresql/usr/local/lib/usr/local/include/postgresql/server/usr/local/include/postgresql/usr/local/include/usr/local/etc/postgresql/usr/local/bin/usr/local/share/postgresql%s: out of memory /../..././%s%s wr/dev/ttyUnknown errorPAjz *:JZjz *:JZjz *:JZ ,<PXix 5 5  L ootoo`o@T>L t T p 5 5 55@PABBBF B<BOUB `lBwB5|]  " lBwB5lBwB526 2s .e / lBwB5lBwB5lBwB5B$-5# :IPB!XT"p0 F$BJ4@1 0 T#*F12 FdMWd^4*  r{ x01 T*  05) B!.N 1p T( -( d$$*F18P.V E<+ WF^ep1 rT}5 P0 B0 T Dp0 BPAt*  /D9* N5[4kqty\50  OB,* @42t * D- 1tDFKT$[00 jt5 zp ltP1 BD0 vacuumlocrti.scrt1.ocrt1.s__get_exit_frame_monitor_ptr__do_exit_code_ptrfsr.strap_tablevalues-Xa.cDdata.dataBbss.bssDrodata.rodatavacuumlo.cusagegetopt.cpath.ctrim_trailing_separatortrim_directorydir_strcmpmake_relative_pathsprompt.cthread.ccrtn.s_END__START__edataPQfinishstrtoulmainPQresultStatusfputs_environ_get_exit_frame_monitorget_pkglib_pathfprintf_endPQconnectionNeedsPasswordfopen64strtol__iob_GLOBAL_OFFSET_TABLE___fsr_init_valueget_locale_pathPQsetdbLoginget_pkginclude_pathstrlcpymallocatexitoptargget_parent_directorystrlenPQfreememstrcpyfirst_dir_separator__fsrget_doc_pathfirst_path_var_separatorpqStrerrorpath_is_prefix_of_pathabortPQerrorMessageget_home_pathgetoptstrstrtcsetattrpath_is_relative_and_below_cwd__fpstartfgetsopterrfflushget_prognamecanonicalize_pathoptoptstrdupget_man_pathPQgetvalue_initget_etc_path___Argvget_includeserver_path_PROCEDURE_LINKAGE_TABLE_PQclear__posix_getpwuid_rfclosegeteuidget_include_path__environ_lock_DYNAMIClast_dir_separatorPQntuplesjoin_path_components_lib_versionPQserverVersion_exitstrncmppqGetpwuid__1cG__CrunMdo_exit_code6F_v_PQtransactionStatussnprintfhas_drive_prefixfileno_etexttcgetattrstrerror_rsimple_promptmake_native_pathpath_contains_parent_referencePQescapeIdentifieroptindPQstatusstrcatget_share_pathlo_unlink_fini_startget_html_pathPQexec__longdouble_usedstrchrget_lib_pathanotate anotate0 ,(xPA5 BBanotateX||] "#Z'$\'{_"m \' #anotate $\'\'t%`'%d'%h'%l'%p'T%t'%x'%|'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'%'$'%'%'%'%'%'%'%'%'%'%'%(%(%(% (%(%($(%(% (%$( %((%,(C%0(%4($8(%<(%@(%D(%H(%L(%P($anotateT( T(anotate anotatep,*P,*4* T* t* **<+D--(.NP.V.e/00P0p00000101P1p11p22s26 0(0 2anotate anotate2t 2tanotate anotate(05\05)\50@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)strings.h 1.3 96/03/12 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)pwd.h 1.22 04/09/28 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)termios.h 1.6 92/07/14 SMI@(#)termios.h 1.42 07/01/14 SMI@(#)ttydev.h 1.7 92/07/14 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)strings.h 1.3 96/03/12 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)pwd.h 1.22 04/09/28 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)strings.h 1.3 96/03/12 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)pwd.h 1.22 04/09/28 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)unistd.h 1.76 06/03/10 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)strings.h 1.3 96/03/12 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)pwd.h 1.22 04/09/28 SMI@(#)termios.h 1.6 92/07/14 SMI@(#)termios.h 1.42 07/01/14 SMI@(#)ttydev.h 1.7 92/07/14 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)strings.h 1.3 96/03/12 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)pwd.h 1.22 04/09/28 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ld: Software Generation Utilities - Solaris Link Editors: 5.10-1.497Mvacuumlo.c /var/tmp/postgresql-9.2.0/contrib/vacuumlo /opt/solstudio12.2/prod/bin/cc -Xa -v -O -I../../src/interfaces/libpq -I. -I. -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c vacuumlo.cXa;O;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.08getopt.c /var/tmp/postgresql-9.2.0/src/port /opt/solstudio12.2/prod/bin/cc -Xa -v -O -I../../src/port -DFRONTEND -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c getopt.cXa;O;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0S4,path.c /var/tmp/postgresql-9.2.0/src/port /opt/solstudio12.2/prod/bin/cc -Xa -v -O -I../../src/port -DFRONTEND -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c path.cXa;O;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0:Bsprompt.c /var/tmp/postgresql-9.2.0/src/port /opt/solstudio12.2/prod/bin/cc -Xa -v -O -I../../src/port -DFRONTEND -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c sprompt.cXa;O;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0oXthread.c /var/tmp/postgresql-9.2.0/src/port /opt/solstudio12.2/prod/bin/cc -Xa -v -O -D_REENTRANT -D_THREAD_SAFE -D_POSIX_PTHREAD_SEMANTICS -I../../src/port -DFRONTEND -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c thread.cXa;O;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0-OI /var/tmp/postgresql-9.2.0/contrib/vacuumlovacuumlo.cE? /var/tmp/postgresql-9.2.0/src/portgetopt.cC= /var/tmp/postgresql-9.2.0/src/portpath.cF@ /var/tmp/postgresql-9.2.0/src/portsprompt.cE? /var/tmp/postgresql-9.2.0/src/portthread.c DD% DD% DD% DD% DD%.interp.SUNW_cap.hash.dynsym.dynstr.SUNW_version.rel.data.rel.bss.rel.plt.text.init.fini.rodata.rodata1.got.dynamic.bssf.symtab.strtab.annotate.comment.debug_info.debug_line.debug_abbrev.shstrtab o4 LL`!"  )ott07 BA B(J B NTTSpp Y55_55e55m55 v@@{PAPAP;BBTBBEBBB F Mo`SxY64v $v n  070701000894e3000081ed000000000000000000000001504ffe4d000008ab000000b500010002ffffffffffffffff0000002000000000root/usr/local/bin/pltcl_delmod#! /bin/sh # src/pl/tcl/modules/pltcl_delmod.in # # Start tclsh \ exec /usr/local/bin/tclsh "$0" "$@" # # Code still has to be documented # #load /usr/local/pgsql/lib/libpgtcl.so package require Pgtcl # # Check for minimum arguments # if {$argc < 1} { puts stderr "" puts stderr "usage: pltcl_delmod dbname \[options\] modulename \[...\]" puts stderr "" puts stderr "options:" puts stderr " -host hostname" puts stderr " -port portnumber" puts stderr "" exit 1 } # # Remember database name and initialize options # set dbname [lindex $argv 0] set options "" set errors 0 set opt "" set val "" set i 1 while {$i < $argc} { if {[string compare [string index [lindex $argv $i] 0] "-"] != 0} { break; } set opt [lindex $argv $i] incr i if {$i >= $argc} { puts stderr "no value given for option $opt" incr errors continue } set val [lindex $argv $i] incr i switch -- $opt { -host { append options "-host \"$val\" " } -port { append options "-port $val " } default { puts stderr "unknown option '$opt'" incr errors } } } # # Final syntax check # if {$i >= $argc || $errors > 0} { puts stderr "" puts stderr "usage: pltcl_delmod dbname \[options\] modulename \[...\]" puts stderr "" puts stderr "options:" puts stderr " -host hostname" puts stderr " -port portnumber" puts stderr "" exit 1 } proc delmodule {conn modname} { set xname $modname regsub -all {\\} $xname {\\} xname regsub -all {'} $xname {''} xname set found 0 pg_select $conn "select * from pltcl_modules where modname = '$xname'" \ MOD { set found 1 break; } if {!$found} { puts "Module $modname not found in pltcl_modules" puts "" return } pg_result \ [pg_exec $conn "delete from pltcl_modules where modname = '$xname'"] \ -clear pg_result \ [pg_exec $conn "delete from pltcl_modfuncs where modname = '$xname'"] \ -clear puts "Module $modname removed" } set conn [eval pg_connect $dbname $options] while {$i < $argc} { delmodule $conn [lindex $argv $i] incr i } pg_disconnect $conn 070701000894e2000081ed000000000000000000000001504ffe4f00011f50000000b500010002ffffffffffffffff0000001b00000000root/usr/local/bin/pgbenchELF!44 (44o X/usr/lib/ld.so.1  $'),/0246789:;?ACEGHJKMNQTVWXZ]_acdefghjklnopqrstvw|} !"#%&(*+-.135<=>@BDFILOPRSUY[\^`bimuxyz{~X ؟h{t -( 5X>EGJp WXuB bkH!v HH8"{ x `q X(!hn( %П6nN Mk  `herzh<q Lr p~ {h!$k  q h H#Lj* .X5<EDZgu x8 q !  rp ,k x hh!"8"F/q ? FDQ@q hq ynV ( +ԟx8! u }) hk *X!=!G[@dH muD x p Pr 8~ ̟i Ls j  P!~0 8 y(p +j <j  Uğ_yhȟ (T~ q xPO< (xjD  HX!m @x HW4^lZ fv 8o{8Tt .( !\!x( ܟalarmunlogged_tablesmemmovesimple_prompt__ctypePQisBusy_etext_endget_etc_pathpg_tolower_DYNAMICstrerror_r_PROCEDURE_LINKAGE_TABLE_PQconsumeInputatexitgettimeofday__fsrPQfreememmemcpydurationfopen64snprintfstrcatget_lib_pathbsearchfputspath_is_relative_and_below_cwdindex_tablespacepath_is_prefix_of_pathlast_dir_separatoratoipthread_joinstrncmp__iobsystemoptindget_doc_pathnxactstimer_exceededpgttyPQexecget_man_pathPQescapeIdentifier_lib_versionabortmake_native_pathget_pkginclude_pathldexpstrcmppg_lrand48getenvstrlenuse_log_GLOBAL_OFFSET_TABLE_PQsetdbLoginpg_ascii_toupperoptarg__div64get_html_path_startPQsendQueryParamsget_home_pathjoin_path_components__longdouble_usedscalePQsocketmalloc_get_exit_frame_monitorfprintf___errnois_latenciesget_locale_pathstrstris_connectget_includeserver_pathget_include_pathstrtokget_progname__rem64strtolPQpreparefflush__fsr_init_value__1cG__CrunMdo_exit_code6F_v_getpidPQgetvaluepg_ascii_tolowerpqStrerrormemsetstrdupcanonicalize_path__posix_getpwuid_rtcgetattrPQsendQueryPreparedmain_pidpqsignalpg_touppersrandomstrcpy_environPQclearget_parent_directoryPQsendQuery_initloginpghostreallocpg_erand48pg_strcasecmpfirst_dir_separatorpqGetpwuidselectPQfinishget_share_pathhas_drive_prefixfirst_path_var_separatorpgoptionsPQconnectionNeedsPasswordstrchrfreepgportPQerrorMessagepopenPQstatusfilenosprintf_finipthread_createget_pkglib_pathmain__fpstartPQputlinepg_srand48PQendcopystrerrorfgets_exitpath_contains_parent_referencestrlcpyPQresultStatusdbName___Argvpg_qsortgetrlimit64PQgetResult__environ_lockpg_strncasecmp_edatastrncpypclosetcsetattrgetopt_longfclosegeteuidfillfactorlibpthread.so.1SUNW_1.2libm.so.2libc.so.1SUNW_1.22SUNWprivate_1.1libpq.so.5librt.so.1libxslt.so.1libxml2.so.2libpam.so.1libssl.so.0.9.8libcrypto.so.0.9.8libkrb5.so.3libcom_err.so.3libgssapi_krb5.so.2libz.solibreadline.so.6libcurses.so.1libnsl.so.1libsocket.so.1/usr/local/lib:/usr/local/lib '=  '= yqN "tWh#(8;<%Eo]GĜ*Ȝ̜iМԜ9؜ܜ|w3~6} R$ $(,0 4T8a<?@kD,HLPT"XO\`dHhl5p\tx|XYev!D<Quc2fKĝ.ȝ̝Нgԝ؝`ܝU _F5%%h%h%h%h%h %h(%h0%h8p%h@`%ĜhHP%ȜhP@%̜hX0%Мh` %Ԝhh%؜hp%ܜhx%h%h%h%h%h%h%h%hp%h`%hP%h@% h0%h %h%h%h% h%$h%(h%,h%0h %4h(%8h0%<h8p%@h@`%DhHP%HhP@%LhX0%Ph` %Thh%Xhp%\hx%`h%dh%hh%lh%ph%th%xh%|hp%h`%hP%h@%h0%h %h%h%h%h%h%h%h%h %h(%h0%h8p%h@`%ĝhHP%ȝhP@%̝hX0%Нh` %ԝhh%؝hp%ܝhx%h%h%h%h%hjjRthT~pttt PEPu TPRU lRP:@\S-P2jKURQt`|$у| D$td$у`tƒ 3fd$f T$tfd$f L$l$YZ]USu؅tÃ[Ãh@hjpאUS u u؅tÃ[Ãh@hsj)USuu؅tÃ[Ãh@h2jאU EPPh|;ÐU$E P:F]EMU +AME]E<$ $ fL$l$\$,$D$ÐUS u uSu ][ E0 PhxhRjĐUS555455ğ5ȟ5̟ ؅ Suw Stg=u^ Sz jjdhHVP55455ğ5ȟ5̟ ؅z St'54hThJ3ۋÃ[à SP54h hS3ƐUS]3t PG3u[UEM M EUUB(3+M M h%jPEr$Pc t@3ÐUS]3Ʌt%)u<_u A u3[USVWuu]C(~C h%jPEs$P t# uw_ V[tzK$tC(@PQ j{$s( E0 uDC(@C(h%jPs$OE0u hh33_^[ÐUSVW 3UF 2)u_tu3) V WE@PSDM à _^[ÐUSVW] uEE; <3;uu4T}+؉] P+E܍D0P7]؍<3EÉE PY @PuW[VE0SY] ǃ_^[ÐUSVW$j:u E؅tv}EEWSt;Vu VtW}7SE P}C ;:uC;:tj:S؅uE _^[ÐUSVW] C H~4EE3EE3t;uM9FC H;|܃_^[USVWlEDžuE3;:u&C{:tCS؅u|؃ S| iT}]Ƅ APS P[G;[H40hh,30hȎh33ɋƄ9M ghP!؅(SEj@P Sj ESP t0)tYB t)u;}t5Ph4Ej@PEPu h(uEPE0h8h3E0hdh3=LuE0hh3`E0hh3B Pt'=LuE0hhH3l_^[ÐUuu h uÐUS]t P3[ÐUSVWE ] C<jS jP+M+CAAy@BA A|=@B|MAA=@B}}t E xu,jP8=Ft4jP] C4F F xF=vshhxH|~3|{xt7h~h wh~h wh~h w h~hu;t~;|/|t7h~h<C;t~݃hhhv@F8:t P&@Pu $ P؋F8:t P$@Pu v Px;:+APSuWPh4hj@PhPvv] u @Eh~v?F8:t P&@Pu  P؃x.F 8:t P&@Pu  Pehv0uSh4Ej@Phvu+Sh4Ej@PhvuSh4Ej@Pqphv"@@ tÙ fffPh4Ej@PSh4Ej@PEPvvu *E @ohhv>F8:t P&@Pu J P؃xi@B<hdv=th`v=ui@BijPGʋi@B@BʋU BJ BBjh(v<t`hXv<8xHPPju =LE @xPPvu {=LE @@vhhVE @zvhЌh.E @RvvhhE @(vvhhE @vhhE @vvhphE @v vhhbE @E @rvvhh&E @HvvhhE @E @ E E EČ_^[E @E E EČ_^[w-C<|@DžtyuetPPjA HPqP3 PK4 AC<tuM D@PVu 9 ] sHsUSVWE 3PU]ȅ}3Ƀ|SEt Pt P;u~;u$t PnF;u~܃_^[ÐUSVWL ~~~ ~~ ~~ ~~ ~~ ~33hhPkPW'{uԟX P P5ܟh+QPԟ PY P5ԟWy P/ PVhp+QPsV$=؟uHLQs3PhXhP&PW Fh@W~03CShhVVW;|k ~~333 CPFVhȉhPP?GA؃ @;؋ȃك +k ;|hWhVh@WhWhlWSk Si33ۉ3FjCPVh`hPPB'h +i'+uVh8hG@%@;؋ȃ%+i;Oh~W WhWhh3ۃh40P$Пtr P P5ПWP PVh؈+QPVPWCJḧSFhWhWhlWxhLWjhDSW\_^[à j WA PhxVjxkhLhjThhzj0 hhVj USVW8u EЋuF j:PX؅E ẼEPStEF }^Ph~EPEPE0SEP؋F |F @F ;:uC;:tj:S؅uuj h hs3MЋEH,_^[ÐUSVW x~f|~MfE~~Ej u_tE)tC)u;tjhSXu3 j8uO3ɉPFNN ;\tPFu SFF it tSV FKFEPCSt,^} PF Wjuڃhv-uBF ^ 3vḣhG;~ |h~vc-uLF };f|7vḣhMC;^ |=hhv-V ^:tB)tC)ut^ʃH#+ЉV hȇv,t2hdvl,th`vU,~ ~q^3vḣhTG;~ |Gh(v ,u ~ }*hXv+%~ ƃ_^[à j j؃vhhjxF vhhjNF vhhnj$V DvvhhDjvhhj vh|hjvhhhjUSVW=`a hhuJuhhE07Vh3P3Dž Pt@1C;|/ǀPhPu V$`P` h_^[Ãhh@h(jv 0PE0h~h3USVWu h3DžDžt tFAt utn< uF StƋG;|Qnau_^[ÐUSVW\EE E$E(~]Eu E ]EEE]Ettt (Ph5h؆~4@he]ShTuhD=~&5h%Vh,5h SVhL E$hE$h=FL=`?EHMMMEE=` hdoE@PhXEȋhE̋EEx333}R]U}}3҃EEԋC4L@B|5UCE+Ѝt#iCEԍC(EC@4L@B|/C+Ӎt#i]CEԃ(EЃE;EHEԋU;UnUЉUEԉ}ЋCU4L@B|/C+׍t#iCUЋEԉEԃ(UBU;U~'uE~ɉMEEE]EE0$h~ẼE̋E:E@E;`\_^[ÐUSVW] 3zPu~lh<s. h8s h,s h(sp hht 8t̟ hJt 8tȟ h*t 8t h@thjPxPhhЄSV 83ۃDžhDžpDžTDžXDž\Dž`<U :Pl3Dždu ԟu П3$`=` 34@Q 8t B|уZ QܟZ8 j=Q D 8 ; x D@P58h tS Q `d8w E =j Q^v = Q3 QDžh  FD QzT Q[`H EPjU `pUJH;Hrh \UM ȟE\=X5 ̟-d%lhxhjh xPhhЄWV 8pd<9E~ M 4? hl(t 8t4t 8t4 h4 ==  `@T@ t`Tl ffl`x;T| T…~ @`iPt؍P`HDiPjQDž@P@H{(~233C$t040h~P G;{(|ҁP@@@;D~t=tg=~0545`5ȟ5̟h .545`5ȟ5̟hw ؅g Sd pt{hXSIVNy jjVP V#ht5hhht5h4Ej@P`Hht}33|n`D3EPhh~VEPhh~V;D~;h:hDEPhh~V}G;D~҃Xh̀VshShShShxV;\t-hTV!hlSohxV SjEPM@BEPpu" 5h`Lu" 5h`%u 5h` Tk(P\dTHd\DžPPlitCK @fC 7fC".fC$=Fu 3CC PsC PKLCh~7333>>DL?B;h|σ(P@P;\EjP~ P3ۋd\jFP F&VhajFP%~(C;~l3EEDž\d3|Ct|QP|8 Sc|8G\EEGhUh=@B|KHCꋅH+ЍDM#ihM W(F;l\0EjPK~ P 3EE3ۃ`t jEPE+uu}+}}y:OC+Du+ʋ#i@B@BM uuEp0Td`Sp3_^[à Pj` h  jAhhgj 8 Qhh<j5ܟhhjȾ[Qh(hj裾7 j葾$ j hh蠾jV 8l5hLhpj&hhLj 8C5hdhjҽe5hԃhj訽;Phhͽj能Phh訽j^CQ 0W Phhtj*)E0phPhHhh6j jռT`h hj証U j薼 j脼54hV裼S PhxV苼jAY S Phxh]jY5h(h3jU j׻ jŻ j賻I P貾 Ph8hϻj腻 RQS~QSSSSSS(QpSSSSSwSORDRSSSSSSSSSSSSSS~SSRSSSRS8RSSSSSRRzRSSUSVW,MAy j 3C=EDžtot" P5@h(j@P 5@h((j@P(hP޼=DuD~@3tC;|ꋝGjS蕻H) K+HKy@BK K|G3F<h^`HPjGF +$+CCy@BC C|=@B|CC=@B}싅t PȶÁ,_^[þ貶 0踶 Ph~Vٳ茶 0蒶 PhV賳xf 0l(PQhh肳G>ULUhij"EE#USVWufPNÉE^]RNj}~]TM܋UffFfN_^[ÐUS0um jЋ]EE$耶]jCEE$^]蛃jCEE$<]EEE]E$[ÐUhV ZXÐUfV3EfXfZfPmfRfTfN U3ÐUEt/t @u3UEt:t @u3UU 3t/uB uUÐUSVW ]ME ;thPQ'.u{/u.u{/ttJE 8u\` uuSWhd+QuVJ ] _^[USVW(u7]˅t,3/u t C/t;t/CAuuu3ۃ uW}hTE0u`hX>PްhTE0|Eh P蛰t\hPE0肰tCE8tl PKE8,hTP耳 E0C E0mEK~gÅ3|AE0WV'WVWVWV }ͅ~uhVKhPuѲ_^[ÐUSu襯hPuSt4jhE0thHE0t(}3h EDP[UE8/u3 PQUSu Su uHuE /t 3[ÐUSV utXE S莭t^[ÃSh4hL脱ݐUSVW}M t2t;:t /uE7u6Ӄ}"E0E0Ӄ|EE^[ÐUSVWL]E EuEEE̋ étEyEEEЋEw<3}EÉE;0]]̃W+PӃ;}r] }]̋]MÉEI΍ E؃}˃}(vnE}ủu?EP;PSxEűE 8QP+P_EűEP+Nj}PE+EuP=MUUuPuQ$EEЅu MPVuS}܋E؉E;lSWŨ}tKuuVWuyu;}1SWŨ~σSuŨuu܅u u};}SWU~։u܋uSuŨ|VSuU}}u~;}uBuEȋU؋E؉+ƉE؋E+ƉE;wzSPŨ}ˋMȋDuuVuu)u؋E+ƉE;w9SPŨ}uVuWTE+ƉE;u܋uE܋+ЉUċ++H#~uP+QS E؋+UȉUM++;sʅ~uQE+PWE;v(uV 3ҝtEfPSE;]+؋ t3ҋEE3fEpM< ;E<3;thMMuE;vOW+P}U~9+ƉEuVuuEĉE;v+ΉMăPQU;}rUE܉u;vAW+EPŨ~-+M;v+EEVPŨM};}rEE ]L_^[USVWE @ P؅9hthxrhphx^tu( VXt WFh} VQP 8<@DHL $PT(X Vg QhTPrEtWPnWuVSu S蟠~zD taVhhPàt: hP]~g uċDD D< u D}u8 Vy 8QhTP脣Whl膣W荣ht ViW`3ۋÁ_^[U uu uXtE ÐUuuuu u6 E8t3UWVS[Q[^_UWVS[5[^_ DH܋ȋ8L_$tIzD$%d\. set %sstartup %f %s %s: %s bad socket: %s unlogged-tablesduration: %d s query mode: %s TPC-B (sort of)pgbench_historypgbench_tellersClient %d aborted in state %d. Execution of meta-command failed. select failed: %s Client %d aborted in state %d. Execution meta-command failed. Couldn't open logfile "%s": %swpgbench_log.%d.%dpgbench_log.%dcannot create thread: %s starting vacuum pgbench_accounts...end. truncate pgbench_historyvacuum pgbench_tellersvacuum pgbench_branchesstarting vacuum...scaleScale option ignored, using pgbench_branches table count = %d count(*) from pgbench_branches invalid (%d) select count(*) from pgbench_branchesConnection to database '%s' failed. pghost: %s pgport: %s nclients: %d duration: %d dbName: %s pghost: %s pgport: %s nclients: %d nxacts: %d dbName: %s number of clients (%d) must be a multiple of number of threads (%d) PGDATABASETry "%s --help" for more information. invalid query mode (-M): %s query mode (-M) should be specifiled before transaction scripts (-f) invalid fillfactor: %d optioninvalid variable definition: %s invalid duration: %d invalid number of transactions: %d specify either a number of transactions (-t) or a duration (-T), not both. invalid scaling factor: %d invalid number of threads: %d Use limit/ulimit to increase the limit before using pgbench. You need at least %d open files but you are only allowed to use %ld. getrlimit failed: %s invalid number of clients: %d ih:nvp:dSNc:j:Crs:t:T:U:lf:D:F:M:PGUSERPGPORTPGHOSTpgbench (PostgreSQL) 9.2.0-V--version-?--helptablespaceindex-tablespacestatement latencies in milliseconds: statement latencies in milliseconds, file %d: tps = %f (excluding connections establishing) tps = %f (including connections establishing) number of transactions actually processed: %d number of transactions actually processed: %d/%d number of transactions per client: %d number of threads: %d number of clients: %d scaling factor: %d transaction type: %s Custom querySELECT onlyUpdate only pgbench_accountsUp to only %d SQL files are allowed Invalid command %s %s: missing command %s: unknown time unit '%s' - must be us, ms or s us%s: extra argument "%s" ignored %s: missing argument --statement has too many arguments (maximum is %d): %s done. vacuum analyze pgbench_historyvacuum analyze pgbench_accountsvacuum analyze pgbench_tellersvacuum analyze pgbench_branchesvacuum... using index tablespace %sset primary key... PQendcopy failed very last PQputline failed %d tuples done. PQputline failed %d %d %d copy pgbench_accounts from stdintruncate pgbench_accountscreating tables... commitinsert into pgbench_tellers(tid,bid,tbalance) values (%d,%d,0)insert into pgbench_branches(bid,bbalance) values(%d,0)begin unloggedcreate%s table %s(%s)%s tablespace %s with (fillfactor=%d)drop table if exists %salter table pgbench_accounts add primary key (aid)alter table pgbench_tellers add primary key (tid)alter table pgbench_branches add primary key (bid)tid int,bid int,aid int,delta int,mtime timestamp,filler char(22)aid int not null,bid int,abalance int,filler char(84)pgbench_accountstid int not null,bid int,tbalance int,filler char(84)bid int not null,bbalance int,filler char(88)pgbench_branchesshellsmssleep%s: unsupported operator %s %s: division by zero /*-+%s: range too large %s: maximum is less than minimum setrandom client %d executing \%sclient %d cannot send %s client %d sending %s Client %d aborted in establishing connection. Client %d aborted in state %d: %s%d %d %.0f %d %ld %ld Client %d aborted in state %d. Probably the backend died while processing. client %d receiving P%d_%dsetshell%d%s: must return an integer ('%s' returned) %s: cannot close shell command %s: cannot read the result r%s: cannot launch shell command %s: too long shell command %s: undefined variable %s %s: invalid variable name '%s' Connection to database "%s" failed: %sPassword: Connection to database "%s" failed %s%s is a benchmarking tool for PostgreSQL. Usage: %s [OPTION]... [DBNAME] Initialization options: -i invokes initialization mode -F NUM fill factor -s NUM scaling factor --index-tablespace=TABLESPACE create indexes in the specified tablespace --tablespace=TABLESPACE create tables in the specified tablespace --unlogged-tables create tables as unlogged tables Benchmarking options: -c NUM number of concurrent database clients (default: 1) -C establish new connection for each transaction -D VARNAME=VALUE define variable for use by custom script -f FILENAME read transaction script from FILENAME -j NUM number of threads (default: 1) -l write transaction times to log file -M simple|extended|prepared protocol for submitting queries to server (default: simple) -n do not run VACUUM before tests -N do not update tables "pgbench_tellers" and "pgbench_branches" -r report average latency per command -s NUM report this scale factor in output -S perform SELECT-only transactions -t NUM number of transactions each client runs (default: 10) -T NUM duration of benchmark test in seconds -v vacuum all four standard tables before tests Common options: -d print debugging output -h HOSTNAME database server host or socket directory -p PORT database server port number -U USERNAME connect as specified database user -V, --version output version information, then exit -?, --help show this help, then exit Report bugs to . out of memory \set naccounts 100000 * :scale \setrandom aid 1 :naccounts SELECT abalance FROM pgbench_accounts WHERE aid = :aid; \set nbranches 1 * :scale \set ntellers 10 * :scale \set naccounts 100000 * :scale \setrandom aid 1 :naccounts \setrandom bid 1 :nbranches \setrandom tid 1 :ntellers \setrandom delta -5000 5000 BEGIN; UPDATE pgbench_accounts SET abalance = abalance + :delta WHERE aid = :aid; SELECT abalance FROM pgbench_accounts WHERE aid = :aid; INSERT INTO pgbench_history (tid, bid, aid, delta, mtime) VALUES (:tid, :bid, :aid, :delta, CURRENT_TIMESTAMP); END; \set nbranches 1 * :scale \set ntellers 10 * :scale \set naccounts 100000 * :scale \setrandom aid 1 :naccounts \setrandom bid 1 :nbranches \setrandom tid 1 :ntellers \setrandom delta -5000 5000 BEGIN; UPDATE pgbench_accounts SET abalance = abalance + :delta WHERE aid = :aid; SELECT abalance FROM pgbench_accounts WHERE aid = :aid; UPDATE pgbench_tellers SET tbalance = tbalance + :delta WHERE tid = :tid; UPDATE pgbench_branches SET bbalance = bbalance + :delta WHERE bid = :bid; INSERT INTO pgbench_history (tid, bid, aid, delta, mtime) VALUES (:tid, :bid, :aid, :delta, CURRENT_TIMESTAMP); END; preparedextendedsimple..//../usr/local/share/man/usr/local/share/doc//postgresql/usr/local/share/locale/usr/local/lib/postgresql/usr/local/lib/usr/local/include/postgresql/server/usr/local/include/postgresql/usr/local/include/usr/local/etc/postgresql/usr/local/bin/usr/local/share/postgresql%s: out of memory /../..././%s%s wr/dev/ttyUnknown error.>N^n~.>N^n~.>N^n~.>N^n~  . > N ^ n ~         !!.!>!N!^!n!2=HUbn~ 8~ T~ #T oƒoopHo`oh!PĖdPD~؟ m3ͫ4THPp  ! 8~ T~ p~~P\`>GD p;tNT| _kPv`p~"A "D #A X# p#a #a 8$5 p%8 % %A &@ H&  (T'g 6' F`( V)P eP) uL, h,* , ,< <\ 4C (D H J K @ !'3Ai! Ja{ Ti  eho`kv`x~y8i PNVkNv`p~s6 rs 8oe o kPv`p~kPv`p~uH  v kPv`p~$kPv`p~.kPv`p~7DX L؟\dh{t r( zXGp XuB H! HH8"{ x ) 0`q =XE(!Khn( FjП{nN k  hh<q Lr #p~0 h!6$k G q [h HaLj* lXszEu 8 q !  rp ,k x!' h0h!"IP8YFfq v }D@q q nV ( pԟx8! %u 6}) AhHk ZX!m!w@H uD   Pr 8~ ̟i Ls j  P!#~0 .8 5(>p Mj ^j  wğhȟ (T~ q Hx PO<  (  xjD $ . H7 = XC m b x j y 4 l  v > 8  8 T t s( ! \   ! x (  ܟpgbenchcrti.scrt1.ocrt1.s__get_exit_frame_monitor_ptr__do_exit_code_ptrfsr.strap_tablevalues-Xa.cDdata.dataBbss.bssDrodata.rodatapgbench.cxmallocxreallocxstrdupusagegetrandexecuteStatementdoConnectdiscard_responsecompareVariablesgetVariableisLegalVariableNameputVariableparseVariablereplaceVariableassignVariablesgetQueryParamsrunShellCommandpreparedStatementNameclientDonedoCustomdebugquerymodedisconnect_all_initparseQueryprocess_commandsnum_commandsprocess_fileprocess_builtinprintResultsQUERYMODEtpc_bselect_onlysimple_updatesetalarmthreadRunhandle_sig_alarmsql_filesnum_fileserand48.c_dorand48_rand48_mult_rand48_add_rand48_seedpath.ctrim_trailing_separatortrim_directorydir_strcmpmake_relative_pathpgstrcasecmp.cqsort.cswapfuncmed3sprompt.cthread.ccrtn.s_END__START_unlogged_tablesmemmovesimple_prompt__ctypePQisBusy_etext_endget_etc_pathpg_tolower_DYNAMICstrerror_r_PROCEDURE_LINKAGE_TABLE_PQconsumeInputatexitgettimeofday__fsrPQfreememmemcpydurationfopen64snprintfstrcatget_lib_pathbsearchfputspath_is_relative_and_below_cwdindex_tablespacepath_is_prefix_of_pathlast_dir_separatoratoipthread_joinstrncmp__iobsystemoptindget_doc_pathnxactstimer_exceededpgttyPQexecget_man_pathPQescapeIdentifier_lib_versionabortmake_native_pathget_pkginclude_pathldexppg_lrand48getenvstrlenuse_log_GLOBAL_OFFSET_TABLE_PQsetdbLoginpg_ascii_toupperoptarg__div64get_html_path_startPQsendQueryParamsget_home_pathjoin_path_components__longdouble_usedscalePQsocket_get_exit_frame_monitorfprintf___errnois_latenciesget_locale_pathstrstris_connectget_includeserver_pathget_include_pathstrtokget_progname__rem64strtolPQpreparefflush__fsr_init_value__1cG__CrunMdo_exit_code6F_v_getpidPQgetvaluepg_ascii_tolowerpqStrerrormemsetcanonicalize_path__posix_getpwuid_rtcgetattrPQsendQueryPreparedmain_pidpqsignalpg_touppersrandomstrcpy_environPQclearget_parent_directoryPQsendQueryloginpghostpg_erand48pg_strcasecmpfirst_dir_separatorpqGetpwuidselectPQfinishget_share_pathhas_drive_prefixfirst_path_var_separatorpgoptionsPQconnectionNeedsPasswordstrchrfreepgportPQerrorMessagepopenPQstatusfilenosprintf_finipthread_createget_pkglib_pathmain__fpstartPQputlinepg_srand48PQendcopystrerrorfgets_exitpath_contains_parent_referencestrlcpyPQresultStatusdbName___Argvpg_qsortgetrlimit64PQgetResult__environ_lockpg_strncasecmp_edatastrncpypclosetcsetattrgetopt_longfclosegeteuidfillfactoranotate anotate0 ,(!!T~"ptanotate"Fh"A"D#AX#p#a#a8$5p%8%%A&@H& T'g'`()PP)L,h,*,,<<\4C(DHJKa{i i!PO<`!Q`]OV.#]}ueYm ` $%88m;;%<0ianotate %%e&%'%$Q`Za`R`Q`S`~Q`S`S`S`S`S`S`(Q`pS`S`S`S`S`wSaORaDRaS aSaSaSaSaS aS$aS(aS,aS0aS4aS8aS /var/tmp/postgresql-9.2.0/src/portqsort.cF@ /var/tmp/postgresql-9.2.0/src/portsprompt.cE? /var/tmp/postgresql-9.2.0/src/portthread.c DD% DD% DD% DD% DD% DD% DD%.interp.SUNW_cap.hash.dynsym.dynstr.SUNW_version.rel.data.rel.bss.rel.plt.text.init.fini.rodata.rodata1.got.dynamic.bssf.symtab.strtab.annotate.comment.debug_info.debug_line.debug_abbrev.shstrtab o< TT` !"#)op7 BHHA BPP J Bpp N`S!!\Y8~8~_T~T~ep~p~Pm~~v`{X;PP \\E``\y < oLPzI.  D  P  070701000894c9000081ed000000000000000000000001504ffe4c000145dc000000b500010002ffffffffffffffff0000001c00000000root/usr/local/bin/createdbELF#4TA4 (44oFFHHt P/usr/lib/ld.so.1 !"#$%&'()*+,-/045679:;<>?@ABCDEFGHJOPSVZ]^_`befghijklmnpqruvxyz|}  .1238=IKLMNQRTUWXY[\acdostw{~  ! &V 0@"6\e U![ mDm !7 (i -Y V 0o) Tc ` X:P p 8 6i Ch ] #hP o v"}8H#1 `!!  MMM MԋMM؋MM܋MMЉE jjiaxEԉGpE؉FGhE܉FG \EF GTEЉFG8EF3GFjVW3W8V/  S+u; S*t+}u% S jjdh#=E Et P Su}  S13؋Ã,_^[Ãuhh[juuhh4juhh jxuuhhj SPuuhhjh&USEtjuuuuu P Mju]Suuu h؅t u'jE0SE0E0E 0h̅I [USV}tu heu ud؅t Sbu^[à E0PuhVE 0uhVE0=jC뤐USV}tu hu u؅t Su ]^[ E0PuhVE 0uhVE0j럐USV}tu h uu u t Và V3^[ÐUS]t S؅t)Ã[Ãhdh*jŃhTh j붐USVWh@hDuhHhP)jjP9hDVtk@DSVt@ V SWh  jjP8WVt믃 V[3 VK _^[ÐU(E3(}t E0\ u^(U(E3(}t E0ÐUS=(tThP5(uPhhQhh:[Uh\5jUÐUSV,t S ؉,=4unUHv_u[tȍqv Ѓ v<_u@Bu5phpu!t@uE0S@Sj"S@ut-<"uj"S$PSFuӃj"S^[ÐUSVW8u u EPuEMA 'CMMMMu<'t <\u }uCCFAuV3҅~(΋Ӊ]uԋڋ3ҋM t } FCB;|;| u!Mq t1+ʍ<;s  CB;|'CE+CX,_^[ÐUSu j\u ti u=8|T]UJv| tj RjE3~E0jPE 03of]PugtLj'E01jSE 0EAPu M AE 'M[[ÐUSVW j$WEt PW7u -t1E 03ۃ}pPWC7Vuփj$Wj7uMu u?7u2} _^[USVW u ]]Pu.tvEP<'O}uD\O\AxASv3Y>Flplp Jхw'@M+@A _^[ÐUSVW(}W]SuVhu |t3kd kd_^[USVW 3ɋu E u(؃E8{|} QWO3}t~ }tM,tHtg"t BC,zJ"ttH\uGt7 GC"uW }t,uC ,uB F}u3(3$3 3zu E0 333 _^[ÐUSVWL] u =t;u3ۃEPEPE0uEt P3E~wEoEgE_EuhuE tPhxuuuh`uM H9}ChTE0υu& E0E0E0h,uL ύE8EGEčEEȍEE̍E EЍEE3ME uuVuuuuuȍE48[0~EtSh(VExvu$~ExSE0|uS6jt@~wExEx126S3,EE}}hE0hE0uhuEЅtPhxu E0=Puuhur Exv/ E0 PuuȋE0uhu: Ex( E0 PuuȋE0uhȊu ~ 6 PhuExuuȋE0uhu E܃xt{ h|: Ph|E0t# E0 PhhuRD h|MP Phpu!hu ExuuȋE0uhu E܃xt{ h|u Ph|E0t# E0R Ph(uD h|+MP! PhTu\h`uGh<u4~v)t6S,thuE@E؍M;}u؋u}uRtNuhVE tPhxV SXPuuhV uuuu76hu$LVsWjuE 03]L_^[ÐUSVr u PhVE t Pw Ph܉Vuu6E0uujh؉"V^[ÐUSVW(u{\ Vuv 8=4 xj/Wt+@Pu E 8t! V3 u k u$]u(RhЉu hĉE 0hE 0hE 0hTE 0n%hHE 0Qh<E 04vh4E 0hTE 08hE 0hE 0hE 0h܈E 0ḧE 0iY jrW#tOx*t#uhE$0 3E/uhE(0 E E3ۃjwWtIx*tE$uhp0w 3 uhpE(0X EE3jrWPtUx*t&uhE$0 3EuhE(0 EkE3]jUWtUx*t&uhE$0 3EuhE(0s EE3jUWftUx*t&uhE$0$ 3EuhE(0EE3sjCWtUx*t&uh,E$03E5uh,E(0E E3jCW|tOx*t#uh,E$0:3E/uh,E(0E E3ۃjcWtCx*tE$uh 03*uh E(0E E3ۃjTWtIx*tE$uh 0r3uh E(0SEE3jCWKtOx*t#uh,E$0 3E/uh,E(0E E3ۃjUWtIx*tE$uh03,uhE(0EE3jUWxtUx*t&uhE$063EuhE(0EE3jXWtUx*t&uh(E$03EGuh(E(0EE3jrWtOx*t#uhE$0L3E/uhE(0)E E3ۃhĉE 0MthE 04umjUWtCx*tE$uh03*uhE(0E E3ہ}8ojaWtCx*tE$uh0C3*uhE(0'E E3ۋEE=8hĉE 0?hE 0"jwWtIx*tE$uh`03'uh`E(0{EE3jxWstCx*tE$uh013*uhE(0E E3ۋE.jdWEtCx*tE$uh03*uhE(0E E3ۃjtWtGx*tE$M1h00e3,E0h0E(0GE E3ہ}:|bjDW>tGx*tE$M1hx03,E0hxE(0E E3ۃjwWtCx*tE$uhp03*uhpE(0~E E3ۄۍ]$uA}tw E(0h3EtQPhx3f< 3hE(0EtPhxE(0( V V33_^[PE6USV] u9tt=toM1<"uIC"u{"u7tS<"uKS"uًCPV"uπ{"tCCPVt=u] E ^[ÐUS]Exvj,Pu h(3 Et EE xM[[USVWHu]J EPEPEhP* EEE"}t $?=*?.$}t)Phtj\EPWSp )!PEPiCF΋t  u hEP%C EPE0EPEPhEPC j.EPC thEPC Z RPEPC 8}t's{"t Ej"EPjEC 2}7h]S%hu }uĈPu u }$tTu h6= u36 Whx6 u36ht60u hl6 u36j 6n}w}( ]hEP3hu}}wJ3ۃ}(}tĈPu u(hu ,hEPhu3ۅt_3ۃ}tW}tĈPu _ uhlu uuu cj u > EPEP@u(3ۅt7}uĈPu Vhu <Ã<_^[ÐUUE MMEE UUSVW8u sE }EEEE܋EE3jVSPE؃jVS>Eԃ uQuPhWu4 PhWq uuWh܇WTF S;p,_^[US] ;uhЇuu hȇE0u ahE0u CE050hSi 50hlSUE[[ÐU EPu uÐU=0t=EtP50h`h50hXhM EEM EU EPu ujIÐU=8|h8jM8 @M D@8ÐUSVW 8Kxe48}3|<}vWvWVvWVvWV}˅|}vWK}EE _^[USVWhuE@EH}33|juE3;Pw D=WD;xw DDxw DDxw Dz;~;U:Xw D=G;~ED] Et;wE+ˋ<˃EP4t|w_;v33ǃ\_^[UShSuo|SC%=tBjE0SjE0But3 Ĕ[ÐUSVhPn u.E8/tPQu nhPu E ƀ u u u E 0%E 0h|SMSj r htHk8bu M Dž3ۉt C SDu SÉ+ÍP+H#…v+PSQD8/t,PPV VVPV VfVqu'VhXhhj  tt8 Vo)uh4SSj ^[à 5a PhS]Sj USVWXhP;u V؅t V9toCރXPS,p%=hWS |P=sIƄWVkVhhohj ShS?Sj dSPh]utpPPP34XPt3-XPhSSj Ĝ_^[à 5o PhSkSj 뾃 58 PhS4Sj Y뇐USVxuuu} 6t 6,66hu h+QS6tZ6hhP EjdPQ9t!EuP藿u3 p^[ÐUSVWhV3=hܚux؅=Suu ft SruE 33/C t,E0hV膾 S*3 _^[à h ؃ h̚3ҐUSutVv.u'Ph0SSj LPhS׽Sj (Ph\S譽Sj 3[à hCߐU hu 趽thj Pu'|t hؙGu`PQrPhșhPJP/PPU3ÐUEt/t @u3UEt:t @u3UU 3t/uB uUÐUSVW ]ME ;thPQ.u{/u.u{/ttJE 8u uҽuŽSWh+QuV ] _^[USVW(u7]˅t,3/u t C/t;t/CAuuu3ۃ u7}hE0{u`h >P^hE0A|EhPt\hE0tCE8tl PKE8,hP E0C E0mEK~gÅ3|AE0WVWVWVWV}ͅ~uhVɽKhu豽_^[ÐUSu腻huӹt4jhE0thE0读t(}3hEDPq[UE8/u3 PQUSuɺ Su uXuE /t 3[ÐUSV utXE S边t^[ÃShhLݐUSVW}M t2t;:t /u. By default, a database with the same name as the current user is created. --maintenance-db=DBNAME alternate maintenance database -W, --password force password prompt -w, --no-password never prompt for password -U, --username=USERNAME user name to connect as -p, --port=PORT database server port -h, --host=HOSTNAME database server host or socket directory Connection options: -?, --help show this help, then exit -V, --version output version information, then exit -T, --template=TEMPLATE template database to copy -O, --owner=OWNER database user to own the new database --lc-ctype=LOCALE LC_CTYPE setting for the database --lc-collate=LOCALE LC_COLLATE setting for the database -l, --locale=LOCALE locale settings for the database -E, --encoding=ENCODING encoding for the database -e, --echo show the commands being sent to the server -D, --tablespace=TABLESPACE default tablespace for the database Options: %s [OPTION]... [DBNAME] [DESCRIPTION] %s creates a PostgreSQL database. %s: comment creation failed (database was created): %sCOMMENT ON DATABASE %s IS %s: database creation failed: %s%stemplate1postgres; LC_CTYPE '%s' LC_COLLATE '%s' TEMPLATE %s ENCODING '%s' TABLESPACE %s OWNER %sCREATE DATABASE %sPGUSERPGDATABASE%s: "%s" is not a valid encoding name %s: only one of --locale and --lc-collate can be specified %s: only one of --locale and --lc-ctype can be specified %s: too many command-line arguments (first is "%s") Try "%s --help" for more information. h:p:U:wWeO:D:T:E:l:createdbpgscripts-9.2maintenance-dblocalelc-ctypelc-collateencodingtemplatetablespaceownerechopasswordno-passwordusernameporthost%s Could not send cancel request: %sCancel request sent Please answer "%s" or "%s". ny%s (%s/%s) out of memory pg_strdup: cannot duplicate null pointer (internal error) %s: query was: %s %s: query failed: %stemplate1postgres%s: could not connect to database %s: %s%s: could not connect to database %s fallback_application_namedbnamepassworduserporthost%s: out of memory Password: %s (PostgreSQL) 9.2.0 -V--version-?--help%s: could not obtain information about current user: %s %s ALL %s IS CONNECTEXECUTETRIGGERout of on_exit_nicely slots %s: %s: [%s] Try "%s --help" for more information. %s: unrecognized section name: "%s" post-datadatapre-data; SECURITY LABEL FOR %s ON %sSELECT provider, label FROM pg_catalog.pg_shseclabel WHERE classoid = '%s'::pg_catalog.regclass AND objoid = %u%s ~ ) OR %s ~ (%s ~ ^(.*)$)$|*+?()[]{}.^$\\$.*^(WHERE AND LARGE OBJECTFOREIGN TABLEFOREIGN SERVERFOREIGN DATA WRAPPERTABLESPACETEMPORARYCREATESCHEMALANGUAGEFUNCTIONSFUNCTIONUPDATE,DELETEUPDATETRUNCATEDELETEREFERENCESINSERTUSAGESELECTSEQUENCESTABLESSEQUENCETABLEIN SCHEMA %s ALTER DEFAULT PRIVILEGES FOR ROLE %s %s%sRESET SESSION AUTHORIZATION; WITH GRANT OPTION; GROUP %sPUBLIC%s; GROUP %s; group PUBLIC; %sGRANT %s ON %s %s TO SET SESSION AUTHORIZATION %s; %sGRANT %s ON %s %s TO %s WITH GRANT OPTION; %sGRANT %s ON %s %s TO %s; ON %s %s FROM %s; %s%sGRANT CONNECT ON %s %s TO PUBLIC; DATABASE ON %s %s FROM PUBLIC; (%s)%sREVOKE ALL%d.%d.%dyesxmlsetrowrefoutoffnotkeyintforenddecdaycsvbitascanyandalladdxmlrootwrapperwithoutversionverbosevaryingvarcharunknowntrustedtriggerstoragesimilarsessionreturnsrestartreplicareplacereleasereindexrecheckprimaryprepareplacingpassingpartialoverlayoptionsnumericnotnullnothingnaturalmappingleadinginvokerintegerinsteadinheritindexeshandlergrantedforwardforeignextractexplainexecuteexcludediscarddisabledefinerdefaultdeclaredecimalcurrentcontentcommentcollateclustercatalogcascadebooleanbetweenanalyzeanalysecurrent_catalogcharacteristicszoneyearxmlserializexmlpixmlparsexmlforestxmlexistsxmlelementxmlconcatxmlattributeswriteworkwithwindowwhitespacewherewhenvolatileviewvariadicvaluesvaluevalidatorvalidatevalidvacuumusinguserupdateuntilunloggedunlistenuniqueunionunencrypteduncommittedunboundedtypestypetruncatetruetrimtreattransactiontrailingtotimestamptimethentexttemporarytemplatetemptablespacetablestablesystemsysidsymmetricsubstringstripstrictstdoutstdinstatisticsstatementstartstandalonestablesomesnapshotsmallintsimpleshowsharesetofsession_userserverserializablesequencessequenceselectsecuritysecondsearchscrollschemasavepointrulerowsrollbackrolerightrevokereturningrestrictresetrepeatablerenamerelativereferencesrecursivereassignrealreadrangequoteprocedureproceduralprivilegespriorpreservepreparedprecisionprecedingpositionplanspasswordpartitionparserownerownedoverlapsoverouterorderoroptionoperatoronlyonoidsoffsetofobjectnullsnullifnullnowaitnotifynonenonextncharnationalnamesnamemovemonthmodeminvalueminutemaxvaluematchlocklocationlocaltimestamplocaltimelocalloadlistenlimitlikelevelleftleastleakprooflc_ctypelc_collatelastlargelanguagelabeljoinisolationisnullisintointervalintersectinsertinsensitiveinputinoutinnerinlineinitiallyinheritsindexincrementincludinginimplicitimmutableimmediateilikeifidentityhourholdheaderhavinggroupgreatestgrantglobalfunctionsfunctionfullfromfreezeforcefollowingfloatfirstfetchfamilyfalseexternalextensionexistsexclusiveexcludingexceptescapeenumencryptedencodingenableelseeachdropdoubledomaindocumentdodistinctdictionarydescdelimitersdelimiterdeletedeferreddeferrabledefaultsdeallocatedatabasedatacyclecursorcurrent_usercurrent_timestampcurrent_timecurrent_schemacurrent_rolecurrent_datecrosscreatecostcopyconversioncontinueconstraintsconstraintconnectionconfigurationconcurrentlycommittedcommitcommentscolumncollationcoalescecloseclasscheckpointcheckcharactercharchaincastcasecascadedcalledcachebybothbinarybigintbeginbeforebackwardauthorizationattributeatasymmetricassignmentassertionasarrayalwaysalteralsoaggregateafteradminactionaccessabsoluteabort"%s" -VPGSYSCONFDIR=%sPGSYSCONFDIRpostgres-9.2child process exited with unrecognized status %dchild process was terminated by signal %dchild process exited with exit code %dpclose failedfgets failureno data was returned by command "%s" popen failurer/%s%scould not read symbolic link "%s"could not change directory to "%s"could not find a "%s" to executecould not read binary "%s"PATHinvalid binary "%s"could not identify current directory: %s..//../usr/local/share/man/usr/local/share/doc//postgresql/usr/local/share/locale/usr/local/lib/postgresql/usr/local/lib/usr/local/include/postgresql/server/usr/local/include/postgresql/usr/local/include/usr/local/etc/postgresql/usr/local/bin/usr/local/share/postgresql%s: out of memory /../..././%s%s wr/dev/ttyUnknown error&6FVfv  & 6 F V f v         !!&!6!F!V!f!v!!!!!!!!!""&"6"F"V"f"v"""""""""##&#6#F#V#f#v#####  ) 6 F Z b s      0p Lp    o_ooo`oH#؄hЄpĄUwWeODTxEl`XlH  # 0p Lp hp|H88 < OU `lw8hp+7 l8w8hp4@ ,5- (\5| l(w8hpB  dO P\ 8$@l,w8lp8lw8hpClw8pNUhY c\) t_ lw8hpj6 (js fe (g lw8hplw8hplw8hplw8hp  !+V 5@";\e Z!` rDm !7 (i  -Y  V 0o) Tc ` X:P p%8 ;i Hh b #mP t {"8H#1 `!! ?@ABDEFHIJMPQRSUVWY\^`cegjklmnorsuwxyz{|}~ ).13569;<CGKLNOTXZ[]_abdfhipqtv  ; &'PW?HKHd ]lhQ *,W)&( 9s )<)P+ 2 (: $L'+,+>)M)Ut\ _)n'v<+")\5 7 <'4|  <&('  @'HM@ dP{ t &HU pC Wf &(W L(l UXX) !0':l&Co Tb !(eg u*~ !  P \)_y ,& +\(؄pj '|) * s Т9 ( (/5L&@|'G)N\f2 ]0Y n< 'l),  L*c; |(hTL  $ ,)%V *9%@ ` u,'|P8 & XB )'@+b   & *"')*,*0N G\'NxV d&(W!kh( 6 ,( l(  |*l*'q &9X.  Ww ( ") -+{ 3bO El'L8h3 W *`fTgd ''t ̿  'H/   Y ^ X0^ `  )' G(Qs a@ q@}w  & L DW % |&\& \*  3 0 : *@ t U 0 ` p n 4 t \ %  r@}!  V <( lX i 4rg  * <* ( (c ( D 4 )Ĥ8 L)D 8 @ z  Q (Y  i d,p } /H 4   0E * %, UM `  %1&"  9 (first_dir_separatorpg_reallocfclose__longdouble_usedcheck_new_clustercluster_conn_optsinstall_support_functions_in_new_dbpg_tolower__environ_lockPQstatuspopenpg_freecreate_script_for_old_cluster_deletionfwritegetopt_long_startcheck_cluster_compatibilitystrcpyreport_statusgetenv__posix_getpwuid_rPQconninfoFreesprintfexec_progPQconndefaultsstrncmp__fsr_init_value_get_exit_frame_monitorgeteuidcreate_script_for_cluster_analyzeget_user_infosscanfold_8_3_check_ltree_usageexecuteQueryOrDiePQfnumberPQescapeStringConnfirst_path_var_separatorstrlcpy_endget_includeserver_pathconnectToServer__1cG__CrunMdo_exit_code6F_v_chmodstart_postmaster_lib_versionget_control_datagenerate_old_dumpatoi_environget_etc_pathreadcheck_loadable_libraries_DYNAMICoutput_files__ctypevsnprintfPQfinishgen_db_file_mapsinit_tablespacescheck_hard_linkreadlinkcheck_okget_man_path_finifputsverify_directories__assertpg_toupperuser_optsget_loadable_librariespclosegetcwdget_share_pathfputcget_db_and_rel_infospg_logfopen64errnoPQgetvaluestrspnfscanfload_directoryquote_identifierold_8_3_invalidate_hash_gin_indexesfprintfjoin_path_componentsget_html_pathpg_putenvlinkAndUpdateFilepg_malloc_GLOBAL_OFFSET_TABLE_mainget_locale_pathmake_native_pathctimedisable_old_clusteratexitold_8_3_check_for_tsquery_usageget_parent_directorystrchrpg_strdupcheck_old_clustercanonicalize_pathPQerrorMessageumaskoptargstrerror_rpgfnamesold_8_3_invalidate_bpchar_pattern_ops_indexesunlinkget_doc_pathchdirsystemperrorpath_is_prefix_of_pathfflushfree_db_and_rel_infosstrlenpath_is_relative_and_below_cwdlog_optspgfnames_cleanupaccesspg_ascii_tolowerpg_strncasecmprmdirlstat64renameget_pg_database_relfilenodePQntuplesgetErrorTextsplit_old_dumppqStrerror__fsrcopyAndUpdateFilestrstrfopen_privgetpwuid_etextfind_my_exechas_drive_prefixold_8_3_create_sequence_scriptfgetsissue_warningsstr2uintpg_ascii_toupperget_sock_diris_server_runningoutput_completion_bannerget_lib_pathPQresultStatusold_8_3_rebuild_tsvector_tablesreaddir64stop_postmasteradjust_data_dir__ioblast_dir_separatorstrtoulget_include_pathpg_strcasecmp___Argvpath_contains_parent_reference_PROCEDURE_LINKAGE_TABLE_strcmpPQclearunsetenvnew_9_0_populate_pg_largeobject_metadatarmtreeaborttransfer_all_new_dbspqGetpwuidget_home_path_initfind_other_exec_exitos_infoold_8_3_check_for_name_data_type_usageget_progname_edatauninstall_support_functions_from_new_clusterprint_mapssetlocalestrerrorPQexecclosedirprep_statusPQconnectdbparseCommandLineopendirget_pkglib_pathoutput_check_bannerreport_clusters_compatiblepclose_checkget_pkginclude_pathcheck_pghost_envvarcheck_cluster_versionsstrncpycheck_control_dataget_major_server_version__fpstartset_pglocale_pgservicestrcatlibrt.so.1SUNW_1.2libc.so.1SUNW_1.22SUNWprivate_1.1libpq.so.5libxslt.so.1libxml2.so.2libpam.so.1libssl.so.0.9.8libcrypto.so.0.9.8libkrb5.so.3libcom_err.so.3libgssapi_krb5.so.2libz.solibreadline.so.6libcurses.so.1libnsl.so.1libsocket.so.1libm.so.2/usr/local/lib:/usr/local/lib@  '= K T y^ qN h LW*P@}@ptTxT|TeTTtTTDT#TQTT9TTTkTT+T}TT0T TTIThT TT{TTRTTTTWToT&T8UwUOU< UUU3UFU U]$U (U,U0U4U8U$UxUUUUEUqUU5lT%pT%tTh%xTh%|Th%Th%Th %Th(%Th0%Th8p%Th@`%ThHP%ThP@%ThX0%Th` %Thh%Thp%Thx%Th%Th%Th%Th%Th%Th%Th%Thp%Th`%ThP%Th@%Th0%Th %Th%Th%Th%Th%Th%Th%Uh%Uh %Uh(% Uh0%Uh8p%Uh@`%UhHP%UhP@% UhX0%$Uh` %(Uhh%,Uhp%0Uhx%4Uh%8Uh% 5d2t)Ehj3vhj$v!h|jvh\jvUSV]u hZo hhbhFrK= hbhyhP |Q# h\{h}h蒀=؄u% PM  |>jh΂jhKjP |$wjhw=؄tuE^[Yp^[D))ݐUhHphHPhHE(c>=܄u8 HP 9Ȅthjt=thjs hH ÐU=؄uhXjsÃhjsjgojUSV |Q#wb hHlujhHjhH蜈jhHUjn |$w. hHjljhH+vE^[n^[à hD4rHP*j VP5hjjh,8,E0s,U |Q$suhjHruhXj1ru hjrÐUShd{qPj| HPsj |Q#shjq th$hjq9|vhjgq P&HP |;thDjq ;thjp[rUSV]ShjhHHPPb# Qu=L shtj^ptZ x|s!uhj$p x;uhjp^[ÐUSVW}wlhW[f؁:hdSgVthehPhPhDVEh8VEujVPqG@ujVPqGD VhSfVTththPhPEhVD PjVHPCqGH V@]_^[>USV] s@uv@thjqnsDvDܣthPjJnsHvH赣tE E^[n^[USVW=33ɍH~a33EMhDPwtMDPhjmƈG;H|MELA; |_^[USVWhUo] hlhhh3h32htV$PPh(V$PPhV$PPhV$PPhTV hDhHVn$PPhVY$PPhVD$PPhXV/ hThHV$PPhV$PPhV |Q$s $QPQhVhhHVhVhTVh@Vv$PPhVa$PPhVLhV> hhHV+$PPhPV$PPhV hhHVhVhV$PPhV$PPhTVhV hPhHVh<Vy$PPhVd$PPhVO |$sPhV hhHV $PPhVVh3u4 _^[9k 5lP3hji 5lP3hPjiUSVW(hk] h(hhhh3+h3.E܅htu5d Phu=0Y33؃ 5Єt@, 4tE 5Є`Puhuhut ,|Q$v`C 4E 5Єj/Puhu ,`~ou3]E܉E3ۃ E45Є \4j/PWhu ,LF;5`|u؋]EE܃F;50 uh]3u4_^[h 54jP3hjjg 5 jP3hPjBg말USVWhu]hfhPS^VJu"jjVehLPt5(h$jfjjV+ j jPM9 VhSY^Vthj[fjjVP^ VS _^[TgUSVhu\hheh|S]V't9E=t=HtD  PhLje VS%^[fUSVWH33h dM:,hhPExPDžDžHLLQP\[hTP\Vh@Vh8VK3ۉDžu!hP)7u!hDWDžS| SePVh8WC;eDž V68L@;APtt V6ud9h0j=c Phj'c<_^[Od<_^[à 5ePPhjbUSVWX33hx2b h`hPaExPDžDžHLLQPXhPZVvh@Vh0Voh(V_K3Džu!hP'؅Au!hDSMDžWVWVWVPh S G;DDž Vz|L@;APHt Vzua(h0j` Phjk`L_^[à 5cPPhj8`USVW]s\hhPhP VhP V j P tj PWVhxPtPhXjR_kdkd_^[à 5aPQhj_@USVW|DžDžDž hIDžt h+P&a h t hP` ht hP` ht hP` hsDžt hUPP` h6Džt hP` hDžt hP_ hDžt hP_ hDžt haP\_jh_jh_jh_jh{_jhl_jh]_jhN_jh?_hh-_} u,]sTPs\hhPhP}h`}hPs3C@CDKlQ#DžwC=DžVhPDžDžDžDžDžDžDžDžDžDžDžDžDžDž DžWh`jZhDWctXj:Pt Wwhh(jZ GPB]< hWtYj:Pt W2whhjZ GP\ChWtcj:P6t WwhhjY GPg\CDžVhWtcj:Pt WLwhhj4Y GP[C DžhWtcj:PFt WwhhjX GPw[CDžfhhW j/Puj:t W9whhj!X GPZCDžhHWtcj:P3t WwhhjW GPdZCDžSh0W tcj:Pt WIwhhj1W GPYCDžhWtcj:PCt WwhhjV GPtYC DžchWtcj:Pt WYwhhjAV GPXC$DžhWtcj:PSt Wwh hjU GPXC(DžshW-tcj:Pt WiwhhjQU GP XC,DžhWtcj:Pct WwhhjT GPWC0DžhW=tcj:Pt Wywh*hjaT GPWC4Dž hxWtcj:Pst Wwh5hjS GPVC8Džh`WMtmj:Pt Wwh@hjqSh GPC<DžhDWtmj:Pyt WwhKhjRh8GPqC=Džh,WIj:Pt WwhXhjiRh(GPG W<v. W,< u W W|TC@hWj:P)t WwhghjQh(GP7G Wrv. Wb< u WJ WSCDVhWY-t VEhShShShSh{ShhShUShBSh/SRRR{RmR_RQRCR5Rt} utptgt^tUtLtCt:t1t(ttt hj&O!hjOhjOuhjN} u6uhjNuhXjNuh4jNuhjvNuh j[Nuhj@Nuhj%Nuhj NuhjMuh|jMuh`jMuh@jMuhjMhjqM|_^[à 5 PPQhdj>M`US]KtE ;Hthj MC tM ;A thPjLC$tM ;A$thjLC(tM ;A(thjLC,tM ;A,thdjLC0tM ;A0thjgLC4tM ;A4thjFLC8tM ;A8thlj%LC _^[UuhhP jjPS};tu3à PFPQhTjCԃ PÐUh($Cjh$thjC PV5d(HP:5 DUSVW x|(, 04 8< @DHX]3(8uPQShhWTXPWu8p%=@tWhXjAF r_^[à 5DPWhpjbAːUSVhV]s\sF%=@ts\hXjAhLs\hDs\h4s\tHu3h(s\Yh s\Ihs\9Đ^[à 5 DPs\hpjw@_USu uh hhPhhSPdC%=thPhj@hjPthPhj@hjPthPh`jf@Ĕ[à 5ChPQhpj5@hUSVW }jju C؅} hhuh PS9 uAh PV'= unh PS t SVu3$EPuu t<3 _^[à SfV]@ك SJhơE _^[AU}tuu Wt3áEYAUSVWEou djjP؅C}u3h PV}# h@}h@VSytYWVua;t‹=u VrE={ VFEU= VE=# _^[à SS SBC P1= S M PG SW PQ SU WLUSVW(hU>]  uE؅3 u 3twEE@E؉E3E;|EP3> Vb>M܉ MG uuEEءu@ u,_^[à 58>PE0hjk;# P>PuhjG;럐U5dhxhP׾5h`hP踾P)PQst Pà 5h= Phj:̐USV j?腿u uEVj^[US uhH0hS2PýhtS2P謽hXS1P蕽h8S1P~hS1Pgh(S1PPhS1P9hS{1P"h Sd1P h SM1Pht S61Pݼh S1PƼh@ S1P诼][鯼USVWh q8=~}33D0PhHV/hS0PIh S0P2hXSt0PS"LG;=| _^[9USVWH `3Q::؉] \E=`u33D9EPh.uċh@h V/ P)E܋ |Qskh@h V/Ẽ P~4}uh8j7uh0jl7E u V \LuF;5`E؄thj7 E@P84 hk9 4=`MMEE0 VHE؍ẺuEjuuEȋ 4~'3341u 4t)G;|݃ u84M̉ MCE@E;E~uЃ V蚹EE@E;`58 uK8L_^[ÐUSVW4 hhH=,33h5 hhPM4Dž=83ۋ4 VN |Qs,hpVӸu h\\hTPPjWVPغhPPԺPϺWԺhV*uhjh4u%hP uPVhDž W芷4A; 8| W[u41 V脷hj3 Phj3, _^[à 56PPhjP3USVW<]MHu ;HtAPhj3H iP4E3ɃHKM̋MMЉEԋEE؉u33EDEȍ<1E܋D]č010;t PQuhj2 SWuD |QshWt6C@PG@P۵tC@PSG@PWuh<j 2 uS]WuSuu; EHMƈEԈE@;HEE<_^[ÐUSV]uƈ V薵tUE05ЄVhhu .E05EPhhE P C E0uh0hu ݴE0u h0hE P躴 E MRh,j@P脴E H @ME,E @E^[XUSVW=Iuh jt0E 3Ʌ pu]Ѕ}3҃Es3CHPCPhj 0 GHPGPhj/ LjGHPGPhj/ LjGHPGPhj/ ;uK;u+s3CHPCPhjf/ ÈF;u~E E_^[=/_^[ÐUSVW ]EHLxLt Q/ 333~P~ 3ۃFLPV4LG;~P|]tHt Phj.=tCLE _^[ _^[ÐUSVW4 hu$EHlQv$Ph4h P۱ Ph,%hVahVJhV: V iLP/H3ۃSVܰ j jP_SV躰Ph,j@GP SV薰Ph,hGDP述LC;~ VtvEHLHP, _^[ÐUSVWD E Pu#EPlQv$|#v$v \ Ph@QShh PүPh,#S=iLjP-hS5hShShPSh@SٮhSɮDž"OM D3VS胮 j jPVS] j@PW VSA j@PG@P¯ VS" j jP襮VS j jPuVSЭhPPHLjF; S詭諭E DH< _^[ÐUSVW u3~~#3ۃ DP0LG;~|߃ ]3,3C _^[ÐUS]3+C[ÐUSVW ]3{~H3D8Ph0j<)8DP&hj)LF;s| _^[USVW u~~:33 PA@PQhj( ÈG;~|ʃ _^[USVW3ۉ] jE܄ ] 3Y  hH"t hH"ҬPifx h<"謬t h<"蘬P/f h()h4"ct, 5(:*h4"AP<*(}h,"sDh("s)h$"syh"suh"sتZu5 h!j'h!h![uh!h!j& EPhxWh!SW$ M u4w$l5 h!j&h0!ji&l 5((5@((Ph4" )2& 5@"fE 5@fx? 5@8( 5@(p܄ 5@' 5@'e 5@'d 5@'h7؄. 5@' 5@v'l VhxWh!SWE )XXXXt[]h!Pu6h!j$ S Phh WEWLu h< hX h\ jhlh h, h0 jhhh h hhhdhhhhh<_^[I jۦp h!Fj輦hL!j#j蛦hh!jx#jzx};|O};|;|;|;|;|;|;|;|;|;| }|;|;|;|;|;|;|;|;|;|;|;|;|;|;|;|;|;|}}}};|;|;|;|;|;|@};|;|;|%}|;||;|;|v|X|U5(PxPhhHhÐUSVW ]t P-uf u蛦t5 V t% V}$} t- Vh$ E0uuhj! 3趥 |/u Q补 D _^[ÐUSV ]sXhhP%hP!1 PsXhxhPhPݥtHt< ,0PhDI sXs\hhPrhPΤVhP輤tj V輤j P軤tj P裤 P"CTc! P ^[à 5"PQhjiUSVW ]KlQ} f{hsThhPMhPIuPhj^VhP肣uPjhpj*VhPNuPjhpjVhPuPjhpjVhPuPjhpjhxh(Pޢ VhP虢uPjhpjA h% CdPh$P肢V=tn x;tcKhQPh<jL hCdhPiu$E E _^[Cd _^[US3EEEEu uhhHEPΦEPE 0EPP-jhHEP!]SEPhHKSh(jh(j jf HP  j9=܄ut55dhh\ h( 55(5h(jjh) < EP耮EP83Vhx(jhd(juu:uu33[ÐU} u' 5d th'jC 5th'jPu?|= P%H PHPM$à 5m Ph`'jUSh8'=u'' HP SP5h'jjh)  h&=u&' HP SP5h&jjh) & hH[ÐU h&0h&KHP h&P5h$&jjh,)#  hH6USVWh%3=~C3ۡ|h&Wڜu WLF;|; h%fHP\ h%P5h$&jjh,)f  hHy _^[Uuh%u5dhx%hP u5hx%hPjP:uPhT%jHE0h4%nPQh %jjh)z Uh" h$# 55$5h$jjh)+  h$5555 5h$jjh)0qUSVW8hl$h&hH 5$h4$VP|h#Vh"S>Eh#S*SHE؉}܉u3uWS uWSEԃh#PuVh#u0PיVhH EЃ5$hH#P P裙u訙h#u訙uVh"u PgG;}2u SNVU,_^[US5r=u8XXXXu0 h"諘h&螘h%葘[à PuUSVW<=܄tp)x)Ph+jEExE E̋EEEEEE3EEԉEȋ]̋KE;}BiLEċƉEPu?tLGK;|Չ]]̋K;|EȃPh+jYE uuPuu ؍E8t1EPE0Sz E0SjSeE@E܁ELGM;A h+F3<_^[USVh+u+ h*Sw h*V PjV j jP~M V]^[USVW\3ƅ=W ā=LW MIM HDž3i] ؋EPS6$33Jy3ɃY 48 t8 t8o t8 X;~;0 48F;~⋝ PSh*hP6PP Sh*hPPh*hPєPh*jP,HPPPPv |Q$rWhd)hPEpq7h\)hP0h\)hPpeÈ@;k"iЉЉЉ33h`)4t Pkh`)^ PL PP4 G;~%iЉЉЉ33h`)4;tY P苒h`)|;u: Pf PP4(@ P, PP4 \G;>h\)hP耑Ji؈ÉÉÉÉ33ۃ PK PP49 ,C;~H;CF33}3|o 48Ct8/t8t8 ;~; 48C;~ 0\_^[à 4h*hP j_4nP0hh)hP規PPPc  4h*hP= j_4ŏP0hh)hPPnPP  48h*hP茎 j.48P0hh)hPLP轍PP +U=܄u}tlh0*j, =܄uQuu h*j juu utrPE0E 0uuh)j Muu h)j uu ut#PE0E 0uuh)j US u uj؅t SuÃ[à S萏 Phl/j4 t S hX/谏j밐UMAdt-IhQP5(u h(/hP腌 *AhP5(u h/hPY PWÐUMAdt(5(IhQPh.hhX % 5(AhPh.hhX XUSEPu h h@]# h@]h.jh@]uSHwÃ[à E0Ph@]h.jS(E0+hX/j脊뤐USV3uvTh.hPh.P؅txpVhx.St!PPhp.VXtEpThP.j S蝊kdkd3^[ÐUj[ÐUSVWh8莉ƅ((h.Pp}u~dthNlQr-- (P(PvdSh .+Q=(}P蜉 ~{ sL--N`uH-(RQPFhPvXh-v\h-hPF(-SS'u3ۃ PhD-jSh-h8-VBth VuX Vu6?t?Ht, ++Ph,j<_^[à V Ph-jt VH=t<=Ht,+QPh,jyV uOPh+h,jLV߇Q4US<;t H;uOA`u`,Uu\,+SPqXq\hd,Pjh-t <[ÐUSVW蚊E8~FhT,P0thH,7uy 7ه؅tf SGvVh<,StAh0,S͆t,h+S踆t;/tS7h+j>B uӉ,_^[UY PsHPe=0~-55Є1uhX0joÐUSVW$ hL0P؋ |Qv//Ph/h Pȅ Ph/SV80u , P,h/V=0~C33؃WVP ,G;=0|ϋ VS, _^[US]KlQ$v

USǘ؅u5 h0jSÃ[Uu覄E뱐U j ju*USVu tI uVDP؍E 0uh0S]^[CEE^[EUSVW8h3 h3hPE]{PM} p3DžDžDžCLD0PSh3Ph3W} PjWPtpu%h3P@  Ph`3qh2^Dž W L@;CPt Ph0jU Ph0j3DžDžCLD8PSXh3Ph3V~ PjV!~P~ V~~L@;CPot#h0jxh2j1c,_^[à 5PPhp3j(USVWX33hPF hOhPu}ExPDžDžHLLQPhTNP%V|h 4V|h4V|h4Vs|K3Džu!hPNP'؅Au!h NSa|DžWV{WV{WV{PhNS{ G;DDž V{{L@;APHt V{u(h Nj PhLjL_^[à 5PPh0NjLUSVWX33hL hLhPzExPDžDžHLLQP8hJP}Vyh 4Vyh4Vyh4VyK3Džu!hPNP؅Au!h NSyDžWVLyWV3yWVyPhNSOy G;DDž VxxL@;APHt Vxu:(h Nj PhIjL_^[à 5sPPh0NjUSVWH33hI hIhP%xExPDžDžHLLQPh IPV:wh 4VJwh4V:wK3ۉDžu!hPNP&u!h NW"wDžSv SvPVhHWvC;eDž VjvlvL@;APtt Vjvu(h Njq Ph\Gj[<_^[à 5PPhHj(USVWh8G~ hGhhPuEdxP} DžHDžLDž`DžT hJ BJ  BJ BJ B J$ B(J,  B0J4 B8J< UJ BJ  BJ BJ B J$ B(J, B0J4 B8JjCL_^[à 5PPh0Nj}USVWXh<* h<hPYj]{PI} \DžDžDž3HLLQPh9PWdih 4Wtih4W]i K3ۋDžu!hPNPVu* Phd@V0iDžShP ShPyPWhL@VhC;J whDž W_hthl8P7h 6hL@;APt V@hh4j} Ph 6j/33DžCLD0PSh9P W)gh 4W2gh4W$g~ Dž W%g'gLx;{PWt#h4jhh7jI{L_^[à 5PPh0Nj}USVWX33h h5hWfh5?ExPTE]E}uEEHLULMQPh4WSVeh 4VeEh4VeK]ĉ}EE3ۋEEԉu؃uSueEuSuye}uhPNuJE}u& u# PhlEu~eE uVPWh4u\Wdthhh4h|4dh\4WdEhP4WdE܃ uE VqEujWyd ujWidPVuuh,4udWXdC;]}ȋu؃h(4uudE V"dW)dELE@EM;AP]}ut V6du W3ǃL_^[à 5Puh0Nj7USue؅tÃ[ÃhPh`}cjbאUSug؅tÃ[ÃhPh`}^cjbאUS u uf؅tÃ[ÃhPh`}cjMbUSVW(3ud h 3 WdE]EXhPSybtRhPSdbt=FE;|EPuE܃ SU܋M M W=dx]ܡu W&dÃ_^[à PePuhPh`}a뿃 5gePE0hPh`}a3룐US];t PzcuEE[^cUSVWuPɻET8 QWhPhXPaXPXPdu1p%=@utjXPc#uT} t uud V3ÁĬ_^[à XP_tt PcPXPh4Ph`})`3h PcPXPhdPh`}_39 5cPE0h4Ph`}_32UShSuCa|SC%=tBjE0ajE0`ut3 Ĕ[ÐUSVhPan u.E8/tPQu nhPu bE ƀ u u u E 0%E 0hR`}Sq^Sj fb hR^k8bu M Dž3ۉt C SDu S^É+ÍP+H#…v+PSQaD8/t,PPV VVPV VfVqu'VhRh`}]h`}j a tt8 Vo)uhlR`}S\Sj `^[à 55` PhR`}S\Sj v`USVWXhP/_u V؅t V-`toCރXPS_p%=hWS_|P=sIƄWV]kVhHRh`}[h`}j _Sh$R`}Sc[Sj X_SPk]h]u^tpPPP34XP_t3-XPhHR`}SZSj ^Ĝ_^[à 5C^ PhR`}SZSj ^뾃 5 ^ PhR`}SXZSj M^뇐USVxuuu} 6t 6,6"Z6ZhRu hR+QSY6tZ6hPhPY EjdPQ9t!EuPKYu3 p^[ÐUSVWhP}Y`}VY3=hRulY؅=Suu ZYt SruE 33/C t,E0hQVX SY3 _^[à hQ\؃ hR\3ҐUSuXtVv.u'PhhQ`}SXSj \LPh4Q`}SWSj [(PhQ`}SWSj [3[à hQ[ߐU h$Qu jWth Qj[Pu'|t hQWu`PQrPhQhPVP/PZPZU3ÐUEt/t @u3UEt:t @u3UU 3t/uB uUÐUSVW ]ME ;thPQW.u{/u.u{/ttJE 8uHTLT u6Vu)VSWhPT+QuVU ] _^[USVW(u7]˅t,3/u t C/t;t/CAuuu3ۃ uU}h@TE0/Uu`hDT>PUh@TE0T|EhRPTt\h> "%s" 2>&1command too long Could not create hard link between old and new data directories: %s In link mode the old and new data directories must be on the same file system volume. %s/PG_VERSION.linktest%s/PG_VERSIONcould not read directory "%s": %s could not open directory "%s": %s Cannot in-place update this cluster, page-by-page conversion is requiredfound partial page in source filecould not write new page to destinationcould not create destination filecould not open source fileYour installation references loadable libraries that are missing from the new installation. You can add these libraries to the new installation, or remove the functions using them from the old installation. A list of problem libraries is in the file: %s fatal Could not load library "%s" %s Could not open file "%s": %s wThe pg_upgrade_support module must be created and installed in the new cluster. 'LOAD '$libdir/plpython2$libdir/plpythonloadable_libraries.txtChecking for presence of required librariestemplate1$libdir/pg_upgrade_supportRemove the problem functions from the old cluster to continue. %s The old cluster has a "plpython_call_handler" function defined in the "public" schema which is a duplicate of the one defined in the "pg_catalog" schema. You can confirm this by executing in psql: \df *.plpython_call_handler The "public" schema version of this function was created by a pre-8.1 install of plpython, and must be removed for pg_upgrade to complete because it references a now-obsolete "plpython" shared object file. You can remove the "public" schema version of this function by running the following command: DROP FUNCTION public.plpython_call_handler() in each affected database: SELECT 1 FROM pg_catalog.pg_proc JOIN pg_namespace ON pronamespace = pg_namespace.oid WHERE proname = 'plpython_call_handler' AND nspname = 'public' AND prolang = 13 /* C */ AND probin = '$libdir/plpython' AND pg_proc.oid >= %u;SELECT DISTINCT probin FROM pg_catalog.pg_proc WHERE prolang = 13 /* C */ AND probin IS NOT NULL AND oid >= %u;DROP SCHEMA binary_upgrade CASCADE;Removing support functions from new clusterCREATE OR REPLACE FUNCTION binary_upgrade.create_empty_extension(text, text, bool, text, oid[], text[], text[]) RETURNS VOID AS '$libdir/pg_upgrade_support' LANGUAGE C;CREATE OR REPLACE FUNCTION binary_upgrade.set_next_pg_authid_oid(OID) RETURNS VOID AS '$libdir/pg_upgrade_support' LANGUAGE C STRICT;CREATE OR REPLACE FUNCTION binary_upgrade.set_next_pg_enum_oid(OID) RETURNS VOID AS '$libdir/pg_upgrade_support' LANGUAGE C STRICT;CREATE OR REPLACE FUNCTION binary_upgrade.set_next_toast_pg_class_oid(OID) RETURNS VOID AS '$libdir/pg_upgrade_support' LANGUAGE C STRICT;CREATE OR REPLACE FUNCTION binary_upgrade.set_next_index_pg_class_oid(OID) RETURNS VOID AS '$libdir/pg_upgrade_support' LANGUAGE C STRICT;CREATE OR REPLACE FUNCTION binary_upgrade.set_next_heap_pg_class_oid(OID) RETURNS VOID AS '$libdir/pg_upgrade_support' LANGUAGE C STRICT;CREATE OR REPLACE FUNCTION binary_upgrade.set_next_toast_pg_type_oid(OID) RETURNS VOID AS '$libdir/pg_upgrade_support' LANGUAGE C STRICT;CREATE OR REPLACE FUNCTION binary_upgrade.set_next_array_pg_type_oid(OID) RETURNS VOID AS '$libdir/pg_upgrade_support' LANGUAGE C STRICT;CREATE OR REPLACE FUNCTION binary_upgrade.set_next_pg_type_oid(OID) RETURNS VOID AS '$libdir/pg_upgrade_support' LANGUAGE C STRICT;CREATE SCHEMA binary_upgrade;RESET client_min_messages;DROP SCHEMA IF EXISTS binary_upgrade CASCADE;SET client_min_messages = warning;oidnewoldrelnamenspnamedatname%s%s/%u %s databases: relname: %s.%s: reloid: %u reltblspace: %s Database: %s reltablespacerelfilenode, 'pg_largeobject_metadata', 'pg_largeobject_metadata_oid_index', 'S'SELECT c.oid, n.nspname, c.relname, c.relfilenode, c.reltablespace, %s FROM pg_catalog.pg_class c JOIN pg_catalog.pg_namespace n ON c.relnamespace = n.oid LEFT OUTER JOIN pg_catalog.pg_tablespace t ON c.reltablespace = t.oid WHERE relkind IN ('r','t', 'i'%s) AND ((n.nspname !~ '^pg_temp_' AND n.nspname !~ '^pg_toast_temp_' AND n.nspname NOT IN ('pg_catalog', 'information_schema', 'binary_upgrade') AND c.oid >= %u) OR (n.nspname = 'pg_catalog' AND relname IN ('pg_largeobject', 'pg_largeobject_loid_pn_index'%s) )) ORDER BY 1;spclocationpg_catalog.pg_tablespace_location(t.oid) AS spclocationt.spclocationSELECT d.oid, d.datname, %s FROM pg_catalog.pg_database d LEFT OUTER JOIN pg_catalog.pg_tablespace t ON d.dattablespace = t.oid WHERE d.datallowconn = true ORDER BY 2template1none %s.%s: %u to %u mappings for database "%s": %s%s/base/%uMismatch of relation names in database "%s": old name "%s.%s", new name "%s.%s" pg_toastMismatch of relation OID in database "%s": old OID %d, new OID %d old and new databases "%s" have a different number of relations %s %hunewoldverboseUser-supplied old port number %hu corrected to %hu Cannot read line %d from %s: %m Cannot open file %s: %m %s/postmaster.pidcannot find current directory Could not get data directory using %s: %s "%s/postmaster" -D "%s" -C data_directorynoneFinding the real data directory for the %s cluster%s/PG_VERSIONr%s/postgresql.confYou must identify the directory where the %s. Please use the %s command-line option or the %s environment variable. Report bugs to . $ export PGDATAOLD=oldCluster/data $ export PGDATANEW=newCluster/data $ export PGBINOLD=oldCluster/bin $ export PGBINNEW=newCluster/bin $ pg_upgrade pg_upgrade upgrades a PostgreSQL cluster to a different major version. Usage: pg_upgrade [OPTION]... Options: -b, --old-bindir=OLDBINDIR old cluster executable directory -B, --new-bindir=NEWBINDIR new cluster executable directory -c, --check check clusters only, don't change any data -d, --old-datadir=OLDDATADIR old cluster data directory -D, --new-datadir=NEWDATADIR new cluster data directory -k, --link link instead of copying files to new cluster -o, --old-options=OPTIONS old cluster options to pass to the server -O, --new-options=OPTIONS new cluster options to pass to the server -p, --old-port=OLDPORT old cluster port number (default %d) -P, --new-port=NEWPORT new cluster port number (default %d) -r, --retain retain SQL and log files after success -u, --user=NAME cluster superuser (default "%s") -v, --verbose enable verbose internal logging -V, --version display version information, then exit -?, -h, --help show this help, then exit Before running pg_upgrade you must: create a new database cluster (using the new version of initdb) shutdown the postmaster servicing the old cluster shutdown the postmaster servicing the new cluster When you run pg_upgrade, you must provide the following information: the data directory for the old cluster (-d OLDDATADIR) the data directory for the new cluster (-D NEWDATADIR) the "bin" directory for the old version (-b OLDBINDIR) the "bin" directory for the new version (-B NEWBINDIR) For example: pg_upgrade -d oldCluster/data -D newCluster/data -b oldCluster/bin -B newCluster/bin or new cluster data resides-DPGDATANEWold cluster data resides-dPGDATAOLDnew cluster binaries reside-BPGBINNEWold cluster binaries reside-bPGBINOLD ----------------------------------------------------------------- pg_upgrade run on %s----------------------------------------------------------------- Try "%s --help" for more information. Running in verbose mode invalid new port number invalid old port number d:D:b:B:cko:O:p:P:ru:vcannot write to log file %s apg_upgrade_internal.log%s: cannot be run as root pg_upgrade (PostgreSQL) 9.2.0-V--version-?-h--helpPGUSERPGPORTNEWPGPORTOLDretainlinkcheckusernew-portold-portnew-optionsold-optionsnew-bindirold-bindirnew-datadirold-datadirdatnamepg_clogpg_upgrade_dump_all.sqlUPDATE pg_catalog.pg_database SET datallowconn = false WHERE datname = '%s'UPDATE pg_catalog.pg_class SET relfrozenxid = '%u' WHERE relkind IN ('r', 't')UPDATE pg_catalog.pg_database SET datallowconn = true WHERE datname = '%s'fdatallowconnSELECT datname, datallowconn FROM pg_catalog.pg_databaseUPDATE pg_catalog.pg_database SET datfrozenxid = '%u'Setting frozenxid counters in new cluster"%s/pg_resetxlog" -l %u,%u,%u "%s"Resetting WAL archives"%s/pg_resetxlog" -f -x %u "%s"Setting next transaction ID for new clustercp -Rf "%s" "%s"Copying old %s to new servercould not delete directory "%s" %s/%sDeleting files from new %spg_upgrade_dump_db.sqlRestoring database schema to new clusterAdding support functions to new clusterpg_upgrade_dump_globals.sql"%s/psql" --echo-queries --set ON_ERROR_STOP=on --no-psqlrc --dbname=template1 %s -f "%s"template1Creating databases in the new cluster"%s/vacuumdb" %s --all --freeze %sFreezing all rows on the new cluster--verbose"%s/vacuumdb" %s --all --analyze %sAnalyzing all rows in the new clusterCould not get path name to pg_upgrade: %s There seems to be a postmaster servicing the new cluster. Please shutdown that postmaster and try again. There seems to be a postmaster servicing the old cluster. Please shutdown that postmaster and try again. ---------------- Upgrade Complete "%s/pg_resetxlog" -o %u "%s"Setting next OID for new cluster------------------ Performing Upgrade pg_upgrade_internal.logpg_upgrade_utility.logpg_upgrade_restore.logpg_upgrade_server.log%u._vm%u_%s/%u%sCopyingLinkingerror while creating link for relation "%s.%s" ("%s" to "%s"): %s linking "%s" to "%s" error while copying relation "%s.%s" ("%s" to "%s"): %s copying "%s" to "%s" This upgrade requires page-by-page conversion, you must use copy mode instead of link mode. %s/%s %-60.60s %s/%u%srelfilenodeSELECT c.relname, c.relfilenode FROM pg_catalog.pg_class c, pg_catalog.pg_namespace n WHERE c.relnamespace = n.oid AND n.nspname = 'pg_catalog' AND c.relname = 'pg_database' ORDER BY c.relnametemplate1 old database "%s" not found in the new cluster %s user relation files ::1newold-m fastlibpq environment variable %s has a non-local server value: %s 127.0.0.1localhostPGHOSTADDRPGHOST"%s/pg_ctl" -w -D "%s" -o "%s" %s stoppg_ctl failed to start the %s server, or connection failed nonecould not connect to %s postmaster started with the command: %s connection to database failed: %s template1%s-c autovacuum=off -c autovacuum_freeze_max_age=2000000000-bpg_upgrade_server.log"%s/pg_ctl" -w -l "%s" -D "%s" -o "-p %d %s %s%s" startunix_socket_directoriesunix_socket_directory -c %s='%s' -c listen_addresses='' -c unix_socket_permissions=0700could not get version from %s %d.%d%63sr%s/PG_VERSIONSQL command failed %s %s executing: %s --port %d --username "%s"--host "%s" --port %d --username "%s"dbname = '%s' user = '%s' port = %ddbname = '%s' user = '%s' host = '%s' port = %dFailure, exiting connection to database failed: %s /PG_%s_%d%spg_catalog.pg_tablespace_location(oid) AS spclocationspclocationSELECT %s FROM pg_catalog.pg_tablespace WHERE spcname != 'pg_default' AND spcname != 'pg_global'template1Cannot upgrade to/from the same system catalog version when using tablespaces. %s%s %s=%s%s: out of memory okFailure, exiting %-60s%swarning Your installation contains large objects. The new database has an additional large object permission table, so default permissions must be defined for all large objects. The file %s when executed by psql by the database superuser will set the default permissions. Your installation contains large objects. The new database has an additional large object permission table. After upgrading, you will be given a command to populate the pg_largeobject permission table with default permissions. SELECT pg_catalog.lo_create(t.loid) FROM (SELECT DISTINCT loid FROM pg_catalog.pg_largeobject) AS t; \connect %s could not open file "%s": %s wcountSELECT count(*) FROM pg_catalog.pg_largeobject pg_largeobject.sqlChecking for large objects; warningpronameattnamerelnamenspname SELECT setval('%s.%s', %s, '%s'); is_calledlast_valueversion_old_8_3.cPQntuples(seq_res) == 1SELECT s.last_value, s.is_called FROM %s.%s sSELECT n.nspname, c.relname FROM pg_catalog.pg_class c, pg_catalog.pg_namespace n WHERE c.relkind = 'S' AND c.relnamespace = n.oid AND n.nspname !~ '^pg_temp_' AND n.nspname !~ '^pg_toast_temp_' AND n.nspname NOT IN ('pg_catalog', 'information_schema')Creating script to adjust sequencesadjust_sequences.sql Your installation contains indexes using "bpchar_pattern_ops". These indexes have different internal formats between your old and new clusters so they must be reindexed with the REINDEX command. The file: %s when executed by psql by the database superuser will recreate all invalid indexes; until then, none of these indexes will be used. Your installation contains indexes using "bpchar_pattern_ops". These indexes have different internal formats between your old and new clusters so they must be reindexed with the REINDEX command. After upgrading, you will be given REINDEX instructions. UPDATE pg_catalog.pg_index i SET indisvalid = false FROM pg_catalog.pg_class c, pg_catalog.pg_namespace n WHERE indexrelid = c.oid AND c.relnamespace = n.oid AND ( SELECT o.oid FROM pg_catalog.pg_opclass o, pg_catalog.pg_am a WHERE a.amname NOT IN ('hash', 'gin') AND a.oid = o.opcmethod AND o.opcname = 'bpchar_pattern_ops') = ANY (i.indclass)SELECT n.nspname, c.relname FROM pg_catalog.pg_index i, pg_catalog.pg_class c, pg_catalog.pg_namespace n WHERE indexrelid = c.oid AND c.relnamespace = n.oid AND ( SELECT o.oid FROM pg_catalog.pg_opclass o, pg_catalog.pg_am a WHERE a.amname NOT IN ('hash', 'gin') AND a.oid = o.opcmethod AND o.opcname = 'bpchar_pattern_ops') = ANY (i.indclass) AND i.indrelid NOT IN ( SELECT DISTINCT c.oid FROM pg_catalog.pg_class c, pg_catalog.pg_namespace n, pg_catalog.pg_attribute a WHERE c.relkind = 'r' AND c.oid = a.attrelid AND NOT a.attisdropped AND a.atttypid = 'pg_catalog.tsvector'::pg_catalog.regtype AND c.relnamespace = n.oid AND n.nspname !~ '^pg_' AND n.nspname != 'information_schema') reindex_bpchar_ops.sqlChecking for bpchar_pattern_ops indexes Your installation contains hash and/or GIN indexes. These indexes have different internal formats between your old and new clusters, so they must be reindexed with the REINDEX command. The file: %s when executed by psql by the database superuser will recreate all invalid indexes; until then, none of these indexes will be used. Your installation contains hash and/or GIN indexes. These indexes have different internal formats between your old and new clusters, so they must be reindexed with the REINDEX command. After upgrading, you will be given REINDEX instructions. UPDATE pg_catalog.pg_index i SET indisvalid = false FROM pg_catalog.pg_class c, pg_catalog.pg_am a, pg_catalog.pg_namespace n WHERE i.indexrelid = c.oid AND c.relam = a.oid AND c.relnamespace = n.oid AND a.amname IN ('hash', 'gin')REINDEX INDEX %s.%s; \connect %s SELECT n.nspname, c.relname FROM pg_catalog.pg_class c, pg_catalog.pg_index i, pg_catalog.pg_am a, pg_catalog.pg_namespace n WHERE i.indexrelid = c.oid AND c.relam = a.oid AND c.relnamespace = n.oid AND a.amname IN ('hash', 'gin') AND i.indrelid NOT IN ( SELECT DISTINCT c.oid FROM pg_catalog.pg_class c, pg_catalog.pg_namespace n, pg_catalog.pg_attribute a WHERE c.relkind = 'r' AND c.oid = a.attrelid AND NOT a.attisdropped AND a.atttypid = 'pg_catalog.tsvector'::pg_catalog.regtype AND c.relnamespace = n.oid AND n.nspname !~ '^pg_' AND n.nspname != 'information_schema') reindex_hash_and_gin.sqlChecking for hash and GIN indexes Your installation contains tsvector columns. The tsvector internal storage format changed between your old and new clusters so the tables must be rebuilt. The file: %s when executed by psql by the database superuser will rebuild all tables with tsvector columns. Your installation contains tsvector columns. The tsvector internal storage format changed between your old and new clusters so the tables must be rebuilt. After upgrading, you will be given instructions. ALTER COLUMN %s TYPE pg_catalog.tsvector USING %s::pg_catalog.text::pg_catalog.tsvector, ALTER TABLE %s.%s \connect %s SELECT n.nspname, c.relname, a.attname FROM pg_catalog.pg_class c, pg_catalog.pg_namespace n, pg_catalog.pg_attribute a WHERE c.relkind = 'r' AND c.oid = a.attrelid AND NOT a.attisdropped AND a.atttypid = 'pg_catalog.tsvector'::pg_catalog.regtype AND c.relnamespace = n.oid AND n.nspname !~ '^pg_temp_' AND n.nspname !~ '^pg_toast_temp_' AND n.nspname NOT IN ('pg_catalog', 'information_schema')rebuild_tsvector_tables.sqlChecking for tsvector user columnsYour installation contains the "ltree" data type. This data type changed its internal storage format between your old and new clusters so this cluster cannot currently be upgraded. You can manually upgrade databases that use "contrib/ltree" facilities and remove "contrib/ltree" from the old cluster and restart the upgrade. A list of the problem functions is in the file: %s %s.%s Could not open file "%s": %s SELECT n.nspname, p.proname FROM pg_catalog.pg_proc p, pg_catalog.pg_namespace n WHERE p.pronamespace = n.oid AND p.probin = '$libdir/ltree'contrib_ltree.txtChecking for contrib/ltreeYour installation contains the "tsquery" data type. This data type added a new internal field between your old and new clusters so this cluster cannot currently be upgraded. You can remove the problem columns and restart the upgrade. A list of the problem columns is in the file: %s SELECT n.nspname, c.relname, a.attname FROM pg_catalog.pg_class c, pg_catalog.pg_namespace n, pg_catalog.pg_attribute a WHERE c.relkind = 'r' AND c.oid = a.attrelid AND NOT a.attisdropped AND a.atttypid = 'pg_catalog.tsquery'::pg_catalog.regtype AND c.relnamespace = n.oid AND n.nspname !~ '^pg_temp_' AND n.nspname !~ '^pg_toast_temp_' AND n.nspname NOT IN ('pg_catalog', 'information_schema')tables_using_tsquery.txtChecking for tsquery user columnsYour installation contains the "name" data type in user tables. This data type changed its internal alignment between your old and new clusters so this cluster cannot currently be upgraded. You can remove the problem tables and restart the upgrade. A list of the problem columns is in the file: %s fatal %s.%s.%s Database: %s could not open file "%s": %s wSELECT n.nspname, c.relname, a.attname FROM pg_catalog.pg_class c, pg_catalog.pg_namespace n, pg_catalog.pg_attribute a WHERE c.oid = a.attrelid AND a.attnum > 1 AND NOT a.attisdropped AND a.atttypid = 'pg_catalog.name'::pg_catalog.regtype AND c.relnamespace = n.oid AND n.nspname !~ '^pg_temp_' AND n.nspname !~ '^pg_toast_temp_' AND n.nspname NOT IN ('pg_catalog', 'information_schema')tables_using_name.txtChecking for invalid "name" user columnscould not remove file or directory "%s": %s could not stat file or directory "%s": %s %s/%scould not read directory "%s": %s ...could not open directory "%s": %s out of memory "%s" -VPGSYSCONFDIR=%sPGSYSCONFDIRpostgres-9.2child process exited with unrecognized status %dchild process was terminated by signal %dchild process exited with exit code %dpclose failedfgets failureno data was returned by command "%s" popen failurer/%s%scould not read symbolic link "%s"could not change directory to "%s"could not find a "%s" to executecould not read binary "%s"PATHinvalid binary "%s"could not identify current directory: %s..//../usr/local/share/man/usr/local/share/doc//postgresql/usr/local/share/locale/usr/local/lib/postgresql/usr/local/lib/usr/local/include/postgresql/server/usr/local/include/postgresql/usr/local/include/usr/local/etc/postgresql/usr/local/bin/usr/local/share/postgresql%s: out of memory /../..././%s%sUnknown errorU%%%&&"&2&B&R&b&r&&&&&&&&&''"'2'B'R'b'r'''''''''(("(2(B(R(b(r((((((((())")2)B)R)b)r)))))))))**"*2*B*R*b*r*********++"+2+B+x            % @ 1 @ T 4 PJ J  h  o`o"o""o`ohT<+"d"D"b"B"o"O"pt"Pl"ud"c\"kT"r4vD),))("""" % P+ 4 P phTU(WlXX !HW>LWQWTW bn(WyXp\, 2V ;$ < ? T= >04 X4 sB) n(WyXpn(WyXpn(WyXp` _ a n(WyXx0d) n(WyXpn(WyXpq Tt v hyd /Dy! >yT n(WyXpNW @B nxWyXpn(WyXpP 0  l h (s  4 nXXyXp&4 K n(WyXp\e̙{ q8 n(WyXph( w n(WyXpn(WyXpn(WyXpn(WyXA  A PD n(WyXp 0) (T n(WyXp7>6 Vs e8e p n(WyXpn(WyXpn(WyXp  ; &PWHHd lhQ 3*;,WJ)S&\(a 9s )<)P+ 2 (: L',+))t\ )'%6<+"N)V\5 x7 <'p4|  <&(  '@ P{  '&-HU >pKC \Wf n&s(W| L(l UXX !'l&o b (g * !  )P 0\)5_y H,&T +\(\؄fpj }'|) *s Т9  (L&|')\f2 0Y  < /'( l)/ , D  U L*\ c; q |(x hT L  $ ,) V *%    ,' P8  ' &&  0XB 8 )G 'M @T +_ b h  &  * ' * ,* N \' xV &t(W! h(  6 ! ,( l((  9  H |*N l*V '] q y &X.  Ww   ) +{ bO l' 8h3 * fT d '   ̿ ! '' H/ 6  ?  P Y ] ^ o X0^ ` )  ( s @ @}    &  L . DW6  U % i|&o \&w \*  0 * t 0 p 4 \ %   @}! /V O <(<lXCi p4rg {*<*((R c D )n Ĥ8 L)QD Y8  z  ( d,p /H 4   / C0E Z* % , bUM u` %& (pg_upgradecrti.scrt1.ocrt1.s__get_exit_frame_monitor_ptr__do_exit_code_ptrfsr.strap_tablevalues-Xa.cDdata.dataBbss.bssDrodata.rodatacheck.cfix_path_separatorset_locale_and_encodingcheck_is_super_usercheck_for_prepared_transactionscheck_for_reg_data_type_usagecheck_for_isn_and_int8_passing_mismatchcheck_locale_and_encodingcheck_new_cluster_is_emptyget_bin_versioncontroldata.cdump.cexec.ccheck_bin_dircheck_data_dirvalidate_execfile.ccopy_filefunction.cinfo.ccreate_rel_filename_mapget_db_infosget_rel_infosprint_db_infosfree_rel_infosprint_rel_infosoption.ccheck_required_directoryold_8_3_check_ltree_usagepage.cpg_upgrade.csetupprepare_new_clustercopy_clog_xlog_xidprepare_new_databasescreate_new_objectspgfnames_cleanupset_frozenxidscopy_subdir_filesrelfilenode.ctransfer_single_new_dbtransfer_relfileserver.cget_db_connstop_postmaster_atexittablespace.cget_tablespace_pathsset_tablespace_directory_suffixutil.cversion.cversion_old_8_3.cdirmod.cfe_pallocfe_pstrdupfe_repallocresolve_symlinkspipe_read_linepath.ctrim_trailing_separatortrim_directorydir_strcmpmake_relative_pathpgstrcasecmp.cthread.ccrtn.s_END__START_first_dir_separatorpg_reallocfclose__longdouble_usedcheck_new_clustercluster_conn_optsinstall_support_functions_in_new_dbpg_tolower__environ_lockPQstatuspopenpg_freecreate_script_for_old_cluster_deletionfwritegetopt_long_startcheck_cluster_compatibilitystrcpyreport_statusgetenv__posix_getpwuid_rPQconninfoFreesprintfexec_progPQconndefaultsstrncmp__fsr_init_value_get_exit_frame_monitorgeteuidcreate_script_for_cluster_analyzeget_user_infosscanfexecuteQueryOrDiePQfnumberPQescapeStringConnfirst_path_var_separatorstrlcpy_endget_includeserver_pathconnectToServer__1cG__CrunMdo_exit_code6F_v_chmodstart_postmaster_lib_versionget_control_datagenerate_old_dumpatoi_environget_etc_pathreadcheck_loadable_libraries_DYNAMICoutput_files__ctypevsnprintfPQfinishgen_db_file_mapsinit_tablespacescheck_hard_linkreadlinkcheck_okget_man_path_finifputsverify_directories__assertpg_toupperuser_optsget_loadable_librariespclosegetcwdget_share_pathfputcget_db_and_rel_infospg_logfopen64errnoPQgetvaluestrspnfscanfload_directoryquote_identifierold_8_3_invalidate_hash_gin_indexesfprintfjoin_path_componentsget_html_pathpg_putenvlinkAndUpdateFilepg_malloc_GLOBAL_OFFSET_TABLE_mainget_locale_pathmake_native_pathctimedisable_old_clusterold_8_3_check_for_tsquery_usageget_parent_directorystrchrpg_strdupcheck_old_clustercanonicalize_pathPQerrorMessageumaskoptargstrerror_rpgfnamesold_8_3_invalidate_bpchar_pattern_ops_indexesunlinkget_doc_pathchdirsystemperrorpath_is_prefix_of_pathfflushfree_db_and_rel_infosstrlenpath_is_relative_and_below_cwdlog_optsaccesspg_ascii_tolowerpg_strncasecmprmdirlstat64renameget_pg_database_relfilenodePQntuplesgetErrorTextsplit_old_dumppqStrerror__fsrcopyAndUpdateFilestrstrfopen_privgetpwuid_etextfind_my_exechas_drive_prefixold_8_3_create_sequence_scriptfgetsissue_warningsstr2uintpg_ascii_toupperget_sock_diris_server_runningoutput_completion_bannerget_lib_pathPQresultStatusold_8_3_rebuild_tsvector_tablesreaddir64stop_postmasteradjust_data_dir__ioblast_dir_separatorstrtoulget_include_pathpg_strcasecmp___Argvpath_contains_parent_reference_PROCEDURE_LINKAGE_TABLE_PQclearunsetenvnew_9_0_populate_pg_largeobject_metadatarmtreeaborttransfer_all_new_dbspqGetpwuidget_home_path_initfind_other_exec_exitos_infoold_8_3_check_for_name_data_type_usageget_progname_edatauninstall_support_functions_from_new_clusterprint_mapssetlocalestrerrorPQexecclosedirprep_statusPQconnectdbparseCommandLineopendirget_pkglib_pathoutput_check_bannerreport_clusters_compatiblepclose_checkget_pkginclude_pathcheck_pghost_envvarcheck_cluster_versionsstrncpycheck_control_dataget_major_server_version__fpstartset_pglocale_pgservicestrcatanotate anotate0 ,(X+Uf+P+HWLWanotate \,m\,d,p,X./HH/X0^0E22V044\5 9s;$<T=?B) (B./1)448A;<M=?anotate anotate<C$CUMV Vanotate anotate0WWfWw Wanotate anotate`t\/Ht\^_y_`a _anotate anotatedbHbOc;0d)\f2g8h3 c*danotate anotateLlh0lhQipjl ihjanotate anotateo xoq4rgsTtvxVDy!hydyT /rsFtanotate anotateL z) 0@B@Y z j4|lwI |B$ l 2anotate 7|ll}p;|tO}x;||;|;|;|;|;|;|;|;|;| }|;|;|;|;|;|;|;|;|;|;|;|;|;|;|;|;|;|}}}};|;|;|;|;| ;|@};|;|;| %}$|(;|,|0;|4;|8v|<X|anotateLOlLP0lh4(s -!anotate anotateH 0tq |anotate anotate|PlP{̙{Hd`8HUsanotate U8anotate4$bh(wanotate anotate:DТ9 !0Y7Ĥ8;8P8c Ianotate anotate anotate anotatedT4|<̿anotate anotate`HA APDb60 )anotate anotatedTd0)\T4anotate anotatepP   $,h(NV8e @` ps6 anotate anotateXLHLDXBanotate anotate(\)0@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)strings.h 1.3 96/03/12 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)pwd.h 1.22 04/09/28 SMI@(#)setjmp.h 1.38 04/09/28 SMI@(#)setjmp_iso.h 1.2 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)dirent.h 1.37 04/09/28 SMI@(#)dirent.h 1.36 04/09/28 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)strings.h 1.3 96/03/12 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)pwd.h 1.22 04/09/28 SMI@(#)setjmp.h 1.38 04/09/28 SMI@(#)setjmp_iso.h 1.2 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)dirent.h 1.37 04/09/28 SMI@(#)dirent.h 1.36 04/09/28 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)strings.h 1.3 96/03/12 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)pwd.h 1.22 04/09/28 SMI@(#)setjmp.h 1.38 04/09/28 SMI@(#)setjmp_iso.h 1.2 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)dirent.h 1.37 04/09/28 SMI@(#)dirent.h 1.36 04/09/28 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)strings.h 1.3 96/03/12 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)pwd.h 1.22 04/09/28 SMI@(#)setjmp.h 1.38 04/09/28 SMI@(#)setjmp_iso.h 1.2 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)dirent.h 1.37 04/09/28 SMI@(#)dirent.h 1.36 04/09/28 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)strings.h 1.3 96/03/12 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)pwd.h 1.22 04/09/28 SMI@(#)setjmp.h 1.38 04/09/28 SMI@(#)setjmp_iso.h 1.2 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)dirent.h 1.37 04/09/28 SMI@(#)dirent.h 1.36 04/09/28 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)strings.h 1.3 96/03/12 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)pwd.h 1.22 04/09/28 SMI@(#)setjmp.h 1.38 04/09/28 SMI@(#)setjmp_iso.h 1.2 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)dirent.h 1.37 04/09/28 SMI@(#)dirent.h 1.36 04/09/28 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)strings.h 1.3 96/03/12 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)pwd.h 1.22 04/09/28 SMI@(#)setjmp.h 1.38 04/09/28 SMI@(#)setjmp_iso.h 1.2 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)dirent.h 1.37 04/09/28 SMI@(#)dirent.h 1.36 04/09/28 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)strings.h 1.3 96/03/12 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)pwd.h 1.22 04/09/28 SMI@(#)setjmp.h 1.38 04/09/28 SMI@(#)setjmp_iso.h 1.2 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)dirent.h 1.37 04/09/28 SMI@(#)dirent.h 1.36 04/09/28 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)getopt.h 1.1 04/03/29 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)strings.h 1.3 96/03/12 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)pwd.h 1.22 04/09/28 SMI@(#)setjmp.h 1.38 04/09/28 SMI@(#)setjmp_iso.h 1.2 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)dirent.h 1.37 04/09/28 SMI@(#)dirent.h 1.36 04/09/28 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)strings.h 1.3 96/03/12 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)pwd.h 1.22 04/09/28 SMI@(#)setjmp.h 1.38 04/09/28 SMI@(#)setjmp_iso.h 1.2 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)dirent.h 1.37 04/09/28 SMI@(#)dirent.h 1.36 04/09/28 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)langinfo.h 1.11 03/12/04 SMI@(#)nl_types.h 1.14 00/09/16 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)strings.h 1.3 96/03/12 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)pwd.h 1.22 04/09/28 SMI@(#)setjmp.h 1.38 04/09/28 SMI@(#)setjmp_iso.h 1.2 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)dirent.h 1.37 04/09/28 SMI@(#)dirent.h 1.36 04/09/28 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)strings.h 1.3 96/03/12 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)pwd.h 1.22 04/09/28 SMI@(#)setjmp.h 1.38 04/09/28 SMI@(#)setjmp_iso.h 1.2 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)dirent.h 1.37 04/09/28 SMI@(#)dirent.h 1.36 04/09/28 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)strings.h 1.3 96/03/12 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)pwd.h 1.22 04/09/28 SMI@(#)setjmp.h 1.38 04/09/28 SMI@(#)setjmp_iso.h 1.2 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)dirent.h 1.37 04/09/28 SMI@(#)dirent.h 1.36 04/09/28 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)strings.h 1.3 96/03/12 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)pwd.h 1.22 04/09/28 SMI@(#)setjmp.h 1.38 04/09/28 SMI@(#)setjmp_iso.h 1.2 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)dirent.h 1.37 04/09/28 SMI@(#)dirent.h 1.36 04/09/28 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.16 09/07/02 SMI@(#)procset.h 1.25 04/07/16 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)strings.h 1.3 96/03/12 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)pwd.h 1.22 04/09/28 SMI@(#)setjmp.h 1.38 04/09/28 SMI@(#)setjmp_iso.h 1.2 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)dirent.h 1.37 04/09/28 SMI@(#)dirent.h 1.36 04/09/28 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)strings.h 1.3 96/03/12 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)pwd.h 1.22 04/09/28 SMI@(#)setjmp.h 1.38 04/09/28 SMI@(#)setjmp_iso.h 1.2 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)dirent.h 1.37 04/09/28 SMI@(#)dirent.h 1.36 04/09/28 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)strings.h 1.3 96/03/12 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)pwd.h 1.22 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)dirent.h 1.37 04/09/28 SMI@(#)dirent.h 1.36 04/09/28 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)strings.h 1.3 96/03/12 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)pwd.h 1.22 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.16 09/07/02 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)unistd.h 1.76 06/03/10 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)strings.h 1.3 96/03/12 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)pwd.h 1.22 04/09/28 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)unistd.h 1.76 06/03/10 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)strings.h 1.3 96/03/12 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)pwd.h 1.22 04/09/28 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)strings.h 1.3 96/03/12 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)pwd.h 1.22 04/09/28 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ld: Software Generation Utilities - Solaris Link Editors: 5.10-1.497kcheck.c /var/tmp/postgresql-9.2.0/contrib/pg_upgrade /opt/solstudio12.2/prod/bin/cc -Xa -v -O -DFRONTEND -DDLSUFFIX='".so"' -I. -I../../src/interfaces/libpq -I. -I. -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c check.cXa;O;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0wcontroldata.c /var/tmp/postgresql-9.2.0/contrib/pg_upgrade /opt/solstudio12.2/prod/bin/cc -Xa -v -O -DFRONTEND -DDLSUFFIX='".so"' -I. -I../../src/interfaces/libpq -I. -I. -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c controldata.cXa;O;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0Ri,dump.c /var/tmp/postgresql-9.2.0/contrib/pg_upgrade /opt/solstudio12.2/prod/bin/cc -Xa -v -O -DFRONTEND -DDLSUFFIX='".so"' -I. -I../../src/interfaces/libpq -I. -I. -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c dump.cXa;O;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0iBexec.c /var/tmp/postgresql-9.2.0/contrib/pg_upgrade /opt/solstudio12.2/prod/bin/cc -Xa -v -O -DFRONTEND -DDLSUFFIX='".so"' -I. -I../../src/interfaces/libpq -I. -I. -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c exec.cXa;O;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0iXfile.c /var/tmp/postgresql-9.2.0/contrib/pg_upgrade /opt/solstudio12.2/prod/bin/cc -Xa -v -O -DFRONTEND -DDLSUFFIX='".so"' -I. -I../../src/interfaces/libpq -I. -I. -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c file.cXa;O;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0Lqnfunction.c /var/tmp/postgresql-9.2.0/contrib/pg_upgrade /opt/solstudio12.2/prod/bin/cc -Xa -v -O -DFRONTEND -DDLSUFFIX='".so"' -I. -I../../src/interfaces/libpq -I. -I. -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c function.cXa;O;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0iinfo.c /var/tmp/postgresql-9.2.0/contrib/pg_upgrade /opt/solstudio12.2/prod/bin/cc -Xa -v -O -DFRONTEND -DDLSUFFIX='".so"' -I. -I../../src/interfaces/libpq -I. -I. -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c info.cXa;O;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0moption.c /var/tmp/postgresql-9.2.0/contrib/pg_upgrade /opt/solstudio12.2/prod/bin/cc -Xa -v -O -DFRONTEND -DDLSUFFIX='".so"' -I. -I../../src/interfaces/libpq -I. -I. -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c option.cXa;O;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0Cipage.c /var/tmp/postgresql-9.2.0/contrib/pg_upgrade /opt/solstudio12.2/prod/bin/cc -Xa -v -O -DFRONTEND -DDLSUFFIX='".so"' -I. -I../../src/interfaces/libpq -I. -I. -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c page.cXa;O;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0upg_upgrade.c /var/tmp/postgresql-9.2.0/contrib/pg_upgrade /opt/solstudio12.2/prod/bin/cc -Xa -v -O -DFRONTEND -DDLSUFFIX='".so"' -I. -I../../src/interfaces/libpq -I. -I. -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c pg_upgrade.cXa;O;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0wrelfilenode.c /var/tmp/postgresql-9.2.0/contrib/pg_upgrade /opt/solstudio12.2/prod/bin/cc -Xa -v -O -DFRONTEND -DDLSUFFIX='".so"' -I. -I../../src/interfaces/libpq -I. -I. -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c relfilenode.cXa;O;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0>mserver.c /var/tmp/postgresql-9.2.0/contrib/pg_upgrade /opt/solstudio12.2/prod/bin/cc -Xa -v -O -DFRONTEND -DDLSUFFIX='".so"' -I. -I../../src/interfaces/libpq -I. -I. -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c server.cXa;O;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0utablespace.c /var/tmp/postgresql-9.2.0/contrib/pg_upgrade /opt/solstudio12.2/prod/bin/cc -Xa -v -O -DFRONTEND -DDLSUFFIX='".so"' -I. -I../../src/interfaces/libpq -I. -I. -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c tablespace.cXa;O;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0iutil.c /var/tmp/postgresql-9.2.0/contrib/pg_upgrade /opt/solstudio12.2/prod/bin/cc -Xa -v -O -DFRONTEND -DDLSUFFIX='".so"' -I. -I../../src/interfaces/libpq -I. -I. -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c util.cXa;O;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0@o4version.c /var/tmp/postgresql-9.2.0/contrib/pg_upgrade /opt/solstudio12.2/prod/bin/cc -Xa -v -O -DFRONTEND -DDLSUFFIX='".so"' -I. -I../../src/interfaces/libpq -I. -I. -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c version.cXa;O;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0Jversion_old_8_3.c /var/tmp/postgresql-9.2.0/contrib/pg_upgrade /opt/solstudio12.2/prod/bin/cc -Xa -v -O -DFRONTEND -DDLSUFFIX='".so"' -I. -I../../src/interfaces/libpq -I. -I. -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c version_old_8_3.cXa;O;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.08`dirmod.c /var/tmp/postgresql-9.2.0/src/port /opt/solstudio12.2/prod/bin/cc -Xa -v -O -I../../src/port -DFRONTEND -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c dirmod.cXa;O;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0A4vexec.c /var/tmp/postgresql-9.2.0/src/port /opt/solstudio12.2/prod/bin/cc -Xa -v -O -I../../src/port -DFRONTEND -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c exec.cXa;O;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.04path.c /var/tmp/postgresql-9.2.0/src/port /opt/solstudio12.2/prod/bin/cc -Xa -v -O -I../../src/port -DFRONTEND -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c path.cXa;O;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0Dpgstrcasecmp.c /var/tmp/postgresql-9.2.0/src/port /opt/solstudio12.2/prod/bin/cc -Xa -v -O -I../../src/port -DFRONTEND -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c pgstrcasecmp.cXa;O;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0othread.c /var/tmp/postgresql-9.2.0/src/port /opt/solstudio12.2/prod/bin/cc -Xa -v -O -D_REENTRANT -D_THREAD_SAFE -D_POSIX_PTHREAD_SEMANTICS -I../../src/port -DFRONTEND -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c thread.cXa;O;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0gNH /var/tmp/postgresql-9.2.0/contrib/pg_upgradecheck.cTN /var/tmp/postgresql-9.2.0/contrib/pg_upgradecontroldata.cMG /var/tmp/postgresql-9.2.0/contrib/pg_upgradedump.cMG /var/tmp/postgresql-9.2.0/contrib/pg_upgradeexec.cMG /var/tmp/postgresql-9.2.0/contrib/pg_upgradefile.cQK /var/tmp/postgresql-9.2.0/contrib/pg_upgradefunction.cMG /var/tmp/postgresql-9.2.0/contrib/pg_upgradeinfo.cOI /var/tmp/postgresql-9.2.0/contrib/pg_upgradeoption.cMG /var/tmp/postgresql-9.2.0/contrib/pg_upgradepage.cSM /var/tmp/postgresql-9.2.0/contrib/pg_upgradepg_upgrade.cTN /var/tmp/postgresql-9.2.0/contrib/pg_upgraderelfilenode.cOI /var/tmp/postgresql-9.2.0/contrib/pg_upgradeserver.cSM /var/tmp/postgresql-9.2.0/contrib/pg_upgradetablespace.cMG /var/tmp/postgresql-9.2.0/contrib/pg_upgradeutil.cPJ /var/tmp/postgresql-9.2.0/contrib/pg_upgradeversion.cXR /var/tmp/postgresql-9.2.0/contrib/pg_upgradeversion_old_8_3.cE? /var/tmp/postgresql-9.2.0/src/portdirmod.cC= /var/tmp/postgresql-9.2.0/src/portexec.cC= /var/tmp/postgresql-9.2.0/src/portpath.cKE /var/tmp/postgresql-9.2.0/src/portpgstrcasecmp.cE? /var/tmp/postgresql-9.2.0/src/portthread.c DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD%.interp.SUNW_cap.hash.dynsym.dynstr.SUNW_version.rel.data.rel.bss.rel.plt.text.init.fini.rodata.rodata1.got.dynamic.bssf.symtab.strtab.annotate.comment.debug_info.debug_line.debug_abbrev.shstrtab o !"h )o""P7 B""A B"" J B"" N%%SP+P+Y44_PPeppmJxvhThTl{UUP;(W(WDlXlXEXX`, lX ,qo0x ɕ y  G070701000894de000081ed000000000000000000000001504ffe4f00009cf8000000b500010002ffffffffffffffff0000001e00000000root/usr/local/bin/pg_standbyELF4p4 (44oF@F@H@H@h@@H/usr/lib/ld.so.1t  !#%&(+/01245789:<=>?@DEFGIJLMNOPQSUVWXYZ[]^_`abcdfghijklnopq "$')*,-.36;ABCHKRT\emrs dDR+@B43 :* K^d2 sx30   ( R@R\B0S.V 30 4B%*  >8SC1 Q4YDBhqB|RBT1 ,@B!3 4St 3E BB!h3) *  "B%R,1 C* TpFZDd1 q*  RtTt1 1p <.( 0 Bd  #R*4 DBIBV]tFiR}r- ThBB+ T+ 41 0 $tJtN*JCN|Jaidp$F@p{ d.N xJ1 DH@R0 strncmpsignalatexitstrcatxlogFilePath_environ_finimake_native_path__posix_getpwuid_rget_parent_directorykillpqGetpwuidatoireaddir64mainstat64getoptget_progname_DYNAMICgetpidrestoreCommandTypestrspn___ArgvarchiveLocation_lib_versionget_etc_pathstrerrorsystem_edatafirst_path_var_separator_endget_html_pathstrlcpy__environ_locksnprintfmaxretriesfprintfpriorWALFileNamemaxwaittimeget_pkglib_path_inittriggerPathselectreadpg_usleep__iobclosepqStrerrorlast_dir_separator_get_exit_frame_monitorkeepfilesoptargget_includeserver_pathhas_drive_prefixerrno__fpstartget_man_pathfirst_dir_separatoroptopt_exitget_locale_pathget_home_pathpath_is_relative_and_below_cwdget_share_pathsleeptimestrcmpstrdup_start__1cG__CrunMdo_exit_code6F_v_geteuidopterr_PROCEDURE_LINKAGE_TABLE_putsneed_cleanupstrlenWALFilePathstat_bufpath_contains_parent_referencestrstr__longdouble_useddebugcanonicalize_pathsscanfjoin_path_componentsget_lib_pathget_include_pathclosedirnextWALFileTypeabortrestoreCommandexclusiveCleanupFileNamestrerror_rrestartWALFileNameopendiropen64__fsr_init_valuestrchrftruncate64_etext__fsrpath_is_prefix_of_pathnextWALFileNameget_doc_pathstrcpyfflush_GLOBAL_OFFSET_TABLE_optindunlinkget_pkginclude_pathlibrt.so.1SUNW_1.2libc.so.1SUNW_1.22SUNWprivate_1.1libxslt.so.1libxml2.so.2libpam.so.1libssl.so.0.9.8libcrypto.so.0.9.8libkrb5.so.3libcom_err.so.3libgssapi_krb5.so.2libz.solibreadline.so.6libcurses.so.1libnsl.so.1libsocket.so.1libm.so.2/usr/local/lib:/usr/local/lib '= &/y9qN CdBIB0pF:R7RqR>RKT@;X@@\@`@?d@$h@l@&p@ot@Px@|@F@d@@r@]@@n@Y@e@.@@h@2@@S@@@ @ @M@g@"@@U@G@_@J@-@b@ @55L@%P@%T@h%X@h%\@h%`@h%d@h %h@h(%l@h0%p@h8p%t@h@`%x@hHP%|@hP@%@hX0%@h` %@hh%@hp%@hx%@h%@h%@h%@h%@h%@h%@h%@hp%@h`%@hP%@h@%@h0%@h %@h%@h%@h%@h%@h%@h%@h%@h %@h(%@h0%@h8p%@h@`jjR@toh3e`BtdBt PGE@Bu T@BRU \BRPl[ PjURQt`|$уlB D$td$у`tƒ 3fd$f T$tfd$f L$l$YZ]US5xJ50Shx>hhtFq Rt,u' 5RhtFhd>hhN> % 5RhtFhT>hhN hR50Su[50S5Rh(>BSSjUS RPhtF 5xJvUh>5xJu: h45xJh4xJ+PtjRR3 tF3ɻ;}5=Bth=BSS j33tJtJ[ÐUSVW =tJ 50S< V؅{ Wh>WuphJS}X W50Shx>hhtF =BthtFh=hB htFbuU VB؅L=Bth=hB V.hB _^[ûBtF 5pFPW5Rh=Sh 뎃 5pFP50S5Rh|=hB6 wUSVWE3EE|Jt=5xJP;~35|JhJz3ۃ=B~{ uV}WEPhl=5xJS 3ۃ}vQvKBi+;w+ˉ @+ˁ;s 33 +ȉE0E0E0hl=jhJ Ã_^[ÐUSV 4SRQPR Rjj54S؅j EPSvQDjEh<PcjEh<PEBh<BV=VD jjS|> S)BhH=BSS ^[à 5pFdP54Sh=VV둃 S 54Sh<BSSBhH=BVdVkSRa 5pFP54Sh=BV"V)S 5pFP54Sh$=BSSUSV3ۀ=Bth<BVV=B|7 hNtEBi@BC P;B~ɀ=Bth<hBB30=Bt"h4hB hB#^[U5Rh@<h45Rh;h;h;hh;h:h:hD:h9h9hT9yh9lh8_h8Rh7EÐUBÐUjj19jP>USV ] 3 Ru~lh7sah7sFh7sBh7s'h jh jph ja h7SV6M $d( 5RPBR4S 5RBH;v} 5RB}^ 5RB}?B1R%5Rh6hB@jh7SV8]R;M 0S@RR;M xJ@RR;M R@RR;}M |J@R^B=B4Su5Ph5BSV 5xJh5SB htFh5S/ 5Rh|5S=BP5T5P5BhX5S=B4 4P5Bh05S hNh5Sh4S=Buh4ShJh4St Sx 5xJwh>5xJh h4?5xJ/h4xJ+P9uLtJR=Bth4BSS jY=Bt6B=B h4BSnSu=Bpt({=Bta j=BB< i@BPz BBB B;|7~3B=Bt Ph`4BSS=BhD4BS=4Sth$4Sph=S_SfE j h7j5Rh7hBj5Rh(7hBj|5RhL7hBjRg5Rhl7hBj(=5Rh6hBXj:5Rh6BV- 5Rh6Vj5RhD6BV 5Rh6Vj5Rh5BV 5Rh6VjA j/ j j / j*@"7"L"L"L"L"L"L""q"L"L"L"L"L"!!!L"L"!USB8tR<R;UE 9-AYu-u yTH BR:Pux:t#RB8R RB8ueA R9MLB>E8:t.=Rt5Rh>hB?:E RRB>A RRR=R-tEB8uBR=Rt#E8:t5Rh>hB^?9B>(BRB>B>[U3ÐUEt/t @u3UEt:t @u3UU 3t/uB uUÐUSVW ]ME ;thPQ.u{/u.u{/ttJE 8u(@,@ uZuMSWh0@+QuV ] _^[USVW(u7]˅t,3/u t C/t;t/CAuuu3ۃ u}h @E0u`h$@>Ph @E0|Eh>Pct\h@E0JtCE8tl PKE8,h @Ph E0C E0mEK~gÅ3|AE0>WVWVWVWV}ͅ~uh>VKh@u_^[ÐUSu h@ut4jh>E0th@E0Wt(}3h>EDP[UE8/u3 PQUSuQ Su uuE /t 3[ÐUSV utXE St^[ÃSh@hBlݐUSVW}M t2t;:t /uu ÐUuh?h>u ÐUuh?h>u ÐUSDDžw ShRQPd t3hpuD[UEEUE8tc P9M T|/u;vJ:/u;wE;v J:/t;wE;vz/u J;vz/t;Uu:/uBÐUuM;vJ;v|/u J;v:/tUM~6C+ЍEUi@B+ʉM Pjjjj4 U uu u(t8@E ÐUuuuu u E8t3UWVS[y [^_UWVS[] [^_OK foreversecondsUsage: .backup Checking for trigger file...WAL file not present yet.Timed out after %d seconds: fast failover signaled to exit: fast failover history file not found .historyno cleanup required %s and later Keep archive history: Command for restore: %s Max wait interval: %d %s sSleep interval: %d second%s Restoring to: %s WAL file path: %s Waiting for WAL file: %s Trigger file: %s %s: must specify xlog destination as third non-option argument (use "%%p") %s: must specify WAL file name as second non-option argument (use "%%f") %s: must specify archive location %s: not enough command-line arguments Try "%s --help" for more information. %s: -w maxwaittime incorrectly set %s: -s sleeptime incorrectly set %s: -r maxretries must be >= 0 %s: -k keepfiles must be >= 0 cdk:lr:s:t:w:pg_standby (PostgreSQL) 9.2.0-V--version-?--help Report bugs to . Main intended use as restore_command in recovery.conf: restore_command = 'pg_standby [OPTION]... ARCHIVELOCATION %%f %%p %%r' e.g. restore_command = 'pg_standby /mnt/server/archiverdir %%f %%p %%r' -?, --help show this help, then exit -w MAXWAITTIME max seconds to wait for a file (0=no limit) (default=0) -V, --version output version information, then exit -t TRIGGERFILE trigger file to initiate failover (no default) -s SLEEPTIME seconds to wait between file checks (min=1, max=60, default=5) -r MAXRETRIES max number of times to retry, with progressive wait (default=3) -l does nothing; use of link is now deprecated -k NUMFILESTOKEEP if RESTARTWALFILE is not used, remove files prior to limit (0 keeps all) -d generate lots of debugging output (testing only) -c copy file from archive (default) Options: %s [OPTION]... ARCHIVELOCATION NEXTWALFILE XLOGFILEPATH [RESTARTWALFILE] %s allows PostgreSQL warm standby servers to be configured. not restored running restore: WARNING: invalid content in "%s" trigger file found: fast failover fastsmartWARNING: could not read "%s": %s WARNING: could not open "%s": %s trigger file found: smart failover %08X%08X%08X%s: could not open archive location "%s": %s %s: ERROR: could not remove file "%s": %s removing file "%s"file size greater than expected 0123456789ABCDEF%s: archive location "%s" does not exist cp "%s" "%s"ln -s -f "%s" "%s"%s/%soption requires an argument -- %c illegal option -- %c ..//../usr/local/share/man/usr/local/share/doc//postgresql/usr/local/share/locale/usr/local/lib/postgresql/usr/local/lib/usr/local/include/postgresql/server/usr/local/include/postgresql/usr/local/include/usr/local/etc/postgresql/usr/local/bin/usr/local/share/postgresql%s: out of memory /../..././%s%sUnknown error@JZjz *:JZjz *:JZjzS`my/ 3 3,  8 oodoHo`oH@>, d 4  3 3 34H@@@BBB8S !`B>dBQWlB bn@ByB3   x E $B- G M  XBa $ nByB3qnByB3z26 t2s  /e t/ n@ByB3n@ByB3n@ByB3dD R@B!3 '* 8Kd2 `e30 pu  ( R@R\B0S.V 30 4 B*  +8S01 >4FDBU^BiqRBT1 @B!3 4St 3E BB!h3) *  "BR1 0* ApFGDQ1 ^*  rRytzTt1 1p <.( 0 Bd   R4 *B/B<CtFORjX- wT~hBB+ T+ 41 0 $tJtNJ)4|JGOdVg$nzF@p{ d.N xJ1 DH@R0 pg_standbycrti.scrt1.ocrt1.s__get_exit_frame_monitor_ptr__do_exit_code_ptrfsr.strap_tablevalues-Xa.cDdata.dataBbss.bssDrodata.rodatapg_standby.cCustomizableInitializeCustomizableNextWALFileReadyCustomizableCleanupPriorWALFilesSetWALFileNameForCleanupCheckForExternalTriggerFailoverRestoreWALFileForRecoveryusagesighandlersignaledsigquit_handlergetopt.cpath.ctrim_trailing_separatortrim_directorydir_strcmpmake_relative_pathpgsleep.cthread.ccrtn.s_END__START_strncmpsignalatexitstrcatxlogFilePath_environ_finimake_native_path__posix_getpwuid_rget_parent_directorykillpqGetpwuidatoireaddir64mainstat64getoptget_progname_DYNAMICgetpidrestoreCommandTypestrspn___ArgvarchiveLocation_lib_versionget_etc_pathstrerrorsystem_edatafirst_path_var_separator_endget_html_pathstrlcpy__environ_locksnprintfmaxretriesfprintfpriorWALFileNamemaxwaittimeget_pkglib_path_inittriggerPathselectreadpg_usleep__iobclosepqStrerrorlast_dir_separator_get_exit_frame_monitorkeepfilesoptargget_includeserver_pathhas_drive_prefixerrno__fpstartget_man_pathfirst_dir_separatoroptopt_exitget_locale_pathget_home_pathpath_is_relative_and_below_cwdget_share_pathsleeptimestrdup_start__1cG__CrunMdo_exit_code6F_v_geteuidopterr_PROCEDURE_LINKAGE_TABLE_putsneed_cleanupstrlenWALFilePathstat_bufpath_contains_parent_referencestrstr__longdouble_useddebugcanonicalize_pathsscanfjoin_path_componentsget_lib_pathget_include_pathclosedirnextWALFileTypeabortrestoreCommandexclusiveCleanupFileNamestrerror_rrestartWALFileNameopendiropen64__fsr_init_valuestrchrftruncate64_etext__fsrpath_is_prefix_of_pathnextWALFileNameget_doc_pathstrcpyfflush_GLOBAL_OFFSET_TABLE_optindunlinkget_pkginclude_pathanotate anotate0 ,(@3y`BdBanotatelxE  $ c(\!d(yZ9* d(Tanotate J! Y! h! !d(d(@"h(7"l(L"p(L"t(L"x(L"|(L"(L"("(q"(L"(L"(L"(L"(L"(!(!(!(L"(L"(!anotate( (anotate anotatep*P** * * *++-<.(d.N.V /et/0000141T1t11111pd2t2s26 d00q2anotate anotate 3E 3Eanotate(h3\h3)30@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)strings.h 1.3 96/03/12 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)pwd.h 1.22 04/09/28 SMI@(#)dirent.h 1.37 04/09/28 SMI@(#)dirent.h 1.36 04/09/28 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.16 09/07/02 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)getopt.h 1.1 04/03/29 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)strings.h 1.3 96/03/12 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)pwd.h 1.22 04/09/28 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)strings.h 1.3 96/03/12 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)pwd.h 1.22 04/09/28 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)unistd.h 1.76 06/03/10 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)strings.h 1.3 96/03/12 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)pwd.h 1.22 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)strings.h 1.3 96/03/12 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)netdb.h 1.30 03/12/04 SMI@(#)in.h 1.55 09/05/27 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.133 09/07/17 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)uio.h 1.34 09/06/15 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)seg_enum.h 1.9 09/07/02 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.38 09/05/07 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)pwd.h 1.22 04/09/28 SMIacomp: Sun C 5.11 SunOS_i386 145355-01 2010/10/11iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ld: Software Generation Utilities - Solaris Link Editors: 5.10-1.4976pg_standby.c /var/tmp/postgresql-9.2.0/contrib/pg_standby /opt/solstudio12.2/prod/bin/cc -Xa -v -O -I. -I. -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c pg_standby.cXa;O;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.08getopt.c /var/tmp/postgresql-9.2.0/src/port /opt/solstudio12.2/prod/bin/cc -Xa -v -O -I../../src/port -DFRONTEND -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c getopt.cXa;O;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0W4,path.c /var/tmp/postgresql-9.2.0/src/port /opt/solstudio12.2/prod/bin/cc -Xa -v -O -I../../src/port -DFRONTEND -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c path.cXa;O;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0:Bpgsleep.c /var/tmp/postgresql-9.2.0/src/port /opt/solstudio12.2/prod/bin/cc -Xa -v -O -I../../src/port -DFRONTEND -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c pgsleep.cXa;O;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.0oXthread.c /var/tmp/postgresql-9.2.0/src/port /opt/solstudio12.2/prod/bin/cc -Xa -v -O -D_REENTRANT -D_THREAD_SAFE -D_POSIX_PTHREAD_SEMANTICS -I../../src/port -DFRONTEND -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c thread.cXa;O;R=Sun C 5.11 SunOS_i386 145355-01 2010/10/11;backend;raw;cd;DBG_GEN 5.3.01SM /var/tmp/postgresql-9.2.0/contrib/pg_standbypg_standby.cE? /var/tmp/postgresql-9.2.0/src/portgetopt.cC= /var/tmp/postgresql-9.2.0/src/portpath.cF@ /var/tmp/postgresql-9.2.0/src/portpgsleep.cE? /var/tmp/postgresql-9.2.0/src/portthread.c DD% DD% DD% DD% DD%.interp.SUNW_cap.hash.dynsym.dynstr.SUNW_version.rel.data.rel.bss.rel.plt.text.init.fini.rodata.rodata1.got.dynamic.bssf.symtab.strtab.annotate.comment.debug_info.debug_line.debug_abbrev.shstrtab o @!", , 8)oddP7 BA B0J BH N44SY33_33e33m44F vH@H@{@@H;@B@BpBBEBBB O NoU|PZ4K_ z $n  070701000894db000081ed000000000000000000000001504ffe4d0000f898000000b500010002ffffffffffffffff0000002200000000root/usr/local/bin/pg_receivexlogELF 44 (44oninipipijjP/usr/lib/ld.so.1  "%*+-./0123789;>?ABDEFGHKNOPTUVXZ[^_abdefgijknrstuvwxyz|}~!#$&'(),456:<=@CIJLMQRSWY\]`chlmopq{,lPl"pQ 3:DlB J QK fK w0q~Q V I PR 2  pR C @Q (/p5>@!{ DB Q0Q `Q p}W08qP 4K  G ")hm/`m6lJ MgPy@  ni`t?  "p ,K piPm> DN PQ (P7E@ LQ `|lk4qtV0  tK  *hm!0 hm'`N(  (l! ( -l50R BJpTG dnSE   (lx@`0@\mR xV) Tt Pdm@`gPOV p! ?,qF0OWON n vPp`__environ_lock__longdouble_usedget_include_pathgetcwd___Argvfopen64selectjoin_path_componentsmake_native_pathoptindPQgetvaluefstat64get_lib_pathsnprintf_initpclosepclose_checkget_html_pathPQerrorMessageputenvReceiveXlogStreamget_man_pathatoifcloseget_includeserver_pathfprintffgetsPQsocket__fsrfind_my_execget_share_pathget_pkglib_pathgettimeofday_lib_versionPQconsumeInput_endfputstcgetattrfirst_dir_separatorcanonicalize_pathtime_to_abortdbgetpasswordget_home_pathgeteuidPQfreemem_fini_exitbasediropendir__fsr_init_valueget_parent_directorytcsetattrmainPQresultErrorMessage_DYNAMICclosedirstrstrInvalidXLogRecPtrgetenverrnostrcatstandby_message_timeoutPQfinishstrlcpylseek64fputcfirst_path_var_separatormemcpyperrorxstrdupsscanfmemset__iobdbuserset_pglocale_pgservicePQconnectionNeedsPasswordPQparameterStatusPQexec_start_etextfsyncGetConnection_get_exit_frame_monitorchdirhas_drive_prefix_GLOBAL_OFFSET_TABLE_connstrcmpxmalloc0path_contains_parent_referenceget_etc_pathPQresultStatusPQgetCopyDatafilenoget_pkginclude_pathnoloopget_prognamepqGetpwuidstrerror_rlast_dir_separator_PROCEDURE_LINKAGE_TABLE_PQflush_edataaccessPQconnectdbParamspopenpath_is_relative_and_below_cwdstrncpy_environ__posix_getpwuid_rfreeverboseget_doc_path__div64PQnfieldsfind_other_execsetlocalepg_usleep__fpstartatexitstrerrorPQgetResultdbportPQclearget_locale_pathpqStrerrorsimple_promptunlinkstrlenwritedbhoststrcpystrncmpPQputCopyDatagetopt_longrename__1cG__CrunMdo_exit_code6F_v_optargreadlink__rem64path_is_prefix_of_pathlstat64readdir64fflushmallocPQntuplespqsignalPQstatuslibrt.so.1SUNW_1.2libc.so.1SUNW_1.22SUNWprivate_1.1libpq.so.5libxslt.so.1libxml2.so.2libpam.so.1libssl.so.0.9.8libcrypto.so.0.9.8libkrb5.so.3libcom_err.so.3libgssapi_krb5.so.2libz.solibreadline.so.6libcurses.so.1libnsl.so.1libsocket.so.1libm.so.2/usr/local/lib:/usr/local/lib '= yqN LlhmL(q?,q0q |iiQii1iipi3ii]iiJiBii.i;iiRiaiizi iiiiii&ii iiviDijjUj j"jyjj/j jl$jb(jG,jK0j4j8j$pjXtjxj|jjjqjjjHj|jjCj@jj<j~j-jj6jcj'j7jYjhjujW5ti%xi%|ih%ih%ih%ih%ih %ih(%ih0%ih8p%ih@`%ihHP%ihP@%ihX0%ih` %ihh%ihp%ihx%ih%ih%ih%ih%ih%ih%ih%ihp%ih`%ihP%ih@%ih0%ih %ih%ih%ih%ih%jh%jh%jh% jh %jh(%jh0%jh8p%jh@`% jhHP%$jhP@%(jhX0%,jh` %0jhh%4jhp%8jhx% ,qb Q\mU 5,qdm= 5,ql%54qhXhmj ShlhpXVW E90q=l2h(j=Hmr4q=|l;jPh`Whm@h@KL_(븃 hXqj6 j5,q54qh,XhmjQ54qhPXhmjk ,qp0qM 454qhWmS| 54qhXShj54qhWmS= 54qhXS)jPhWhmj| jj*****************)** *****************v******)*D***)**)*USVWEPuuh|dj@uWuuhldXhP8hXhP؃XVS`N4V83 tb  h p3h VS= u} rك VjjjS u ÁĜ_^[à 5(qXPQ54qhLchmS밃 5(qUPXP54qhchmVS3XP4RhXv4P54qhchm>S 5(qXPQ54qhdhmS 5(qrXPQ54qh8dhm USVjjj5Lm$ڋы u 5Lm/ 5LmLm t#}uu 54qhpbhm [ u uhldhPUu uhbhP6PQuC/ 5(q4Pu 54qhbhmx 3^[à 5(qPE 054qhbhm: 3 5(qPu 54qhbhm Lm3녃 5(qPu 54qhchm 3QUSVjEP]Ui@B@B ā^[ÐUSV]EM +]3;}S ƃu @BÙjh@BVS5Mx @Bƃ|jh@BVS!؋E 3ɋEE^[USV]EM +]Ui;^[ÐUSVW|} ]3WWE>h^uV  V+ VjjV P>uZjjVP9Eu V54qhDahmV3"54qhahmV3 VIVN jjPS54qhahmPVW3 SWh,ahPPuS SU$iDžDžt PE tjuЃE$ PVW8 9=W WAEIMQUƅ8rj!8Pu E0jPu؅\kwbjAQPLmu !jjjRʋLm3 ,GEEDž=+u: 8Pp0a ЉLmWDPRLm;+ߍ=s uTj8P0Lmjp0Lm3|Dž=~ +u5 8Puu1 ЉLmqWDPRLm;+ߋ=ru)8jPuȋLm3hjhPE0؍E0ȸ hu3GPSQPVWs  E0KSjhjQ@PE }(q< E0&T=Lmt(E(8PQuLmV54qh_hm%Lm[jjjRPV54qh_hm LmS54qh`hmLmP54qh$`hmLmS54qhP`hmxLmE 0 S SMt=juЃu#54qh^hmLm7t PLmLm1t PLmLm3|_^[à E0Ph^54qh@bhmRVY3뷃 5(q8PQW54qhT_hm LmIE 0P54qh`hmLm Px 5(qO8PQ54qhbhm S>P54qh_hmeLm PP54qh`hm5LmkE 0:P54qh`hmLm7E 0P54qh`hmLm Rf 5(q=8PQ54qhbhm} S,Pha54qh@bhmNSU3USu؅tÃ[Ã54qhehmjѐUSVWuV؅ éudw\ 3;sbq+ÃG;v3|!3BBB BB;v;w;vVjSà _^[Ã54qhehm1jNUSVW39dmt9`mtC9\mtCC4 VV3ɋeeGFeGe4qF9 dmtG edmF 9 `mte`mB9 \mte\mE]Et P=Tmt MDxeTmDXm/=Xmu&jjdhlefEMDxeDjVW؅ Su4 St$=XmtXm S7 Sv VWh eSktUhdVdusEtTmÃ_^[Ã54qhHehmj)54qhdhmS,jx54qhdhmSjOZ SP54qh ehmeSVW3UShSu|SC%=tBjE0+jE0ut3 Ĕ[ÐUSVhPn u.E8/tPQu nhPu E ƀ u u u E 0%E 0hgmSSj J hg@k8bu M Dž3ۉt C SDu SÉ+ÍP+H#…v+PSQwD8/t,PPV VVPV VfVqu'Vhghmhmj  tt8 Vo)uh\gmSDSj ^[à 5(q PhgmSSj ZUSVWXhPu V؅t V!toCރXPSp%=hWS|P=sIƄWVkVh8ghmhmj hShgmSSj <SPoh]utpPPP34XPt3-XPh8gmSSSj Ĝ_^[à 5(q PhgmSSj h뾃 5(q PhgmSSj 1뇐USVxuuu} 6t 6,66hgu h g+QS6tZ6hehP EjdPQ9t!EuPu3 p^[ÐUSVWhxmymVk3=(qhgu`؅=(qSuu Nt SruE 33/C t,E0hfV. S3 _^[à hf؃ hf3ҐUSutVv.u'PhXfmSSj LPh$fmSSj (PhfmSUSj 3[à hf+ߐU hfu >thfjPu'|t hf?u`PQrPhehPP/PDPU3ÐUEt/t @u3UEt:t @u3UU 3t/uB uUÐUSVW ]ME ;thPQ.u{/u.u{/ttJE 8u8iPh0iE0|EhgPt\h,iE0tCE8tl PKE8,h0iP E0C E0mEK~gÅ3|AE0gWVWVWVWV}ͅ~uhgVKh,iu_^[ÐUSu}h,iu[t4jhgE0`th$iE0Wt(}3hgEDP[UE8/u3 PQUSu Su uuE /t 3[ÐUSV utXE St^[ÃShihm\ݐUSVW}M t2t;:t /uM;vJ;v|/u J;v:/tUM~6C+ЍEUi@B+ʉM Pjjjj$ USVWE @ PM؅9hPihTihLihTitu( Vt Whmm} VQP 8<@DHL $PT(X V QhTPEtWPWVSu SK~zD taVhhPt: hP ~g uċDD D< u D}u8 V% 8QhTP0WhHi2W hmt VW3ۋÁ_^[U uu ut`iE ÐUuuuu u E8t3UWVS[Ñ[^_UWVS[u[^_verboseno-loopversionUsage: status-intervalIDENTIFY_SYSTEM%s: disconnected. Waiting %d seconds to try again. %s: disconnected. %s: no target directory specified %s: too many command-line arguments (first is "%s") Try "%s --help" for more information. %s: invalid status interval "%s" %s: invalid port number "%s" D:h:p:U:s:nwWvpg_receivexlog (PostgreSQL) 9.2.0--version-V-?--helppg_receivexlog-9.2passwordno-passwordusernameporthostdirectoryhelp%s: starting log streaming at %X/%X (timeline %u) %s: could not parse transaction log location "%s" %X/%X%s: could not identify system: got %d rows and %d fields, expected %d rows and %d fields %s: could not send replication command "%s": %s%s: segment file "%s" has incorrect size %d, skipping %s: could not stat file "%s": %s %s/%s%s: could not parse transaction log file name "%s" %08X%08X%08X...%s: could not open directory "%s": %s %s: received interrupt signal, exiting. %s: finished segment at %X/%X (timeline %u) Report bugs to . -W, --password force password prompt (should happen automatically) -w, --no-password never prompt for password -U, --username=NAME connect as specified database user -s, --status-interval=INTERVAL time between status packets sent to server (in seconds) -p, --port=PORT database server port number -h, --host=HOSTNAME database server host or socket directory Connection options: -?, --help show this help, then exit -V, --version output version information, then exit -v, --verbose output verbose messages -n, --no-loop do not loop on connection lost -D, --directory=DIR receive transaction log files into this directory Options: %s [OPTION]... %s receives PostgreSQL streaming transaction logs. IDENTIFY_SYSTEM%s: replication stream was terminated before stop point %s: unexpected termination of replication stream: %s%s: could not write %u bytes to WAL file "%s": %s %s: got WAL data offset %08x, expected %08x %s: received transaction log record for offset %u with no file open %s: streaming header too small: %d %s: unrecognized streaming header: "%c" %s: keepalive message has incorrect size %d %s: could not read COPY data: %s%s: could not receive data from WAL stream: %s%s: select() failed: %s %s: could not send feedback packet: %sSTART_REPLICATIONSTART_REPLICATION %X/%X%s: timeline does not match between base backup and streaming connection %s: system identifier does not match between base backup and streaming connection %s: could not identify system: got %d rows and %d fields, expected %d rows and %d fields %s: could not send replication command "%s": %s%s: not renaming "%s", segment is not complete %s: could not rename file "%s": %s %s/%s%s: could not close file "%s": %s %s: could not fsync file "%s": %s %s: could not determine seek position in file "%s": %s %s: could not seek to beginning of transaction log file "%s": %s %s: could not pad transaction log file "%s": %s %s: transaction log file "%s" has %d bytes, should be 0 or %d %s: could not stat transaction log file "%s": %s %s: could not open transaction log file "%s": %s %s/%s.partial%08X%08X%08X%s: integer_datetimes compile flag does not match server on%s: could not determine server setting for integer_datetimes integer_datetimes%s: could not connect to server: %s %s: could not connect to server Password: passwordportuserhostfallback_application_nametruereplicationdbname%s: out of memory "%s" -VPGSYSCONFDIR=%sPGSYSCONFDIRpostgres-9.2child process exited with unrecognized status %dchild process was terminated by signal %dchild process exited with exit code %dpclose failedfgets failureno data was returned by command "%s" popen failurer/%s%scould not read symbolic link "%s"could not change directory to "%s"could not find a "%s" to executecould not read binary "%s"PATHinvalid binary "%s"could not identify current directory: %s..//../usr/local/share/man/usr/local/share/doc//postgresql/usr/local/share/locale/usr/local/lib/postgresql/usr/local/lib/usr/local/include/postgresql/server/usr/local/include/postgresql/usr/local/include/usr/local/etc/postgresql/usr/local/bin/usr/local/share/postgresql%s: out of memory /../..././%s%s wr/dev/ttyUnknown errorjFVfv&6FVfv&6FVfv&6FVfv&6FVfv  & 6 F V f v    #6CSgo V V, , o#ooxPo`opi 'Y?0WVYDYhXpXU(WnXwXW@Ws Wv,,PXx 0  V V W Wpij(lhmhm8q$%HlBLlU[Tl fr(l}hmW! "m # &3 (  rxl}hmW-m / Lm1K (2 A2: rLm}hmWanTmrPm}hmWyPB E) H r(l}hmWS6 Ss Oe P r(l}hmWr(l}hmWr(l}hmWr(l}hmW,,l;PlMpQ ^eDlm u |K K 0qQ V I PR  2  "pR n/5@;Q SZp`i@!{ oB |0Q Q W08qP 4K  X>G FMThmZ`malJ xBP@  ni`t?  "p ,K piPm> DN ?PQ LP[i@ pQ |l4qV0  tK  Uhm!0 hmR` N( (1(l!9 L QlY0R fnpxG SE  0(l@`0@\mR xV) Tt Pdm@?`$POV 2>pE c,qj0s{ON  Pp`pg_receivexlogcrti.scrt1.ocrt1.s__get_exit_frame_monitor_ptr__do_exit_code_ptrfsr.strap_tablevalues-Xa.cDdata.dataBbss.bssDrodata.rodatapg_receivexlog.cusagestop_streamingFindStreamingStartStreamLogsigint_handlerreceivelog.copen_walfileclose_walfilelocalGetCurrentTimestamplocalTimestampDifferencelocalTimestampDifferenceExceedsstreamutil.cdbpasswordexec.cvalidate_execresolve_symlinkspipe_read_linepath.ctrim_trailing_separatortrim_directorydir_strcmpmake_relative_pathpgsleep.csprompt.cthread.ccrtn.s_END__START___environ_lock__longdouble_usedget_include_pathgetcwd___Argvfopen64selectjoin_path_componentsmake_native_pathoptindPQgetvaluefstat64get_lib_pathsnprintf_initpclosepclose_checkget_html_pathPQerrorMessageputenvReceiveXlogStreamget_man_pathatoifcloseget_includeserver_pathfprintffgetsPQsocket__fsrfind_my_execget_share_pathget_pkglib_pathgettimeofday_lib_versionPQconsumeInput_endfputstcgetattrfirst_dir_separatorcanonicalize_pathtime_to_abortdbgetpasswordget_home_pathgeteuidPQfreemem_fini_exitbasediropendir__fsr_init_valueget_parent_directorytcsetattrmainPQresultErrorMessage_DYNAMICclosedirstrstrInvalidXLogRecPtrgetenverrnostrcatstandby_message_timeoutPQfinishstrlcpylseek64fputcfirst_path_var_separatormemcpyperrorxstrdupsscanfmemset__iobdbuserset_pglocale_pgservicePQconnectionNeedsPasswordPQparameterStatusPQexec_start_etextfsyncGetConnection_get_exit_frame_monitorchdirhas_drive_prefix_GLOBAL_OFFSET_TABLE_connxmalloc0path_contains_parent_referenceget_etc_pathPQresultStatusPQgetCopyDatafilenoget_pkginclude_pathnoloopget_prognamepqGetpwuidstrerror_rlast_dir_separator_PROCEDURE_LINKAGE_TABLE_PQflush_edataaccessPQconnectdbParamspopenpath_is_relative_and_below_cwdstrncpy_environ__posix_getpwuid_rfreeverboseget_doc_path__div64PQnfieldsfind_other_execsetlocalepg_usleep__fpstartatexitstrerrorPQgetResultdbportPQclearget_locale_pathpqStrerrorsimple_promptunlinkstrlenwritedbhoststrcpystrncmpPQputCopyDatagetopt_longrename__1cG__CrunMdo_exit_code6F_v_optargreadlink__rem64path_is_prefix_of_pathlstat64readdir64fflushmallocPQntuplespqsignalPQstatusanotate anotate0 ,( j VI!HlLlanotateL! <!"m#&3( (,),hJ!Y ,anotate O("), +(,*,*,*,*,*,*,*,*,*,*,*,*,*,*,*,*,*,)*,*, *-*-*-* -*-*-*-*-* -*$-*(-*,-*0-*4-*8-*<-*@-v*D-*H-*L-*P-*T-*X-)\-*`-D*d-*h-*l-)p-*t-*x-)|-*anotateh-H-m/1K22:2  "57q;anotate anotate4X>$X>G>t?anotate anotatedPBTPBBE)GHIlJanotate anotatep,KP,K4K TK tK KK