# PaCkAgE DaTaStReAm postgresql 1 91012 # end of header 0707010001f5ca000081a4000000000000000000000001505020600000012d000000b600010002ffffffffffffffff0000001300000000postgresql/pkginfoPKG=postgresql NAME=postgresql 9.2.0 i86pc Solaris 11 VERSION=9.2.0 PSTAMP=12th September 2012 VENDOR=PostgreSQL Global Development Group EMAIL=http://www.postgresql.org/ DESC=Open source object-relational database ARCH=i386 CATEGORY=utility CLASSES=none BASEDIR=/ ISTATES=S s 1 2 3 RSTATES=S s 1 2 3 0707010001f5c9000081a4000000000000000000000001505020600004678b000000b600010002ffffffffffffffff0000001200000000postgresql/pkgmap: 1 91012 1 d none /usr ? ? ? 1 d none /usr/local ? ? ? 1 d none /usr/local/bin 0755 root root 1 f none /usr/local/bin/clusterdb 0755 root root 69572 38379 1347419310 1 f none /usr/local/bin/createdb 0755 root root 70144 35330 1347419310 1 f none /usr/local/bin/createlang 0755 root root 77888 17038 1347419310 1 f none /usr/local/bin/createuser 0755 root root 71784 56793 1347419310 1 f none /usr/local/bin/dropdb 0755 root root 68120 64433 1347419310 1 f none /usr/local/bin/droplang 0755 root root 77712 51068 1347419310 1 f none /usr/local/bin/dropuser 0755 root root 68096 52169 1347419310 1 f none /usr/local/bin/ecpg 0755 root root 804888 28600 1347419309 1 f none /usr/local/bin/initdb 0755 root root 114800 43427 1347419309 1 f none /usr/local/bin/oid2name 0755 root root 33936 43038 1347419312 1 f none /usr/local/bin/pg_archivecleanup 0755 root root 26396 48401 1347419312 1 f none /usr/local/bin/pg_basebackup 0755 root root 73244 34855 1347419310 1 f none /usr/local/bin/pg_config 0755 root root 34472 26103 1347419310 1 f none /usr/local/bin/pg_controldata 0755 root root 33672 45277 1347419310 1 f none /usr/local/bin/pg_ctl 0755 root root 47828 24391 1347419310 1 f none /usr/local/bin/pg_dump 0755 root root 359344 63794 1347419310 1 f none /usr/local/bin/pg_dumpall 0755 root root 91032 55133 1347419310 1 f none /usr/local/bin/pg_receivexlog 0755 root root 52804 63601 1347419310 1 f none /usr/local/bin/pg_resetxlog 0755 root root 44592 29225 1347419310 1 f none /usr/local/bin/pg_restore 0755 root root 162028 4236 1347419310 1 f none /usr/local/bin/pg_standby 0755 root root 34356 14497 1347419312 1 f none /usr/local/bin/pg_test_fsync 0755 root root 27748 26489 1347419312 1 f none /usr/local/bin/pg_test_timing 0755 root root 21820 23324 1347419312 1 f none /usr/local/bin/pg_upgrade 0755 root root 140704 33346 1347419312 1 f none /usr/local/bin/pgbench 0755 root root 65688 13962 1347419312 1 f none /usr/local/bin/pltcl_delmod 0755 root root 2219 44861 1347419310 1 f none /usr/local/bin/pltcl_listmod 0755 root root 2377 56553 1347419310 1 f none /usr/local/bin/pltcl_loadmod 0755 root root 11455 4231 1347419310 1 f none /usr/local/bin/postgres 0755 root root 6729156 32263 1347419307 1 s none /usr/local/bin/postmaster=postgres 1 f none /usr/local/bin/psql 0755 root root 486960 35237 1347419310 1 f none /usr/local/bin/reindexdb 0755 root root 70944 50321 1347419310 1 f none /usr/local/bin/vacuumdb 0755 root root 42388 42712 1347419310 1 f none /usr/local/bin/vacuumlo 0755 root root 33656 19108 1347419313 1 d none /usr/local/include 0755 root root 1 f none /usr/local/include/ecpg_config.h 0644 root root 714 57266 1347419309 1 f none /usr/local/include/ecpg_informix.h 0644 root root 2758 29110 1347419309 1 f none /usr/local/include/ecpgerrno.h 0644 root root 2540 60981 1347419309 1 f none /usr/local/include/ecpglib.h 0644 root root 2601 15719 1347419309 1 f none /usr/local/include/ecpgtype.h 0644 root root 2621 18076 1347419309 1 d none /usr/local/include/libpq 0755 root root 1 f none /usr/local/include/libpq-events.h 0644 root root 2211 49429 1347419309 1 f none /usr/local/include/libpq-fe.h 0644 root root 20649 29784 1347419309 1 f none /usr/local/include/libpq/libpq-fs.h 0644 root root 633 44679 1347419309 1 f none /usr/local/include/pg_config.h 0644 root root 26297 4763 1347419309 1 f none /usr/local/include/pg_config_manual.h 0644 root root 9261 50041 1347419309 1 f none /usr/local/include/pg_config_os.h 0644 root root 1041 19956 1347419309 1 f none /usr/local/include/pgtypes_date.h 0644 root root 766 65439 1347419309 1 f none /usr/local/include/pgtypes_error.h 0644 root root 530 39306 1347419309 1 f none /usr/local/include/pgtypes_interval.h 0644 root root 1143 28859 1347419309 1 f none /usr/local/include/pgtypes_numeric.h 0644 root root 2227 44302 1347419309 1 f none /usr/local/include/pgtypes_timestamp.h 0644 root root 1010 23484 1347419309 1 f none /usr/local/include/postgres_ext.h 0644 root root 1778 8903 1347419309 1 d none /usr/local/include/postgresql 0755 root root 1 d none /usr/local/include/postgresql/informix 0755 root root 1 d none /usr/local/include/postgresql/informix/esql 0755 root root 1 f none /usr/local/include/postgresql/informix/esql/datetime.h 0644 root root 338 27003 1347419309 1 f none /usr/local/include/postgresql/informix/esql/decimal.h 0644 root root 301 23254 1347419309 1 f none /usr/local/include/postgresql/informix/esql/sqltypes.h 0644 root root 1435 45823 1347419309 1 d none /usr/local/include/postgresql/internal 0755 root root 1 f none /usr/local/include/postgresql/internal/c.h 0644 root root 24689 44709 1347419309 1 d none /usr/local/include/postgresql/internal/libpq 0755 root root 1 f none /usr/local/include/postgresql/internal/libpq-int.h 0644 root root 22813 53598 1347419309 1 f none /usr/local/include/postgresql/internal/libpq/pqcomm.h 0644 root root 5800 11746 1347419309 1 f none /usr/local/include/postgresql/internal/port.h 0644 root root 13841 61945 1347419309 1 f none /usr/local/include/postgresql/internal/postgres_fe.h 0644 root root 730 54063 1347419309 1 f none /usr/local/include/postgresql/internal/pqexpbuffer.h 0644 root root 6527 5186 1347419309 1 d none /usr/local/include/postgresql/server 0755 root root 1 d none /usr/local/include/postgresql/server/access 0755 root root 1 f none /usr/local/include/postgresql/server/access/attnum.h 0644 root root 1553 56964 1347419309 1 f none /usr/local/include/postgresql/server/access/clog.h 0644 root root 1508 62296 1347419309 1 f none /usr/local/include/postgresql/server/access/genam.h 0644 root root 7470 58296 1347419309 1 f none /usr/local/include/postgresql/server/access/gin.h 0644 root root 1664 65164 1347419309 1 f none /usr/local/include/postgresql/server/access/gin_private.h 0644 root root 23313 11499 1347419309 1 f none /usr/local/include/postgresql/server/access/gist.h 0644 root root 5562 59338 1347419309 1 f none /usr/local/include/postgresql/server/access/gist_private.h 0644 root root 18682 60890 1347419309 1 f none /usr/local/include/postgresql/server/access/gistscan.h 0644 root root 718 53420 1347419309 1 f none /usr/local/include/postgresql/server/access/hash.h 0644 root root 13177 63527 1347419309 1 f none /usr/local/include/postgresql/server/access/heapam.h 0644 root root 6344 29310 1347419309 1 f none /usr/local/include/postgresql/server/access/hio.h 0644 root root 1280 35802 1347419309 1 f none /usr/local/include/postgresql/server/access/htup.h 0644 root root 32708 34557 1347419309 1 f none /usr/local/include/postgresql/server/access/itup.h 0644 root root 4404 25058 1347419309 1 f none /usr/local/include/postgresql/server/access/multixact.h 0644 root root 2810 46471 1347419309 1 f none /usr/local/include/postgresql/server/access/nbtree.h 0644 root root 27906 5562 1347419309 1 f none /usr/local/include/postgresql/server/access/printtup.h 0644 root root 1051 18880 1347419309 1 f none /usr/local/include/postgresql/server/access/reloptions.h 0644 root root 8813 55753 1347419309 1 f none /usr/local/include/postgresql/server/access/relscan.h 0644 root root 4168 17731 1347419309 1 f none /usr/local/include/postgresql/server/access/rewriteheap.h 0644 root root 1016 16149 1347419309 1 f none /usr/local/include/postgresql/server/access/rmgr.h 0644 root root 804 58096 1347419309 1 f none /usr/local/include/postgresql/server/access/sdir.h 0644 root root 1466 50616 1347419309 1 f none /usr/local/include/postgresql/server/access/skey.h 0644 root root 7033 60969 1347419309 1 f none /usr/local/include/postgresql/server/access/slru.h 0644 root root 5278 46117 1347419309 1 f none /usr/local/include/postgresql/server/access/spgist.h 0644 root root 6391 59800 1347419309 1 f none /usr/local/include/postgresql/server/access/spgist_private.h 0644 root root 22659 43385 1347419309 1 f none /usr/local/include/postgresql/server/access/subtrans.h 0644 root root 973 19627 1347419309 1 f none /usr/local/include/postgresql/server/access/sysattr.h 0644 root root 891 2124 1347419309 1 f none /usr/local/include/postgresql/server/access/transam.h 0644 root root 6161 59536 1347419309 1 f none /usr/local/include/postgresql/server/access/tupconvert.h 0644 root root 1287 37028 1347419309 1 f none /usr/local/include/postgresql/server/access/tupdesc.h 0644 root root 4241 32279 1347419309 1 f none /usr/local/include/postgresql/server/access/tupmacs.h 0644 root root 7326 56488 1347419309 1 f none /usr/local/include/postgresql/server/access/tuptoaster.h 0644 root root 5821 13150 1347419309 1 f none /usr/local/include/postgresql/server/access/twophase.h 0644 root root 1716 15073 1347419309 1 f none /usr/local/include/postgresql/server/access/twophase_rmgr.h 0644 root root 1272 34879 1347419309 1 f none /usr/local/include/postgresql/server/access/valid.h 0644 root root 1437 37032 1347419309 1 f none /usr/local/include/postgresql/server/access/visibilitymap.h 0644 root root 1178 30998 1347419309 1 f none /usr/local/include/postgresql/server/access/xact.h 0644 root root 8646 13793 1347419309 1 f none /usr/local/include/postgresql/server/access/xlog.h 0644 root root 12301 61077 1347419309 1 f none /usr/local/include/postgresql/server/access/xlog_internal.h 0644 root root 9567 7477 1347419309 1 f none /usr/local/include/postgresql/server/access/xlogdefs.h 0644 root root 4597 41837 1347419309 1 f none /usr/local/include/postgresql/server/access/xlogutils.h 0644 root root 956 18495 1347419309 1 d none /usr/local/include/postgresql/server/bootstrap 0755 root root 1 f none /usr/local/include/postgresql/server/bootstrap/bootstrap.h 0644 root root 1573 61655 1347419309 1 f none /usr/local/include/postgresql/server/c.h 0644 root root 24689 44709 1347419309 1 d none /usr/local/include/postgresql/server/catalog 0755 root root 1 f none /usr/local/include/postgresql/server/catalog/catalog.h 0644 root root 2099 42876 1347419309 1 f none /usr/local/include/postgresql/server/catalog/catversion.h 0644 root root 2586 22604 1347419309 1 f none /usr/local/include/postgresql/server/catalog/dependency.h 0644 root root 9669 16852 1347419309 1 f none /usr/local/include/postgresql/server/catalog/genbki.h 0644 root root 1794 14046 1347419309 1 f none /usr/local/include/postgresql/server/catalog/heap.h 0644 root root 3899 57913 1347419309 1 f none /usr/local/include/postgresql/server/catalog/index.h 0644 root root 2845 28723 1347419309 1 f none /usr/local/include/postgresql/server/catalog/indexing.h 0644 root root 16686 18284 1347419309 1 f none /usr/local/include/postgresql/server/catalog/namespace.h 0644 root root 5769 42170 1347419309 1 f none /usr/local/include/postgresql/server/catalog/objectaccess.h 0644 root root 1654 1004 1347419309 1 f none /usr/local/include/postgresql/server/catalog/objectaddress.h 0644 root root 1236 31185 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_aggregate.h 0644 root root 10609 43944 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_am.h 0644 root root 5941 33137 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_amop.h 0644 root root 25108 20608 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_amproc.h 0644 root root 14345 10564 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_attrdef.h 0644 root root 1670 63088 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_attribute.h 0644 root root 6949 55282 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_auth_members.h 0644 root root 1791 8636 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_authid.h 0644 root root 3270 3767 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_cast.h 0644 root root 11759 13768 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_class.h 0644 root root 6070 18629 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_collation.h 0644 root root 2284 43221 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_collation_fn.h 0644 root root 735 55497 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_constraint.h 0644 root root 8149 17531 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_control.h 0644 root root 8166 24816 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_conversion.h 0644 root root 2175 38551 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_conversion_fn.h 0644 root root 833 64411 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_database.h 0644 root root 2689 16061 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_db_role_setting.h 0644 root root 2008 28577 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_default_acl.h 0644 root root 2150 33859 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_depend.h 0644 root root 2796 27834 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_description.h 0644 root root 2985 46833 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_enum.h 0644 root root 1859 12008 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_extension.h 0644 root root 2136 37516 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_foreign_data_wrapper.h 0644 root root 2066 35018 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_foreign_server.h 0644 root root 1914 21633 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_foreign_table.h 0644 root root 1628 60303 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_index.h 0644 root root 3421 14992 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_inherits.h 0644 root root 1499 47948 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_inherits_fn.h 0644 root root 850 822 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_language.h 0644 root root 2442 57657 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_largeobject.h 0644 root root 1829 12311 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_largeobject_metadata.h 0644 root root 1714 4788 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_namespace.h 0644 root root 2282 40965 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_opclass.h 0644 root root 11699 44490 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_operator.h 0644 root root 98031 1469 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_opfamily.h 0644 root root 6493 63238 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_pltemplate.h 0644 root root 3185 64381 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_proc.h 0644 root root 461504 12506 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_proc_fn.h 0644 root root 1169 23528 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_range.h 0644 root root 2595 4977 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_rewrite.h 0644 root root 1893 18512 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_seclabel.h 0644 root root 1363 37456 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_shdepend.h 0644 root root 2815 28366 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_shdescription.h 0644 root root 2444 64232 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_shseclabel.h 0644 root root 1343 36227 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_statistic.h 0644 root root 11373 57274 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_tablespace.h 0644 root root 1891 14850 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_trigger.h 0644 root root 5746 56772 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_ts_config.h 0644 root root 1645 59783 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_ts_config_map.h 0644 root root 2334 38328 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_ts_dict.h 0644 root root 1822 9954 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_ts_parser.h 0644 root root 1993 26851 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_ts_template.h 0644 root root 2152 40685 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_type.h 0644 root root 42313 24492 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_type_fn.h 0644 root root 2126 30879 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_user_mapping.h 0644 root root 1624 60121 1347419309 1 f none /usr/local/include/postgresql/server/catalog/schemapg.h 0644 root root 16154 34939 1347419309 1 f none /usr/local/include/postgresql/server/catalog/storage.h 0644 root root 1366 48541 1347419309 1 f none /usr/local/include/postgresql/server/catalog/toasting.h 0644 root root 1954 25184 1347419309 1 d none /usr/local/include/postgresql/server/commands 0755 root root 1 f none /usr/local/include/postgresql/server/commands/alter.h 0644 root root 942 8016 1347419309 1 f none /usr/local/include/postgresql/server/commands/async.h 0644 root root 1832 23595 1347419309 1 f none /usr/local/include/postgresql/server/commands/cluster.h 0644 root root 1167 27997 1347419309 1 f none /usr/local/include/postgresql/server/commands/collationcmds.h 0644 root root 919 7441 1347419309 1 f none /usr/local/include/postgresql/server/commands/comment.h 0644 root root 1364 38947 1347419309 1 f none /usr/local/include/postgresql/server/commands/conversioncmds.h 0644 root root 941 10217 1347419309 1 f none /usr/local/include/postgresql/server/commands/copy.h 0644 root root 1241 35297 1347419309 1 f none /usr/local/include/postgresql/server/commands/createas.h 0644 root root 801 61384 1347419309 1 f none /usr/local/include/postgresql/server/commands/dbcommands.h 0644 root root 2117 44688 1347419309 1 f none /usr/local/include/postgresql/server/commands/defrem.h 0644 root root 7701 31234 1347419309 1 f none /usr/local/include/postgresql/server/commands/discard.h 0644 root root 471 32118 1347419309 1 f none /usr/local/include/postgresql/server/commands/explain.h 0644 root root 2994 49722 1347419309 1 f none /usr/local/include/postgresql/server/commands/extension.h 0644 root root 1566 779 1347419309 1 f none /usr/local/include/postgresql/server/commands/lockcmds.h 0644 root root 559 39242 1347419309 1 f none /usr/local/include/postgresql/server/commands/portalcmds.h 0644 root root 896 4600 1347419309 1 f none /usr/local/include/postgresql/server/commands/prepare.h 0644 root root 2078 41852 1347419309 1 f none /usr/local/include/postgresql/server/commands/proclang.h 0644 root root 784 61944 1347419309 1 f none /usr/local/include/postgresql/server/commands/schemacmds.h 0644 root root 843 65332 1347419309 1 f none /usr/local/include/postgresql/server/commands/seclabel.h 0644 root root 970 16689 1347419309 1 f none /usr/local/include/postgresql/server/commands/sequence.h 0644 root root 1997 26269 1347419309 1 f none /usr/local/include/postgresql/server/commands/tablecmds.h 0644 root root 2339 735 1347419309 1 f none /usr/local/include/postgresql/server/commands/tablespace.h 0644 root root 1803 19133 1347419309 1 f none /usr/local/include/postgresql/server/commands/trigger.h 0644 root root 6780 25096 1347419309 1 f none /usr/local/include/postgresql/server/commands/typecmds.h 0644 root root 1917 30630 1347419309 1 f none /usr/local/include/postgresql/server/commands/user.h 0644 root root 1105 25135 1347419309 1 f none /usr/local/include/postgresql/server/commands/vacuum.h 0644 root root 6877 59395 1347419309 1 f none /usr/local/include/postgresql/server/commands/variable.h 0644 root root 1881 39127 1347419309 1 f none /usr/local/include/postgresql/server/commands/view.h 0644 root root 510 35677 1347419309 1 d none /usr/local/include/postgresql/server/datatype 0755 root root 1 f none /usr/local/include/postgresql/server/datatype/timestamp.h 0644 root root 5629 47604 1347419309 1 f none /usr/local/include/postgresql/server/dynloader.h 0644 root root 1053 15161 1347419309 1 d none /usr/local/include/postgresql/server/executor 0755 root root 1 f none /usr/local/include/postgresql/server/executor/execdebug.h 0644 root root 4426 64137 1347419309 1 f none /usr/local/include/postgresql/server/executor/execdesc.h 0644 root root 2384 61582 1347419309 1 f none /usr/local/include/postgresql/server/executor/executor.h 0644 root root 14798 50206 1347419309 1 f none /usr/local/include/postgresql/server/executor/functions.h 0644 root root 1150 26343 1347419309 1 f none /usr/local/include/postgresql/server/executor/hashjoin.h 0644 root root 7353 30831 1347419309 1 f none /usr/local/include/postgresql/server/executor/instrument.h 0644 root root 2857 37851 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeAgg.h 0644 root root 782 59303 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeAppend.h 0644 root root 701 52560 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeBitmapAnd.h 0644 root root 738 55773 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeBitmapHeapscan.h 0644 root root 813 62912 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeBitmapIndexscan.h 0644 root root 822 64009 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeBitmapOr.h 0644 root root 724 54721 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeCtescan.h 0644 root root 715 53646 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeForeignscan.h 0644 root root 771 59282 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeFunctionscan.h 0644 root root 785 60922 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeGroup.h 0644 root root 716 54291 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeHash.h 0644 root root 1926 27070 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeHashjoin.h 0644 root root 890 3738 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeIndexonlyscan.h 0644 root root 920 8044 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeIndexscan.h 0644 root root 1558 62898 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeLimit.h 0644 root root 687 51410 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeLockRows.h 0644 root root 729 55544 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeMaterial.h 0644 root root 838 54 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeMergeAppend.h 0644 root root 771 59120 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeMergejoin.h 0644 root root 743 56576 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeModifyTable.h 0644 root root 768 59148 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeNestloop.h 0644 root root 729 55608 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeRecursiveunion.h 0644 root root 813 64174 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeResult.h 0644 root root 802 62613 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeSeqscan.h 0644 root root 812 62745 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeSetOp.h 0644 root root 687 51226 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeSort.h 0644 root root 766 58935 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeSubplan.h 0644 root root 812 63210 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeSubqueryscan.h 0644 root root 785 61286 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeTidscan.h 0644 root root 812 62601 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeUnique.h 0644 root root 701 52994 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeValuesscan.h 0644 root root 866 2808 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeWindowAgg.h 0644 root root 776 59673 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeWorktablescan.h 0644 root root 799 61952 1347419309 1 f none /usr/local/include/postgresql/server/executor/spi.h 0644 root root 5543 6791 1347419309 1 f none /usr/local/include/postgresql/server/executor/spi_priv.h 0644 root root 3318 17303 1347419309 1 f none /usr/local/include/postgresql/server/executor/tstoreReceiver.h 0644 root root 767 57546 1347419309 1 f none /usr/local/include/postgresql/server/executor/tuptable.h 0644 root root 8591 32493 1347419309 1 f none /usr/local/include/postgresql/server/fmgr.h 0644 root root 30065 54957 1347419309 1 d none /usr/local/include/postgresql/server/foreign 0755 root root 1 f none /usr/local/include/postgresql/server/foreign/fdwapi.h 0644 root root 3083 51822 1347419309 1 f none /usr/local/include/postgresql/server/foreign/foreign.h 0644 root root 2606 12795 1347419309 1 f none /usr/local/include/postgresql/server/funcapi.h 0644 root root 10324 7657 1347419309 1 f none /usr/local/include/postgresql/server/getaddrinfo.h 0644 root root 3936 50846 1347419309 1 f none /usr/local/include/postgresql/server/getopt_long.h 0644 root root 827 2276 1347419309 1 d none /usr/local/include/postgresql/server/lib 0755 root root 1 f none /usr/local/include/postgresql/server/lib/dllist.h 0644 root root 2871 31329 1347419309 1 f none /usr/local/include/postgresql/server/lib/stringinfo.h 0644 root root 5489 56620 1347419309 1 d none /usr/local/include/postgresql/server/libpq 0755 root root 1 f none /usr/local/include/postgresql/server/libpq/auth.h 0644 root root 903 6942 1347419309 1 f none /usr/local/include/postgresql/server/libpq/be-fsstubs.h 0644 root root 1610 63743 1347419309 1 f none /usr/local/include/postgresql/server/libpq/crypt.h 0644 root root 550 39406 1347419309 1 f none /usr/local/include/postgresql/server/libpq/hba.h 0644 root root 1780 10147 1347419309 1 f none /usr/local/include/postgresql/server/libpq/ip.h 0644 root root 1704 5168 1347419309 1 f none /usr/local/include/postgresql/server/libpq/libpq-be.h 0644 root root 5584 61607 1347419309 1 f none /usr/local/include/postgresql/server/libpq/libpq-fs.h 0644 root root 633 44679 1347419309 1 f none /usr/local/include/postgresql/server/libpq/libpq.h 0644 root root 2453 10988 1347419309 1 f none /usr/local/include/postgresql/server/libpq/md5.h 0644 root root 901 2480 1347419309 1 f none /usr/local/include/postgresql/server/libpq/pqcomm.h 0644 root root 5800 11746 1347419309 1 f none /usr/local/include/postgresql/server/libpq/pqformat.h 0644 root root 1997 42679 1347419309 1 f none /usr/local/include/postgresql/server/libpq/pqsignal.h 0644 root root 1300 33631 1347419309 1 d none /usr/local/include/postgresql/server/mb 0755 root root 1 f none /usr/local/include/postgresql/server/mb/pg_wchar.h 0644 root root 17249 36233 1347419309 1 f none /usr/local/include/postgresql/server/miscadmin.h 0644 root root 15125 8175 1347419309 1 d none /usr/local/include/postgresql/server/nodes 0755 root root 1 f none /usr/local/include/postgresql/server/nodes/bitmapset.h 0644 root root 3440 28053 1347419309 1 f none /usr/local/include/postgresql/server/nodes/execnodes.h 0644 root root 66161 1017 1347419309 1 f none /usr/local/include/postgresql/server/nodes/makefuncs.h 0644 root root 2380 147 1347419309 1 f none /usr/local/include/postgresql/server/nodes/memnodes.h 0644 root root 2614 20900 1347419309 1 f none /usr/local/include/postgresql/server/nodes/nodeFuncs.h 0644 root root 2510 3312 1347419309 1 f none /usr/local/include/postgresql/server/nodes/nodes.h 0644 root root 13865 21195 1347419309 1 f none /usr/local/include/postgresql/server/nodes/params.h 0644 root root 3776 47449 1347419309 1 f none /usr/local/include/postgresql/server/nodes/parsenodes.h 0644 root root 88399 53169 1347419309 1 f none /usr/local/include/postgresql/server/nodes/pg_list.h 0644 root root 11367 37318 1347419309 1 f none /usr/local/include/postgresql/server/nodes/plannodes.h 0644 root root 28122 7204 1347419309 1 f none /usr/local/include/postgresql/server/nodes/primnodes.h 0644 root root 50383 64749 1347419309 1 f none /usr/local/include/postgresql/server/nodes/print.h 0644 root root 1070 21166 1347419309 1 f none /usr/local/include/postgresql/server/nodes/readfuncs.h 0644 root root 897 3910 1347419309 1 f none /usr/local/include/postgresql/server/nodes/relation.h 0644 root root 69030 9115 1347419309 1 f none /usr/local/include/postgresql/server/nodes/replnodes.h 0644 root root 1053 8745 1347419309 1 f none /usr/local/include/postgresql/server/nodes/tidbitmap.h 0644 root root 2238 54195 1347419309 1 f none /usr/local/include/postgresql/server/nodes/value.h 0644 root root 1798 10409 1347419309 1 d none /usr/local/include/postgresql/server/optimizer 0755 root root 1 f none /usr/local/include/postgresql/server/optimizer/clauses.h 0644 root root 2999 64034 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/cost.h 0644 root root 7502 46997 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/geqo.h 0644 root root 2173 34361 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/geqo_copy.h 0644 root root 966 2865 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/geqo_gene.h 0644 root root 1114 13818 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/geqo_misc.h 0644 root root 1124 15692 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/geqo_mutation.h 0644 root root 959 2185 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/geqo_pool.h 0644 root root 1317 35034 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/geqo_random.h 0644 root root 1312 31647 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/geqo_recombination.h 0644 root root 2644 13745 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/geqo_selection.h 0644 root root 1015 6141 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/joininfo.h 0644 root root 836 63227 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/pathnode.h 0644 root root 5513 62611 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/paths.h 0644 root root 6734 36713 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/placeholder.h 0644 root root 1233 35170 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/plancat.h 0644 root root 1691 3782 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/planmain.h 0644 root root 4974 30890 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/planner.h 0644 root root 1363 43470 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/predtest.h 0644 root root 668 49780 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/prep.h 0644 root root 1657 8058 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/restrictinfo.h 0644 root root 1754 13971 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/subselect.h 0644 root root 1417 49691 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/tlist.h 0644 root root 1594 3728 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/var.h 0644 root root 1534 59450 1347419309 1 d none /usr/local/include/postgresql/server/parser 0755 root root 1 f none /usr/local/include/postgresql/server/parser/analyze.h 0644 root root 1465 54867 1347419309 1 f none /usr/local/include/postgresql/server/parser/gram.h 0644 root root 11350 22875 1347419309 1 f none /usr/local/include/postgresql/server/parser/gramparse.h 0644 root root 2149 44822 1347419309 1 f none /usr/local/include/postgresql/server/parser/keywords.h 0644 root root 1055 14503 1347419309 1 f none /usr/local/include/postgresql/server/parser/kwlist.h 0644 root root 20745 37109 1347419309 1 f none /usr/local/include/postgresql/server/parser/parse_agg.h 0644 root root 1152 23815 1347419309 1 f none /usr/local/include/postgresql/server/parser/parse_clause.h 0644 root root 1772 15441 1347419309 1 f none /usr/local/include/postgresql/server/parser/parse_coerce.h 0644 root root 3116 57264 1347419309 1 f none /usr/local/include/postgresql/server/parser/parse_collate.h 0644 root root 829 65444 1347419309 1 f none /usr/local/include/postgresql/server/parser/parse_cte.h 0644 root root 694 51806 1347419309 1 f none /usr/local/include/postgresql/server/parser/parse_expr.h 0644 root root 619 45566 1347419309 1 f none /usr/local/include/postgresql/server/parser/parse_func.h 0644 root root 2672 18426 1347419309 1 f none /usr/local/include/postgresql/server/parser/parse_node.h 0644 root root 6244 11590 1347419309 1 f none /usr/local/include/postgresql/server/parser/parse_oper.h 0644 root root 2497 9498 1347419309 1 f none /usr/local/include/postgresql/server/parser/parse_param.h 0644 root root 776 59320 1347419309 1 f none /usr/local/include/postgresql/server/parser/parse_relation.h 0644 root root 3544 24362 1347419309 1 f none /usr/local/include/postgresql/server/parser/parse_target.h 0644 root root 1425 48194 1347419309 1 f none /usr/local/include/postgresql/server/parser/parse_type.h 0644 root root 1710 11912 1347419309 1 f none /usr/local/include/postgresql/server/parser/parse_utilcmd.h 0644 root root 953 10432 1347419309 1 f none /usr/local/include/postgresql/server/parser/parser.h 0644 root root 1146 25345 1347419309 1 f none /usr/local/include/postgresql/server/parser/parsetree.h 0644 root root 2069 32621 1347419309 1 f none /usr/local/include/postgresql/server/parser/scanner.h 0644 root root 4199 25390 1347419309 1 f none /usr/local/include/postgresql/server/parser/scansup.h 0644 root root 752 57084 1347419309 1 f none /usr/local/include/postgresql/server/pg_config.h 0644 root root 26297 4763 1347419309 1 f none /usr/local/include/postgresql/server/pg_config_manual.h 0644 root root 9261 50041 1347419309 1 f none /usr/local/include/postgresql/server/pg_config_os.h 0644 root root 1041 19956 1347419309 1 f none /usr/local/include/postgresql/server/pg_trace.h 0644 root root 316 23828 1347419309 1 f none /usr/local/include/postgresql/server/pgstat.h 0644 root root 24463 41272 1347419309 1 f none /usr/local/include/postgresql/server/pgtime.h 0644 root root 2056 38441 1347419309 1 f none /usr/local/include/postgresql/server/plpgsql.h 0644 root root 26354 20318 1347419310 1 d none /usr/local/include/postgresql/server/port 0755 root root 1 f none /usr/local/include/postgresql/server/port.h 0644 root root 13841 61945 1347419309 1 f none /usr/local/include/postgresql/server/port/aix.h 0644 root root 82 6256 1347419309 1 f none /usr/local/include/postgresql/server/port/cygwin.h 0644 root root 436 35069 1347419309 1 f none /usr/local/include/postgresql/server/port/darwin.h 0644 root root 157 12088 1347419309 1 f none /usr/local/include/postgresql/server/port/freebsd.h 0644 root root 33 2795 1347419309 1 f none /usr/local/include/postgresql/server/port/hpux.h 0644 root root 52 4183 1347419309 1 f none /usr/local/include/postgresql/server/port/irix.h 0644 root root 191 15025 1347419309 1 f none /usr/local/include/postgresql/server/port/linux.h 0644 root root 1051 25270 1347419309 1 f none /usr/local/include/postgresql/server/port/netbsd.h 0644 root root 32 2704 1347419309 1 f none /usr/local/include/postgresql/server/port/openbsd.h 0644 root root 33 2811 1347419309 1 f none /usr/local/include/postgresql/server/port/osf.h 0644 root root 73 5705 1347419309 1 f none /usr/local/include/postgresql/server/port/sco.h 0644 root root 115 9040 1347419309 1 f none /usr/local/include/postgresql/server/port/solaris.h 0644 root root 1041 19956 1347419309 1 f none /usr/local/include/postgresql/server/port/unixware.h 0644 root root 279 19440 1347419309 1 d none /usr/local/include/postgresql/server/port/win32 0755 root root 1 f none /usr/local/include/postgresql/server/port/win32.h 0644 root root 12891 6721 1347419309 1 d none /usr/local/include/postgresql/server/port/win32/arpa 0755 root root 1 f none /usr/local/include/postgresql/server/port/win32/arpa/inet.h 0644 root root 66 5591 1347419309 1 f none /usr/local/include/postgresql/server/port/win32/dlfcn.h 0644 root root 37 3065 1347419309 1 f none /usr/local/include/postgresql/server/port/win32/grp.h 0644 root root 35 2875 1347419309 1 f none /usr/local/include/postgresql/server/port/win32/netdb.h 0644 root root 37 3071 1347419309 1 d none /usr/local/include/postgresql/server/port/win32/netinet 0755 root root 1 f none /usr/local/include/postgresql/server/port/win32/netinet/in.h 0644 root root 67 5713 1347419309 1 f none /usr/local/include/postgresql/server/port/win32/pwd.h 0644 root root 39 2971 1347419309 1 d none /usr/local/include/postgresql/server/port/win32/sys 0755 root root 1 f none /usr/local/include/postgresql/server/port/win32/sys/socket.h 0644 root root 696 57001 1347419309 1 f none /usr/local/include/postgresql/server/port/win32/sys/wait.h 0644 root root 44 3475 1347419309 1 d none /usr/local/include/postgresql/server/port/win32_msvc 0755 root root 1 f none /usr/local/include/postgresql/server/port/win32_msvc/dirent.h 0644 root root 411 33794 1347419309 1 d none /usr/local/include/postgresql/server/port/win32_msvc/sys 0755 root root 1 f none /usr/local/include/postgresql/server/port/win32_msvc/sys/file.h 0644 root root 45 3896 1347419309 1 f none /usr/local/include/postgresql/server/port/win32_msvc/sys/param.h 0644 root root 46 4009 1347419309 1 f none /usr/local/include/postgresql/server/port/win32_msvc/sys/time.h 0644 root root 45 3911 1347419309 1 f none /usr/local/include/postgresql/server/port/win32_msvc/unistd.h 0644 root root 43 3745 1347419309 1 f none /usr/local/include/postgresql/server/port/win32_msvc/utime.h 0644 root root 42 3630 1347419309 1 d none /usr/local/include/postgresql/server/portability 0755 root root 1 f none /usr/local/include/postgresql/server/portability/instr_time.h 0644 root root 4262 61224 1347419309 1 f none /usr/local/include/postgresql/server/postgres.h 0644 root root 20550 48738 1347419309 1 f none /usr/local/include/postgresql/server/postgres_ext.h 0644 root root 1778 8903 1347419309 1 f none /usr/local/include/postgresql/server/postgres_fe.h 0644 root root 730 54063 1347419309 1 d none /usr/local/include/postgresql/server/postmaster 0755 root root 1 f none /usr/local/include/postgresql/server/postmaster/autovacuum.h 0644 root root 1965 40205 1347419309 1 f none /usr/local/include/postgresql/server/postmaster/bgwriter.h 0644 root root 1239 37701 1347419309 1 f none /usr/local/include/postgresql/server/postmaster/fork_process.h 0644 root root 447 30691 1347419309 1 f none /usr/local/include/postgresql/server/postmaster/pgarch.h 0644 root root 641 45645 1347419309 1 f none /usr/local/include/postgresql/server/postmaster/postmaster.h 0644 root root 1765 17711 1347419309 1 f none /usr/local/include/postgresql/server/postmaster/startup.h 0644 root root 635 48878 1347419309 1 f none /usr/local/include/postgresql/server/postmaster/syslogger.h 0644 root root 2571 10401 1347419309 1 f none /usr/local/include/postgresql/server/postmaster/walwriter.h 0644 root root 487 33996 1347419309 1 d none /usr/local/include/postgresql/server/regex 0755 root root 1 f none /usr/local/include/postgresql/server/regex/regcustom.h 0644 root root 2892 31982 1347419309 1 f none /usr/local/include/postgresql/server/regex/regerrs.h 0644 root root 1214 25525 1347419309 1 f none /usr/local/include/postgresql/server/regex/regex.h 0644 root root 6595 52283 1347419309 1 f none /usr/local/include/postgresql/server/regex/regguts.h 0644 root root 15392 50306 1347419309 1 d none /usr/local/include/postgresql/server/replication 0755 root root 1 f none /usr/local/include/postgresql/server/replication/basebackup.h 0644 root root 494 34341 1347419309 1 f none /usr/local/include/postgresql/server/replication/syncrep.h 0644 root root 1518 55943 1347419309 1 f none /usr/local/include/postgresql/server/replication/walprotocol.h 0644 root root 3366 17716 1347419309 1 f none /usr/local/include/postgresql/server/replication/walreceiver.h 0644 root root 3884 981 1347419309 1 f none /usr/local/include/postgresql/server/replication/walsender.h 0644 root root 1001 16364 1347419309 1 f none /usr/local/include/postgresql/server/replication/walsender_private.h 0644 root root 3036 53296 1347419309 1 d none /usr/local/include/postgresql/server/rewrite 0755 root root 1 f none /usr/local/include/postgresql/server/rewrite/prs2lock.h 0644 root root 1070 16122 1347419309 1 f none /usr/local/include/postgresql/server/rewrite/rewriteDefine.h 0644 root root 1143 20696 1347419309 1 f none /usr/local/include/postgresql/server/rewrite/rewriteHandler.h 0644 root root 744 57214 1347419309 1 f none /usr/local/include/postgresql/server/rewrite/rewriteManip.h 0644 root root 2764 37971 1347419309 1 f none /usr/local/include/postgresql/server/rewrite/rewriteRemove.h 0644 root root 537 38035 1347419309 1 f none /usr/local/include/postgresql/server/rewrite/rewriteSupport.h 0644 root root 911 5157 1347419309 1 f none /usr/local/include/postgresql/server/rusagestub.h 0644 root root 843 61889 1347419309 1 d none /usr/local/include/postgresql/server/snowball 0755 root root 1 f none /usr/local/include/postgresql/server/snowball/header.h 0644 root root 1690 5770 1347419309 1 d none /usr/local/include/postgresql/server/snowball/libstemmer 0755 root root 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/api.h 0644 root root 763 64946 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/header.h 0644 root root 2487 16389 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_danish.h 0644 root root 325 28045 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_dutch.h 0644 root root 322 27760 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_english.h 0644 root root 328 28390 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_finnish.h 0644 root root 328 28405 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_french.h 0644 root root 325 28042 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_german.h 0644 root root 325 28054 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_hungarian.h 0644 root root 334 29023 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_italian.h 0644 root root 328 28366 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_norwegian.h 0644 root root 334 29062 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_porter.h 0644 root root 325 28156 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_portuguese.h 0644 root root 337 29473 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_spanish.h 0644 root root 328 28426 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_swedish.h 0644 root root 328 28429 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_2_romanian.h 0644 root root 331 28714 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_KOI8_R_russian.h 0644 root root 316 27763 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_danish.h 0644 root root 310 27127 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_dutch.h 0644 root root 307 26842 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_english.h 0644 root root 313 27472 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_finnish.h 0644 root root 313 27487 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_french.h 0644 root root 310 27124 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_german.h 0644 root root 310 27136 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_hungarian.h 0644 root root 319 28105 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_italian.h 0644 root root 313 27448 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_norwegian.h 0644 root root 319 28144 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_porter.h 0644 root root 310 27238 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_portuguese.h 0644 root root 322 28555 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_romanian.h 0644 root root 316 27793 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_russian.h 0644 root root 313 27553 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_spanish.h 0644 root root 313 27508 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_swedish.h 0644 root root 313 27511 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_turkish.h 0644 root root 313 27568 1347419309 1 d none /usr/local/include/postgresql/server/storage 0755 root root 1 f none /usr/local/include/postgresql/server/storage/backendid.h 0644 root root 730 51005 1347419309 1 f none /usr/local/include/postgresql/server/storage/barrier.h 0644 root root 6445 25044 1347419309 1 f none /usr/local/include/postgresql/server/storage/block.h 0644 root root 3281 1187 1347419309 1 f none /usr/local/include/postgresql/server/storage/buf.h 0644 root root 1082 17129 1347419309 1 f none /usr/local/include/postgresql/server/storage/buf_internals.h 0644 root root 7963 13200 1347419309 1 f none /usr/local/include/postgresql/server/storage/buffile.h 0644 root root 1714 12012 1347419309 1 f none /usr/local/include/postgresql/server/storage/bufmgr.h 0644 root root 6950 62401 1347419309 1 f none /usr/local/include/postgresql/server/storage/bufpage.h 0644 root root 13193 12038 1347419309 1 f none /usr/local/include/postgresql/server/storage/copydir.h 0644 root root 561 40290 1347419309 1 f none /usr/local/include/postgresql/server/storage/fd.h 0644 root root 3423 24352 1347419309 1 f none /usr/local/include/postgresql/server/storage/freespace.h 0644 root root 1264 35691 1347419309 1 f none /usr/local/include/postgresql/server/storage/fsm_internals.h 0644 root root 2296 57945 1347419309 1 f none /usr/local/include/postgresql/server/storage/indexfsm.h 0644 root root 795 61420 1347419309 1 f none /usr/local/include/postgresql/server/storage/ipc.h 0644 root root 2600 18517 1347419309 1 f none /usr/local/include/postgresql/server/storage/item.h 0644 root root 469 31708 1347419309 1 f none /usr/local/include/postgresql/server/storage/itemid.h 0644 root root 4341 14322 1347419309 1 f none /usr/local/include/postgresql/server/storage/itemptr.h 0644 root root 3812 54502 1347419309 1 f none /usr/local/include/postgresql/server/storage/large_object.h 0644 root root 2964 48730 1347419309 1 f none /usr/local/include/postgresql/server/storage/latch.h 0644 root root 5399 2495 1347419309 1 f none /usr/local/include/postgresql/server/storage/lmgr.h 0644 root root 3224 12313 1347419309 1 f none /usr/local/include/postgresql/server/storage/lock.h 0644 root root 20611 64853 1347419309 1 f none /usr/local/include/postgresql/server/storage/lwlock.h 0644 root root 3665 42202 1347419309 1 f none /usr/local/include/postgresql/server/storage/off.h 0644 root root 1618 60679 1347419309 1 f none /usr/local/include/postgresql/server/storage/pg_sema.h 0644 root root 2469 10863 1347419309 1 f none /usr/local/include/postgresql/server/storage/pg_shmem.h 0644 root root 1956 27391 1347419309 1 f none /usr/local/include/postgresql/server/storage/pmsignal.h 0644 root root 2080 41129 1347419309 1 f none /usr/local/include/postgresql/server/storage/pos.h 0644 root root 1592 60695 1347419309 1 f none /usr/local/include/postgresql/server/storage/predicate.h 0644 root root 2623 32119 1347419309 1 f none /usr/local/include/postgresql/server/storage/predicate_internals.h 0644 root root 17906 55412 1347419309 1 f none /usr/local/include/postgresql/server/storage/proc.h 0644 root root 9801 33810 1347419309 1 f none /usr/local/include/postgresql/server/storage/procarray.h 0644 root root 2958 62117 1347419309 1 f none /usr/local/include/postgresql/server/storage/procsignal.h 0644 root root 1798 13394 1347419309 1 f none /usr/local/include/postgresql/server/storage/reinit.h 0644 root root 588 41139 1347419309 1 f none /usr/local/include/postgresql/server/storage/relfilenode.h 0644 root root 4416 41241 1347419309 1 f none /usr/local/include/postgresql/server/storage/s_lock.h 0644 root root 26285 63248 1347419309 1 f none /usr/local/include/postgresql/server/storage/shmem.h 0644 root root 2694 26282 1347419309 1 f none /usr/local/include/postgresql/server/storage/sinval.h 0644 root root 5089 33061 1347419309 1 f none /usr/local/include/postgresql/server/storage/sinvaladt.h 0644 root root 1522 61336 1347419309 1 f none /usr/local/include/postgresql/server/storage/smgr.h 0644 root root 5583 30862 1347419309 1 f none /usr/local/include/postgresql/server/storage/spin.h 0644 root root 2568 16803 1347419309 1 f none /usr/local/include/postgresql/server/storage/standby.h 0644 root root 4085 26198 1347419309 1 d none /usr/local/include/postgresql/server/tcop 0755 root root 1 f none /usr/local/include/postgresql/server/tcop/dest.h 0644 root root 5670 24127 1347419309 1 f none /usr/local/include/postgresql/server/tcop/fastpath.h 0644 root root 509 35675 1347419309 1 f none /usr/local/include/postgresql/server/tcop/pquery.h 0644 root root 1161 27113 1347419309 1 f none /usr/local/include/postgresql/server/tcop/tcopdebug.h 0644 root root 1316 21742 1347419309 1 f none /usr/local/include/postgresql/server/tcop/tcopprot.h 0644 root root 2996 55912 1347419309 1 f none /usr/local/include/postgresql/server/tcop/utility.h 0644 root root 1514 59783 1347419309 1 d none /usr/local/include/postgresql/server/tsearch 0755 root root 1 d none /usr/local/include/postgresql/server/tsearch/dicts 0755 root root 1 f none /usr/local/include/postgresql/server/tsearch/dicts/regis.h 0644 root root 915 1629 1347419309 1 f none /usr/local/include/postgresql/server/tsearch/dicts/spell.h 0644 root root 3697 26849 1347419309 1 f none /usr/local/include/postgresql/server/tsearch/ts_cache.h 0644 root root 2109 38292 1347419309 1 f none /usr/local/include/postgresql/server/tsearch/ts_locale.h 0644 root root 2055 33086 1347419309 1 f none /usr/local/include/postgresql/server/tsearch/ts_public.h 0644 root root 2809 21524 1347419309 1 f none /usr/local/include/postgresql/server/tsearch/ts_type.h 0644 root root 8812 55356 1347419309 1 f none /usr/local/include/postgresql/server/tsearch/ts_utils.h 0644 root root 7829 4582 1347419309 1 d none /usr/local/include/postgresql/server/utils 0755 root root 1 f none /usr/local/include/postgresql/server/utils/acl.h 0644 root root 13098 31821 1347419309 1 f none /usr/local/include/postgresql/server/utils/array.h 0644 root root 10863 57414 1347419309 1 f none /usr/local/include/postgresql/server/utils/ascii.h 0644 root root 579 42025 1347419309 1 f none /usr/local/include/postgresql/server/utils/attoptcache.h 0644 root root 716 53471 1347419309 1 f none /usr/local/include/postgresql/server/utils/builtins.h 0644 root root 48719 42868 1347419309 1 f none /usr/local/include/postgresql/server/utils/bytea.h 0644 root root 1615 64112 1347419309 1 f none /usr/local/include/postgresql/server/utils/cash.h 0644 root root 2118 45533 1347419309 1 f none /usr/local/include/postgresql/server/utils/catcache.h 0644 root root 7734 43523 1347419309 1 f none /usr/local/include/postgresql/server/utils/combocid.h 0644 root root 698 52060 1347419309 1 f none /usr/local/include/postgresql/server/utils/date.h 0644 root root 7919 4881 1347419309 1 f none /usr/local/include/postgresql/server/utils/datetime.h 0644 root root 8757 23248 1347419309 1 f none /usr/local/include/postgresql/server/utils/datum.h 0644 root root 1520 57061 1347419309 1 f none /usr/local/include/postgresql/server/utils/dynahash.h 0644 root root 498 34232 1347419309 1 f none /usr/local/include/postgresql/server/utils/dynamic_loader.h 0644 root root 648 47623 1347419309 1 f none /usr/local/include/postgresql/server/utils/elog.h 0644 root root 12857 14027 1347419309 1 f none /usr/local/include/postgresql/server/utils/errcodes.h 0644 root root 20079 65175 1347419309 1 f none /usr/local/include/postgresql/server/utils/fmgroids.h 0644 root root 62560 44991 1347419309 1 f none /usr/local/include/postgresql/server/utils/fmgrtab.h 0644 root root 1181 25590 1347419309 1 f none /usr/local/include/postgresql/server/utils/formatting.h 0644 root root 1261 35536 1347419309 1 f none /usr/local/include/postgresql/server/utils/geo_decls.h 0644 root root 16242 60062 1347419309 1 f none /usr/local/include/postgresql/server/utils/guc.h 0644 root root 13503 20197 1347419309 1 f none /usr/local/include/postgresql/server/utils/guc_tables.h 0644 root root 7319 12077 1347419309 1 f none /usr/local/include/postgresql/server/utils/help_config.h 0644 root root 432 29084 1347419309 1 f none /usr/local/include/postgresql/server/utils/hsearch.h 0644 root root 5639 8050 1347419309 1 f none /usr/local/include/postgresql/server/utils/inet.h 0644 root root 2722 23333 1347419309 1 f none /usr/local/include/postgresql/server/utils/int8.h 0644 root root 4130 8792 1347419309 1 f none /usr/local/include/postgresql/server/utils/inval.h 0644 root root 1849 23057 1347419309 1 f none /usr/local/include/postgresql/server/utils/json.h 0644 root root 916 5604 1347419309 1 f none /usr/local/include/postgresql/server/utils/logtape.h 0644 root root 1539 62057 1347419309 1 f none /usr/local/include/postgresql/server/utils/lsyscache.h 0644 root root 6663 64530 1347419309 1 f none /usr/local/include/postgresql/server/utils/memutils.h 0644 root root 5037 38397 1347419309 1 f none /usr/local/include/postgresql/server/utils/nabstime.h 0644 root root 5927 24841 1347419309 1 f none /usr/local/include/postgresql/server/utils/numeric.h 0644 root root 1833 13366 1347419309 1 f none /usr/local/include/postgresql/server/utils/palloc.h 0644 root root 4006 20054 1347419309 1 f none /usr/local/include/postgresql/server/utils/pg_crc.h 0644 root root 4465 22267 1347419309 1 f none /usr/local/include/postgresql/server/utils/pg_crc_tables.h 0644 root root 20203 47300 1347419309 1 f none /usr/local/include/postgresql/server/utils/pg_locale.h 0644 root root 2614 29074 1347419309 1 f none /usr/local/include/postgresql/server/utils/pg_lzcompress.h 0644 root root 3045 45929 1347419309 1 f none /usr/local/include/postgresql/server/utils/pg_rusage.h 0644 root root 847 65424 1347419309 1 f none /usr/local/include/postgresql/server/utils/plancache.h 0644 root root 7347 35915 1347419309 1 f none /usr/local/include/postgresql/server/utils/portal.h 0644 root root 8911 37494 1347419309 1 f none /usr/local/include/postgresql/server/utils/probes.h 0644 root root 6654 33176 1347419309 1 f none /usr/local/include/postgresql/server/utils/ps_status.h 0644 root root 668 51504 1347419309 1 f none /usr/local/include/postgresql/server/utils/rangetypes.h 0644 root root 7577 38449 1347419309 1 f none /usr/local/include/postgresql/server/utils/rbtree.h 0644 root root 2312 55775 1347419309 1 f none /usr/local/include/postgresql/server/utils/rel.h 0644 root root 12658 16510 1347419309 1 f none /usr/local/include/postgresql/server/utils/relcache.h 0644 root root 3241 11100 1347419309 1 f none /usr/local/include/postgresql/server/utils/relmapper.h 0644 root root 1719 8149 1347419309 1 f none /usr/local/include/postgresql/server/utils/reltrigger.h 0644 root root 1999 33515 1347419309 1 f none /usr/local/include/postgresql/server/utils/resowner.h 0644 root root 4960 36572 1347419309 1 f none /usr/local/include/postgresql/server/utils/selfuncs.h 0644 root root 7533 40605 1347419309 1 f none /usr/local/include/postgresql/server/utils/snapmgr.h 0644 root root 1625 10656 1347419309 1 f none /usr/local/include/postgresql/server/utils/snapshot.h 0644 root root 2653 19559 1347419309 1 f none /usr/local/include/postgresql/server/utils/sortsupport.h 0644 root root 5427 64487 1347419309 1 f none /usr/local/include/postgresql/server/utils/spccache.h 0644 root root 556 39333 1347419309 1 f none /usr/local/include/postgresql/server/utils/syscache.h 0644 root root 5593 50252 1347419309 1 f none /usr/local/include/postgresql/server/utils/timestamp.h 0644 root root 9731 51308 1347419309 1 f none /usr/local/include/postgresql/server/utils/tqual.h 0644 root root 3507 34041 1347419309 1 f none /usr/local/include/postgresql/server/utils/tuplesort.h 0644 root root 4726 19377 1347419309 1 f none /usr/local/include/postgresql/server/utils/tuplestore.h 0644 root root 3213 21407 1347419309 1 f none /usr/local/include/postgresql/server/utils/typcache.h 0644 root root 4361 31294 1347419309 1 f none /usr/local/include/postgresql/server/utils/tzparser.h 0644 root root 993 10973 1347419309 1 f none /usr/local/include/postgresql/server/utils/uuid.h 0644 root root 861 63449 1347419309 1 f none /usr/local/include/postgresql/server/utils/varbit.h 0644 root root 4159 7206 1347419309 1 f none /usr/local/include/postgresql/server/utils/xml.h 0644 root root 3986 15516 1347419309 1 f none /usr/local/include/postgresql/server/windowapi.h 0644 root root 2379 2298 1347419309 1 f none /usr/local/include/sql3types.h 0644 root root 834 59470 1347419309 1 f none /usr/local/include/sqlca.h 0644 root root 1267 26312 1347419309 1 f none /usr/local/include/sqlda-compat.h 0644 root root 1583 59559 1347419309 1 f none /usr/local/include/sqlda-native.h 0644 root root 820 2805 1347419309 1 f none /usr/local/include/sqlda.h 0644 root root 315 27403 1347419309 1 d none /usr/local/lib 0755 root root 1 f none /usr/local/lib/libecpg.a 0644 root root 930228 40688 1347419309 1 s none /usr/local/lib/libecpg.so=libecpg.so.6.4 1 s none /usr/local/lib/libecpg.so.6=libecpg.so.6.4 1 f none /usr/local/lib/libecpg.so.6.4 0755 root root 905000 40215 1347419309 1 f none /usr/local/lib/libecpg_compat.a 0644 root root 17512 16544 1347419309 1 s none /usr/local/lib/libecpg_compat.so=libecpg_compat.so.3.4 1 s none /usr/local/lib/libecpg_compat.so.3=libecpg_compat.so.3.4 1 f none /usr/local/lib/libecpg_compat.so.3.4 0755 root root 22364 2073 1347419309 1 f none /usr/local/lib/libpgport.a 0644 root root 87860 26572 1347419306 1 f none /usr/local/lib/libpgtypes.a 0644 root root 103184 25291 1347419309 1 s none /usr/local/lib/libpgtypes.so=libpgtypes.so.3.3 1 s none /usr/local/lib/libpgtypes.so.3=libpgtypes.so.3.3 1 f none /usr/local/lib/libpgtypes.so.3.3 0755 root root 90716 12815 1347419309 1 f none /usr/local/lib/libpq.a 0644 root root 291928 32488 1347419309 1 s none /usr/local/lib/libpq.so=libpq.so.5.5 1 s none /usr/local/lib/libpq.so.5=libpq.so.5.5 1 f none /usr/local/lib/libpq.so.5.5 0755 root root 249872 45678 1347419309 1 d none /usr/local/lib/postgresql 0755 root root 1 f none /usr/local/lib/postgresql/_int.so 0755 root root 60320 39204 1347419311 1 f none /usr/local/lib/postgresql/adminpack.so 0755 root root 15780 39803 1347419310 1 f none /usr/local/lib/postgresql/ascii_and_mic.so 0755 root root 6764 3651 1347419308 1 f none /usr/local/lib/postgresql/auth_delay.so 0755 root root 7056 18104 1347419310 1 f none /usr/local/lib/postgresql/auto_explain.so 0755 root root 12868 56644 1347419311 1 f none /usr/local/lib/postgresql/autoinc.so 0755 root root 9468 30427 1347419312 1 f none /usr/local/lib/postgresql/btree_gin.so 0755 root root 44400 11442 1347419311 1 f none /usr/local/lib/postgresql/btree_gist.so 0755 root root 124252 24321 1347419311 1 f none /usr/local/lib/postgresql/chkpass.so 0755 root root 9004 17915 1347419311 1 f none /usr/local/lib/postgresql/citext.so 0755 root root 10548 10299 1347419311 1 f none /usr/local/lib/postgresql/cube.so 0755 root root 55508 5275 1347419311 1 f none /usr/local/lib/postgresql/cyrillic_and_mic.so 0755 root root 15212 11693 1347419308 1 f none /usr/local/lib/postgresql/dblink.so 0755 root root 49900 44867 1347419311 1 f none /usr/local/lib/postgresql/dict_int.so 0755 root root 7956 19886 1347419311 1 f none /usr/local/lib/postgresql/dict_snowball.so 0755 root root 435232 7268 1347419308 1 f none /usr/local/lib/postgresql/dict_xsyn.so 0755 root root 10920 14097 1347419311 1 f none /usr/local/lib/postgresql/dummy_seclabel.so 0755 root root 7232 53956 1347419311 1 f none /usr/local/lib/postgresql/earthdistance.so 0755 root root 8016 37738 1347419311 1 f none /usr/local/lib/postgresql/euc2004_sjis2004.so 0755 root root 8872 23523 1347419308 1 f none /usr/local/lib/postgresql/euc_cn_and_mic.so 0755 root root 7364 555 1347419308 1 f none /usr/local/lib/postgresql/euc_jp_and_sjis.so 0755 root root 15160 41925 1347419308 1 f none /usr/local/lib/postgresql/euc_kr_and_mic.so 0755 root root 7492 4229 1347419308 1 f none /usr/local/lib/postgresql/euc_tw_and_big5.so 0755 root root 13812 47798 1347419308 1 f none /usr/local/lib/postgresql/file_fdw.so 0755 root root 19508 16866 1347419311 1 f none /usr/local/lib/postgresql/fuzzystrmatch.so 0755 root root 41156 34232 1347419311 1 f none /usr/local/lib/postgresql/hstore.so 0755 root root 66200 46774 1347419311 1 f none /usr/local/lib/postgresql/insert_username.so 0755 root root 8892 42867 1347419312 1 f none /usr/local/lib/postgresql/isn.so 0755 root root 63360 42805 1347419311 1 f none /usr/local/lib/postgresql/latin2_and_win1250.so 0755 root root 9540 23144 1347419308 1 f none /usr/local/lib/postgresql/latin_and_mic.so 0755 root root 8712 5044 1347419308 1 f none /usr/local/lib/postgresql/libpqwalreceiver.so 0755 root root 13980 44564 1347419309 1 f none /usr/local/lib/postgresql/lo.so 0755 root root 7632 60862 1347419311 1 f none /usr/local/lib/postgresql/ltree.so 0755 root root 83200 17207 1347419311 1 f none /usr/local/lib/postgresql/moddatetime.so 0755 root root 8996 58273 1347419312 1 f none /usr/local/lib/postgresql/pageinspect.so 0755 root root 26272 38163 1347419312 1 f none /usr/local/lib/postgresql/passwordcheck.so 0755 root root 8244 61241 1347419312 1 f none /usr/local/lib/postgresql/pg_buffercache.so 0755 root root 9568 41622 1347419312 1 f none /usr/local/lib/postgresql/pg_freespacemap.so 0755 root root 7236 35547 1347419312 1 f none /usr/local/lib/postgresql/pg_stat_statements.so 0755 root root 33112 51749 1347419312 1 f none /usr/local/lib/postgresql/pg_trgm.so 0755 root root 32004 18918 1347419312 1 f none /usr/local/lib/postgresql/pg_upgrade_support.so 0755 root root 10692 14237 1347419312 1 f none /usr/local/lib/postgresql/pgcrypto.so 0755 root root 184340 39332 1347419312 1 f none /usr/local/lib/postgresql/pgrowlocks.so 0755 root root 11600 3750 1347419312 1 f none /usr/local/lib/postgresql/pgstattuple.so 0755 root root 21492 18242 1347419312 1 f none /usr/local/lib/postgresql/pgxml.so 0755 root root 26812 3032 1347419313 1 d none /usr/local/lib/postgresql/pgxs 0755 root root 1 d none /usr/local/lib/postgresql/pgxs/config 0755 root root 1 f none /usr/local/lib/postgresql/pgxs/config/install-sh 0755 root root 13901 20906 1347419310 1 d none /usr/local/lib/postgresql/pgxs/src 0755 root root 1 f none /usr/local/lib/postgresql/pgxs/src/Makefile.global 0644 root root 23140 51963 1347419310 1 f none /usr/local/lib/postgresql/pgxs/src/Makefile.port 0644 root root 484 35873 1347419310 1 f none /usr/local/lib/postgresql/pgxs/src/Makefile.shlib 0644 root root 14858 31014 1347419310 1 d none /usr/local/lib/postgresql/pgxs/src/makefiles 0755 root root 1 f none /usr/local/lib/postgresql/pgxs/src/makefiles/pgxs.mk 0644 root root 7947 39936 1347419310 1 f none /usr/local/lib/postgresql/pgxs/src/nls-global.mk 0644 root root 5971 12498 1347419310 1 d none /usr/local/lib/postgresql/pgxs/src/test 0755 root root 1 d none /usr/local/lib/postgresql/pgxs/src/test/regress 0755 root root 1 f none /usr/local/lib/postgresql/pgxs/src/test/regress/pg_regress 0755 root root 67160 45221 1347419310 1 f none /usr/local/lib/postgresql/plpgsql.so 0755 root root 186204 51156 1347419310 1 f none /usr/local/lib/postgresql/pltcl.so 0755 root root 39916 25398 1347419310 1 f none /usr/local/lib/postgresql/refint.so 0755 root root 18108 63895 1347419312 1 f none /usr/local/lib/postgresql/seg.so 0755 root root 40296 16327 1347419312 1 f none /usr/local/lib/postgresql/sslinfo.so 0755 root root 13976 35209 1347419313 1 f none /usr/local/lib/postgresql/tablefunc.so 0755 root root 27300 1271 1347419312 1 f none /usr/local/lib/postgresql/tcn.so 0755 root root 9708 8663 1347419313 1 f none /usr/local/lib/postgresql/test_parser.so 0755 root root 7720 63093 1347419313 1 f none /usr/local/lib/postgresql/timetravel.so 0755 root root 15460 32755 1347419312 1 f none /usr/local/lib/postgresql/tsearch2.so 0755 root root 26308 23239 1347419313 1 f none /usr/local/lib/postgresql/unaccent.so 0755 root root 12928 54157 1347419313 1 f none /usr/local/lib/postgresql/utf8_and_ascii.so 0755 root root 6772 4538 1347419308 1 f none /usr/local/lib/postgresql/utf8_and_big5.so 0755 root root 226264 65 1347419308 1 f none /usr/local/lib/postgresql/utf8_and_cyrillic.so 0755 root root 11652 55084 1347419308 1 f none /usr/local/lib/postgresql/utf8_and_euc2004.so 0755 root root 190520 33081 1347419308 1 f none /usr/local/lib/postgresql/utf8_and_euc_cn.so 0755 root root 125988 11677 1347419308 1 f none /usr/local/lib/postgresql/utf8_and_euc_jp.so 0755 root root 217844 55014 1347419308 1 f none /usr/local/lib/postgresql/utf8_and_euc_kr.so 0755 root root 138500 19257 1347419308 1 f none /usr/local/lib/postgresql/utf8_and_euc_tw.so 0755 root root 337156 47618 1347419308 1 f none /usr/local/lib/postgresql/utf8_and_gb18030.so 0755 root root 1020648 50469 1347419308 1 f none /usr/local/lib/postgresql/utf8_and_gbk.so 0755 root root 355500 53067 1347419308 1 f none /usr/local/lib/postgresql/utf8_and_iso8859.so 0755 root root 34132 21787 1347419308 1 f none /usr/local/lib/postgresql/utf8_and_iso8859_1.so 0755 root root 7616 27303 1347419308 1 f none /usr/local/lib/postgresql/utf8_and_johab.so 0755 root root 279644 39697 1347419308 1 f none /usr/local/lib/postgresql/utf8_and_sjis.so 0755 root root 128320 27127 1347419308 1 f none /usr/local/lib/postgresql/utf8_and_sjis2004.so 0755 root root 190040 13395 1347419308 1 f none /usr/local/lib/postgresql/utf8_and_uhc.so 0755 root root 282620 20642 1347419308 1 f none /usr/local/lib/postgresql/utf8_and_win.so 0755 root root 29404 20564 1347419308 1 d none /usr/local/share 0755 root root 1 d none /usr/local/share/doc 0755 root root 1 d none /usr/local/share/doc/postgresql 0755 root root 1 d none /usr/local/share/doc/postgresql/extension 0755 root root 1 f none /usr/local/share/doc/postgresql/extension/autoinc.example 0644 root root 798 56417 1347419312 1 f none /usr/local/share/doc/postgresql/extension/insert_username.example 0644 root root 560 44401 1347419312 1 f none /usr/local/share/doc/postgresql/extension/moddatetime.example 0644 root root 493 34473 1347419312 1 f none /usr/local/share/doc/postgresql/extension/refint.example 0644 root root 2105 24710 1347419312 1 f none /usr/local/share/doc/postgresql/extension/timetravel.example 0644 root root 2372 6310 1347419312 1 d none /usr/local/share/doc/postgresql/html 0755 root root 1 f none /usr/local/share/doc/postgresql/html/LEGALNOTICE.html 0644 root root 2679 62344 1347419305 1 f none /usr/local/share/doc/postgresql/html/acronyms.html 0644 root root 16281 41487 1347419305 1 f none /usr/local/share/doc/postgresql/html/admin.html 0644 root root 12497 39709 1347419305 1 f none /usr/local/share/doc/postgresql/html/adminpack.html 0644 root root 3412 63159 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-clusterdb.html 0644 root root 10600 41712 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-createdb.html 0644 root root 12854 11824 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-createlang.html 0644 root root 9905 55548 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-createuser.html 0644 root root 15638 28555 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-dropdb.html 0644 root root 9640 41596 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-droplang.html 0644 root root 9636 32496 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-dropuser.html 0644 root root 9594 39048 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-ecpg.html 0644 root root 8917 62646 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-initdb.html 0644 root root 15228 19815 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-pg-ctl.html 0644 root root 22127 50394 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-pg-dumpall.html 0644 root root 20079 62364 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-pgbasebackup.html 0644 root root 19816 60387 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-pgconfig.html 0644 root root 11091 34210 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-pgcontroldata.html 0644 root root 3977 29152 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-pgdump.html 0644 root root 42955 48967 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-pgreceivexlog.html 0644 root root 11055 45383 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-pgresetxlog.html 0644 root root 11456 31731 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-pgrestore.html 0644 root root 29944 11035 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-postgres.html 0644 root root 31484 57185 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-postmaster.html 0644 root root 3003 16004 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-psql.html 0644 root root 135001 52252 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-reindexdb.html 0644 root root 11279 16440 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-vacuumdb.html 0644 root root 12614 51902 1347419305 1 f none /usr/local/share/doc/postgresql/html/appendixes.html 0644 root root 21640 36021 1347419305 1 f none /usr/local/share/doc/postgresql/html/applevel-consistency.html 0644 root root 10358 49597 1347419305 1 f none /usr/local/share/doc/postgresql/html/archive-recovery-settings.html 0644 root root 7336 41415 1347419305 1 f none /usr/local/share/doc/postgresql/html/arrays.html 0644 root root 26891 22375 1347419305 1 f none /usr/local/share/doc/postgresql/html/auth-delay.html 0644 root root 3778 18745 1347419305 1 f none /usr/local/share/doc/postgresql/html/auth-methods.html 0644 root root 34495 62877 1347419305 1 f none /usr/local/share/doc/postgresql/html/auth-pg-hba-conf.html 0644 root root 29511 62934 1347419305 1 f none /usr/local/share/doc/postgresql/html/auth-username-maps.html 0644 root root 8595 8467 1347419305 1 f none /usr/local/share/doc/postgresql/html/auto-explain.html 0644 root root 8731 6699 1347419305 1 f none /usr/local/share/doc/postgresql/html/backup-dump.html 0644 root root 15925 53150 1347419305 1 f none /usr/local/share/doc/postgresql/html/backup-file.html 0644 root root 7994 53207 1347419305 1 f none /usr/local/share/doc/postgresql/html/backup.html 0644 root root 4483 3753 1347419305 1 f none /usr/local/share/doc/postgresql/html/biblio.html 0644 root root 11547 37197 1347419305 1 f none /usr/local/share/doc/postgresql/html/bki-commands.html 0644 root root 9644 27707 1347419305 1 f none /usr/local/share/doc/postgresql/html/bki-example.html 0644 root root 3047 25416 1347419305 1 f none /usr/local/share/doc/postgresql/html/bki-format.html 0644 root root 3461 59037 1347419305 1 f none /usr/local/share/doc/postgresql/html/bki-structure.html 0644 root root 4318 46948 1347419305 1 f none /usr/local/share/doc/postgresql/html/bki.html 0644 root root 4328 59268 1347419305 1 f none /usr/local/share/doc/postgresql/html/bookindex.html 0644 root root 241543 4032 1347419305 1 f none /usr/local/share/doc/postgresql/html/btree-gin.html 0644 root root 4598 12803 1347419305 1 f none /usr/local/share/doc/postgresql/html/btree-gist.html 0644 root root 6883 56616 1347419305 1 f none /usr/local/share/doc/postgresql/html/bug-reporting.html 0644 root root 18642 2304 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-aggregate.html 0644 root root 5500 12266 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-am.html 0644 root root 10545 43757 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-amop.html 0644 root root 7591 42402 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-amproc.html 0644 root root 4883 31933 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-attrdef.html 0644 root root 4362 57213 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-attribute.html 0644 root root 10285 40900 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-auth-members.html 0644 root root 4253 43905 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-authid.html 0644 root root 6813 47946 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-cast.html 0644 root root 6953 2178 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-class.html 0644 root root 12659 61309 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-collation.html 0644 root root 5895 46581 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-constraint.html 0644 root root 11574 61380 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-conversion.html 0644 root root 4428 55363 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-database.html 0644 root root 7025 53443 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-db-role-setting.html 0644 root root 4066 35795 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-default-acl.html 0644 root root 5221 57099 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-depend.html 0644 root root 8633 53056 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-description.html 0644 root root 4476 65077 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-enum.html 0644 root root 4714 26295 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-extension.html 0644 root root 5280 60841 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-foreign-data-wrapper.html 0644 root root 4943 34151 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-foreign-server.html 0644 root root 4686 12983 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-foreign-table.html 0644 root root 4034 31619 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-index.html 0644 root root 8783 56030 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-inherits.html 0644 root root 3886 17136 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-language.html 0644 root root 5950 42266 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-largeobject-metadata.html 0644 root root 3628 64076 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-largeobject.html 0644 root root 5152 56700 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-namespace.html 0644 root root 3749 7979 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-opclass.html 0644 root root 5861 39228 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-operator.html 0644 root root 6643 16823 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-opfamily.html 0644 root root 4809 27571 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-pltemplate.html 0644 root root 5362 4885 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-proc.html 0644 root root 13401 7268 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-range.html 0644 root root 5180 49192 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-rewrite.html 0644 root root 5391 52125 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-seclabel.html 0644 root root 4513 873 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-shdepend.html 0644 root root 7041 63424 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-shdescription.html 0644 root root 4245 50284 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-shseclabel.html 0644 root root 4402 61922 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-statistic.html 0644 root root 9487 61999 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-tablespace.html 0644 root root 4156 37978 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-trigger.html 0644 root root 8285 19924 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-ts-config-map.html 0644 root root 4191 42147 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-ts-config.html 0644 root root 4479 490 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-ts-dict.html 0644 root root 4714 20646 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-ts-parser.html 0644 root root 5080 41813 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-ts-template.html 0644 root root 4256 47689 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-type.html 0644 root root 19903 10119 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-user-mapping.html 0644 root root 3845 14862 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalogs-overview.html 0644 root root 10429 7457 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalogs.html 0644 root root 10385 47073 1347419305 1 f none /usr/local/share/doc/postgresql/html/charset.html 0644 root root 4160 42323 1347419305 1 f none /usr/local/share/doc/postgresql/html/chkpass.html 0644 root root 4389 6520 1347419305 1 f none /usr/local/share/doc/postgresql/html/citext.html 0644 root root 11067 51544 1347419305 1 f none /usr/local/share/doc/postgresql/html/client-authentication-problems.html 0644 root root 4222 61941 1347419305 1 f none /usr/local/share/doc/postgresql/html/client-authentication.html 0644 root root 5912 62842 1347419305 1 f none /usr/local/share/doc/postgresql/html/client-interfaces.html 0644 root root 13715 56270 1347419305 1 f none /usr/local/share/doc/postgresql/html/collation.html 0644 root root 14220 13137 1347419305 1 f none /usr/local/share/doc/postgresql/html/config-setting.html 0644 root root 11144 21158 1347419305 1 f none /usr/local/share/doc/postgresql/html/connect-estab.html 0644 root root 4313 780 1347419305 1 f none /usr/local/share/doc/postgresql/html/continuous-archiving.html 0644 root root 49828 27905 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-build-sql-delete.html 0644 root root 5449 9666 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-build-sql-insert.html 0644 root root 6050 57453 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-build-sql-update.html 0644 root root 6279 8843 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-cancel-query.html 0644 root root 3817 18926 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-close.html 0644 root root 4647 12124 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-connect-u.html 0644 root root 4480 17507 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-connect.html 0644 root root 7322 30195 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-disconnect.html 0644 root root 3715 7521 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-error-message.html 0644 root root 3505 59507 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-exec.html 0644 root root 5463 11085 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-fetch.html 0644 root root 5976 56717 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-function.html 0644 root root 8627 10270 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-get-connections.html 0644 root root 3204 37625 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-get-notify.html 0644 root root 4165 43401 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-get-pkey.html 0644 root root 4496 3375 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-get-result.html 0644 root root 6956 614 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-is-busy.html 0644 root root 3487 55869 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-open.html 0644 root root 5461 7861 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-send-query.html 0644 root root 4167 45398 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-prog-client.html 0644 root root 3432 57231 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-prog-server.html 0644 root root 3835 24165 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-prog.html 0644 root root 3318 49965 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-spi.html 0644 root root 11234 40034 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib.html 0644 root root 8902 27116 1347419305 1 f none /usr/local/share/doc/postgresql/html/creating-cluster.html 0644 root root 10596 51326 1347419305 1 f none /usr/local/share/doc/postgresql/html/cube.html 0644 root root 15939 63423 1347419305 1 f none /usr/local/share/doc/postgresql/html/database-roles.html 0644 root root 6090 18532 1347419305 1 f none /usr/local/share/doc/postgresql/html/datatype-binary.html 0644 root root 12891 8592 1347419305 1 f none /usr/local/share/doc/postgresql/html/datatype-bit.html 0644 root root 5094 46557 1347419305 1 f none /usr/local/share/doc/postgresql/html/datatype-boolean.html 0644 root root 5265 37817 1347419305 1 f none /usr/local/share/doc/postgresql/html/datatype-character.html 0644 root root 11891 47501 1347419305 1 f none /usr/local/share/doc/postgresql/html/datatype-datetime.html 0644 root root 49768 36313 1347419305 1 f none /usr/local/share/doc/postgresql/html/datatype-enum.html 0644 root root 6431 26182 1347419305 1 f none /usr/local/share/doc/postgresql/html/datatype-geometric.html 0644 root root 12501 8577 1347419305 1 f none /usr/local/share/doc/postgresql/html/datatype-json.html 0644 root root 3437 58197 1347419305 1 f none /usr/local/share/doc/postgresql/html/datatype-money.html 0644 root root 5050 51908 1347419305 1 f none /usr/local/share/doc/postgresql/html/datatype-net-types.html 0644 root root 10421 18397 1347419305 1 f none /usr/local/share/doc/postgresql/html/datatype-numeric.html 0644 root root 21774 26175 1347419305 1 f none /usr/local/share/doc/postgresql/html/datatype-oid.html 0644 root root 9684 21941 1347419305 1 f none /usr/local/share/doc/postgresql/html/datatype-pseudo.html 0644 root root 7283 32210 1347419305 1 f none /usr/local/share/doc/postgresql/html/datatype-textsearch.html 0644 root root 10031 20419 1347419305 1 f none /usr/local/share/doc/postgresql/html/datatype-uuid.html 0644 root root 4558 22456 1347419305 1 f none /usr/local/share/doc/postgresql/html/datatype-xml.html 0644 root root 11332 31454 1347419305 1 f none /usr/local/share/doc/postgresql/html/datatype.html 0644 root root 16481 14858 1347419305 1 f none /usr/local/share/doc/postgresql/html/datetime-appendix.html 0644 root root 3523 5135 1347419305 1 f none /usr/local/share/doc/postgresql/html/datetime-config-files.html 0644 root root 7705 8230 1347419305 1 f none /usr/local/share/doc/postgresql/html/datetime-input-rules.html 0644 root root 6761 27690 1347419305 1 f none /usr/local/share/doc/postgresql/html/datetime-keywords.html 0644 root root 5094 32747 1347419305 1 f none /usr/local/share/doc/postgresql/html/datetime-units-history.html 0644 root root 7632 10430 1347419305 1 f none /usr/local/share/doc/postgresql/html/dblink.html 0644 root root 5320 31223 1347419305 1 f none /usr/local/share/doc/postgresql/html/ddl-alter.html 0644 root root 10412 18193 1347419305 1 f none /usr/local/share/doc/postgresql/html/ddl-basics.html 0644 root root 7814 36594 1347419305 1 f none /usr/local/share/doc/postgresql/html/ddl-constraints.html 0644 root root 22383 25109 1347419305 1 f none /usr/local/share/doc/postgresql/html/ddl-default.html 0644 root root 4538 15232 1347419305 1 f none /usr/local/share/doc/postgresql/html/ddl-depend.html 0644 root root 5247 8571 1347419305 1 f none /usr/local/share/doc/postgresql/html/ddl-foreign-data.html 0644 root root 4483 18410 1347419305 1 f none /usr/local/share/doc/postgresql/html/ddl-inherit.html 0644 root root 15171 12329 1347419305 1 f none /usr/local/share/doc/postgresql/html/ddl-others.html 0644 root root 3078 29115 1347419305 1 f none /usr/local/share/doc/postgresql/html/ddl-partitioning.html 0644 root root 27761 62472 1347419305 1 f none /usr/local/share/doc/postgresql/html/ddl-priv.html 0644 root root 6064 3345 1347419305 1 f none /usr/local/share/doc/postgresql/html/ddl-schemas.html 0644 root root 18044 50485 1347419305 1 f none /usr/local/share/doc/postgresql/html/ddl-system-columns.html 0644 root root 8047 31236 1347419305 1 f none /usr/local/share/doc/postgresql/html/ddl.html 0644 root root 6222 3598 1347419305 1 f none /usr/local/share/doc/postgresql/html/dict-int.html 0644 root root 4791 33919 1347419305 1 f none /usr/local/share/doc/postgresql/html/dict-xsyn.html 0644 root root 6479 24063 1347419305 1 f none /usr/local/share/doc/postgresql/html/different-replication-solutions.html 0644 root root 14790 58665 1347419305 1 f none /usr/local/share/doc/postgresql/html/disk-full.html 0644 root root 3515 5910 1347419305 1 f none /usr/local/share/doc/postgresql/html/disk-usage.html 0644 root root 5659 30483 1347419305 1 f none /usr/local/share/doc/postgresql/html/diskusage.html 0644 root root 2666 60845 1347419305 1 f none /usr/local/share/doc/postgresql/html/dml-delete.html 0644 root root 3467 63548 1347419305 1 f none /usr/local/share/doc/postgresql/html/dml-insert.html 0644 root root 5367 15740 1347419305 1 f none /usr/local/share/doc/postgresql/html/dml-update.html 0644 root root 5554 34625 1347419305 1 f none /usr/local/share/doc/postgresql/html/dml.html 0644 root root 2858 12169 1347419305 1 f none /usr/local/share/doc/postgresql/html/docguide-authoring.html 0644 root root 6755 53625 1347419305 1 f none /usr/local/share/doc/postgresql/html/docguide-build.html 0644 root root 15797 50481 1347419305 1 f none /usr/local/share/doc/postgresql/html/docguide-docbook.html 0644 root root 3851 31764 1347419305 1 f none /usr/local/share/doc/postgresql/html/docguide-style.html 0644 root root 7427 54569 1347419305 1 f none /usr/local/share/doc/postgresql/html/docguide-toolsets.html 0644 root root 20670 50370 1347419305 1 f none /usr/local/share/doc/postgresql/html/docguide.html 0644 root root 3622 3070 1347419305 1 f none /usr/local/share/doc/postgresql/html/dummy-seclabel.html 0644 root root 4356 62424 1347419305 1 f none /usr/local/share/doc/postgresql/html/dynamic-trace.html 0644 root root 27232 22052 1347419305 1 f none /usr/local/share/doc/postgresql/html/earthdistance.html 0644 root root 8808 20292 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-commands.html 0644 root root 9525 46434 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-concept.html 0644 root root 4977 51238 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-connect.html 0644 root root 10874 26161 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-cpp.html 0644 root root 9623 4026 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-descriptors.html 0644 root root 34904 61899 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-develop.html 0644 root root 7962 2461 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-dynamic.html 0644 root root 6513 22690 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-errors.html 0644 root root 25735 3805 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-informix-compat.html 0644 root root 52757 50983 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-library.html 0644 root root 5796 37521 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-lo.html 0644 root root 5525 6736 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-pgtypes.html 0644 root root 54455 61511 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-preproc.html 0644 root root 8983 59454 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-process.html 0644 root root 5384 15551 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-allocate-descriptor.html 0644 root root 3981 19073 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-commands.html 0644 root root 4696 28092 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-connect.html 0644 root root 9383 22336 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-deallocate-descriptor.html 0644 root root 3771 1260 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-declare.html 0644 root root 5395 56651 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-describe.html 0644 root root 4593 62165 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-disconnect.html 0644 root root 4731 2607 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-execute-immediate.html 0644 root root 3875 11383 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-get-descriptor.html 0644 root root 7707 36308 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-open.html 0644 root root 4640 506 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-prepare.html 0644 root root 4175 32331 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-set-autocommit.html 0644 root root 3331 42661 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-set-connection.html 0644 root root 3927 13044 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-set-descriptor.html 0644 root root 5503 64400 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-type.html 0644 root root 5024 23620 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-var.html 0644 root root 3496 45517 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-whenever.html 0644 root root 4684 6135 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-variables.html 0644 root root 40692 13486 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg.html 0644 root root 10342 56555 1347419305 1 f none /usr/local/share/doc/postgresql/html/encryption-options.html 0644 root root 7493 14418 1347419305 1 f none /usr/local/share/doc/postgresql/html/errcodes-appendix.html 0644 root root 36962 54129 1347419305 1 f none /usr/local/share/doc/postgresql/html/error-message-reporting.html 0644 root root 14122 51893 1347419305 1 f none /usr/local/share/doc/postgresql/html/error-style-guide.html 0644 root root 16767 16343 1347419305 1 f none /usr/local/share/doc/postgresql/html/event-log-registration.html 0644 root root 4186 46312 1347419305 1 f none /usr/local/share/doc/postgresql/html/executor.html 0644 root root 6610 59293 1347419305 1 f none /usr/local/share/doc/postgresql/html/explicit-joins.html 0644 root root 11017 34463 1347419305 1 f none /usr/local/share/doc/postgresql/html/explicit-locking.html 0644 root root 25071 7541 1347419305 1 f none /usr/local/share/doc/postgresql/html/extend-extensions.html 0644 root root 30976 29531 1347419305 1 f none /usr/local/share/doc/postgresql/html/extend-how.html 0644 root root 4550 19370 1347419305 1 f none /usr/local/share/doc/postgresql/html/extend-pgxs.html 0644 root root 11759 16607 1347419305 1 f none /usr/local/share/doc/postgresql/html/extend-type-system.html 0644 root root 10091 8272 1347419305 1 f none /usr/local/share/doc/postgresql/html/extend.html 0644 root root 9962 9826 1347419305 1 f none /usr/local/share/doc/postgresql/html/external-admin-tools.html 0644 root root 2720 3004 1347419305 1 f none /usr/local/share/doc/postgresql/html/external-extensions.html 0644 root root 3265 48261 1347419305 1 f none /usr/local/share/doc/postgresql/html/external-interfaces.html 0644 root root 5034 49972 1347419305 1 f none /usr/local/share/doc/postgresql/html/external-pl.html 0644 root root 4684 27128 1347419305 1 f none /usr/local/share/doc/postgresql/html/external-projects.html 0644 root root 3002 23635 1347419305 1 f none /usr/local/share/doc/postgresql/html/fdw-callbacks.html 0644 root root 12903 27799 1347419305 1 f none /usr/local/share/doc/postgresql/html/fdw-functions.html 0644 root root 4494 19533 1347419305 1 f none /usr/local/share/doc/postgresql/html/fdw-helpers.html 0644 root root 5991 4452 1347419305 1 f none /usr/local/share/doc/postgresql/html/fdw-planning.html 0644 root root 9778 47332 1347419305 1 f none /usr/local/share/doc/postgresql/html/fdwhandler.html 0644 root root 3988 41385 1347419305 1 f none /usr/local/share/doc/postgresql/html/features-sql-standard.html 0644 root root 39103 14481 1347419305 1 f none /usr/local/share/doc/postgresql/html/features.html 0644 root root 7564 9625 1347419305 1 f none /usr/local/share/doc/postgresql/html/file-fdw.html 0644 root root 7712 58087 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-admin.html 0644 root root 49493 36162 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-aggregate.html 0644 root root 21859 13759 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-array.html 0644 root root 13519 45754 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-binarystring.html 0644 root root 12398 12560 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-bitstring.html 0644 root root 6784 22860 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-comparison.html 0644 root root 10613 57307 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-comparisons.html 0644 root root 13529 58586 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-conditional.html 0644 root root 10304 32310 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-datetime.html 0644 root root 47937 53236 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-enum.html 0644 root root 5489 20297 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-formatting.html 0644 root root 32857 32734 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-geometry.html 0644 root root 20333 63933 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-info.html 0644 root root 56697 53931 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-json.html 0644 root root 3812 13080 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-logical.html 0644 root root 4663 60054 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-matching.html 0644 root root 72431 51062 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-math.html 0644 root root 19762 13875 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-net.html 0644 root root 13500 9178 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-range.html 0644 root root 10855 35465 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-sequence.html 0644 root root 12974 6610 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-srf.html 0644 root root 8838 42184 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-string.html 0644 root root 58886 5516 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-subquery.html 0644 root root 16379 38152 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-textsearch.html 0644 root root 20486 54268 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-trigger.html 0644 root root 4546 26651 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-window.html 0644 root root 11863 2448 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-xml.html 0644 root root 32167 12340 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions.html 0644 root root 9937 28693 1347419305 1 f none /usr/local/share/doc/postgresql/html/fuzzystrmatch.html 0644 root root 8059 30085 1347419305 1 f none /usr/local/share/doc/postgresql/html/geqo-biblio.html 0644 root root 3457 56106 1347419305 1 f none /usr/local/share/doc/postgresql/html/geqo-intro.html 0644 root root 4413 13599 1347419305 1 f none /usr/local/share/doc/postgresql/html/geqo-intro2.html 0644 root root 5625 11761 1347419305 1 f none /usr/local/share/doc/postgresql/html/geqo-pg-intro.html 0644 root root 8783 33494 1347419305 1 f none /usr/local/share/doc/postgresql/html/geqo.html 0644 root root 3614 2769 1347419305 1 f none /usr/local/share/doc/postgresql/html/gin-examples.html 0644 root root 3320 44018 1347419305 1 f none /usr/local/share/doc/postgresql/html/gin-extensibility.html 0644 root root 14400 5995 1347419305 1 f none /usr/local/share/doc/postgresql/html/gin-implementation.html 0644 root root 6562 57976 1347419305 1 f none /usr/local/share/doc/postgresql/html/gin-intro.html 0644 root root 4660 30600 1347419305 1 f none /usr/local/share/doc/postgresql/html/gin-limit.html 0644 root root 2815 9420 1347419305 1 f none /usr/local/share/doc/postgresql/html/gin-tips.html 0644 root root 5711 46617 1347419305 1 f none /usr/local/share/doc/postgresql/html/gin.html 0644 root root 2927 13426 1347419305 1 f none /usr/local/share/doc/postgresql/html/gist-examples.html 0644 root root 3750 13009 1347419305 1 f none /usr/local/share/doc/postgresql/html/gist-extensibility.html 0644 root root 24352 48602 1347419305 1 f none /usr/local/share/doc/postgresql/html/gist-implementation.html 0644 root root 4099 56141 1347419305 1 f none /usr/local/share/doc/postgresql/html/gist-intro.html 0644 root root 3614 10519 1347419305 1 f none /usr/local/share/doc/postgresql/html/gist.html 0644 root root 2677 62929 1347419305 1 f none /usr/local/share/doc/postgresql/html/git.html 0644 root root 4560 16401 1347419305 1 f none /usr/local/share/doc/postgresql/html/high-availability.html 0644 root root 7805 41316 1347419305 1 f none /usr/local/share/doc/postgresql/html/history.html 0644 root root 11916 57230 1347419305 1 f none /usr/local/share/doc/postgresql/html/hot-standby.html 0644 root root 36067 40101 1347419305 1 f none /usr/local/share/doc/postgresql/html/hstore.html 0644 root root 22627 59773 1347419305 1 f none /usr/local/share/doc/postgresql/html/index-catalog.html 0644 root root 7994 50917 1347419305 1 f none /usr/local/share/doc/postgresql/html/index-cost-estimation.html 0644 root root 9989 3066 1347419305 1 f none /usr/local/share/doc/postgresql/html/index-functions.html 0644 root root 19112 24480 1347419305 1 f none /usr/local/share/doc/postgresql/html/index-locking.html 0644 root root 8047 59264 1347419305 1 f none /usr/local/share/doc/postgresql/html/index-scanning.html 0644 root root 10705 13228 1347419305 1 f none /usr/local/share/doc/postgresql/html/index-unique-checks.html 0644 root root 9190 19093 1347419305 1 f none /usr/local/share/doc/postgresql/html/index.html 0644 root root 8069 9966 1347419305 1 f none /usr/local/share/doc/postgresql/html/indexam.html 0644 root root 5245 18834 1347419305 1 f none /usr/local/share/doc/postgresql/html/indexes-bitmap-scans.html 0644 root root 6578 63228 1347419305 1 f none /usr/local/share/doc/postgresql/html/indexes-collations.html 0644 root root 3638 10565 1347419305 1 f none /usr/local/share/doc/postgresql/html/indexes-examine.html 0644 root root 7159 45831 1347419305 1 f none /usr/local/share/doc/postgresql/html/indexes-expressional.html 0644 root root 4811 45369 1347419305 1 f none /usr/local/share/doc/postgresql/html/indexes-intro.html 0644 root root 6311 36733 1347419305 1 f none /usr/local/share/doc/postgresql/html/indexes-multicolumn.html 0644 root root 6296 36601 1347419305 1 f none /usr/local/share/doc/postgresql/html/indexes-opclass.html 0644 root root 7334 45520 1347419305 1 f none /usr/local/share/doc/postgresql/html/indexes-ordering.html 0644 root root 6478 42167 1347419305 1 f none /usr/local/share/doc/postgresql/html/indexes-partial.html 0644 root root 11810 33444 1347419305 1 f none /usr/local/share/doc/postgresql/html/indexes-types.html 0644 root root 10075 41424 1347419305 1 f none /usr/local/share/doc/postgresql/html/indexes-unique.html 0644 root root 4000 42738 1347419305 1 f none /usr/local/share/doc/postgresql/html/indexes.html 0644 root root 3617 5642 1347419305 1 f none /usr/local/share/doc/postgresql/html/information-schema.html 0644 root root 11175 8620 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-administrable-role-authorizations.html 0644 root root 3749 15714 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-applicable-roles.html 0644 root root 3968 32621 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-attributes.html 0644 root root 12805 57623 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-character-sets.html 0644 root root 7048 12874 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-check-constraint-routine-usage.html 0644 root root 4347 62462 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-check-constraints.html 0644 root root 3874 26607 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-collation-character-set-applicab.html 0644 root root 4423 5684 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-collations.html 0644 root root 3883 24865 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-column-domain-usage.html 0644 root root 4320 59814 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-column-options.html 0644 root root 4107 42303 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-column-privileges.html 0644 root root 5027 42711 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-column-udt-usage.html 0644 root root 4581 10125 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-columns.html 0644 root root 17623 36921 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-constraint-column-usage.html 0644 root root 4871 39769 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-constraint-table-usage.html 0644 root root 4772 35319 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-data-type-privileges.html 0644 root root 5087 61687 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-datatypes.html 0644 root root 4227 55379 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-domain-constraints.html 0644 root root 4662 19431 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-domain-udt-usage.html 0644 root root 4169 45635 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-domains.html 0644 root root 11365 11653 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-element-types.html 0644 root root 11372 12813 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-enabled-roles.html 0644 root root 3778 20722 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-foreign-data-wrapper-options.html 0644 root root 3908 29633 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-foreign-data-wrappers.html 0644 root root 4225 58014 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-foreign-server-options.html 0644 root root 3851 24815 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-foreign-servers.html 0644 root root 4569 18820 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-foreign-table-options.html 0644 root root 4345 61703 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-foreign-tables.html 0644 root root 4070 41660 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-information-schema-catalog-name.html 0644 root root 3355 53876 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-key-column-usage.html 0644 root root 5183 60818 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-parameters.html 0644 root root 10797 30414 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-referential-constraints.html 0644 root root 5662 22898 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-role-column-grants.html 0644 root root 5015 45521 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-role-routine-grants.html 0644 root root 5358 8199 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-role-table-grants.html 0644 root root 5425 4616 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-role-udt-grants.html 0644 root root 4779 27252 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-role-usage-grants.html 0644 root root 5008 41909 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-routine-privileges.html 0644 root root 5030 45839 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-routines.html 0644 root root 23050 34943 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-schema.html 0644 root root 3178 44529 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-schemata.html 0644 root root 4246 47900 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-sequences.html 0644 root root 6109 60560 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-sql-features.html 0644 root root 4706 22139 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-sql-implementation-info.html 0644 root root 4501 11723 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-sql-languages.html 0644 root root 5092 47020 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-sql-packages.html 0644 root root 4176 43129 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-sql-parts.html 0644 root root 4078 34192 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-sql-sizing-profiles.html 0644 root root 4175 47302 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-sql-sizing.html 0644 root root 4099 43401 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-table-constraints.html 0644 root root 4912 33315 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-table-privileges.html 0644 root root 5095 41865 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-tables.html 0644 root root 5955 46037 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-triggered-update-columns.html 0644 root root 4552 10443 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-triggers.html 0644 root root 9445 58764 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-udt-privileges.html 0644 root root 4509 4659 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-usage-privileges.html 0644 root root 5510 16156 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-user-defined-types.html 0644 root root 9751 12358 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-user-mapping-options.html 0644 root root 4447 6842 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-user-mappings.html 0644 root root 3831 23756 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-view-column-usage.html 0644 root root 4726 22243 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-view-routine-usage.html 0644 root root 4366 61771 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-view-table-usage.html 0644 root root 4387 58862 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-views.html 0644 root root 5527 3259 1347419305 1 f none /usr/local/share/doc/postgresql/html/install-getsource.html 0644 root root 3473 64928 1347419305 1 f none /usr/local/share/doc/postgresql/html/install-post.html 0644 root root 8068 20979 1347419305 1 f none /usr/local/share/doc/postgresql/html/install-procedure.html 0644 root root 45024 63785 1347419305 1 f none /usr/local/share/doc/postgresql/html/install-requirements.html 0644 root root 14392 39522 1347419305 1 f none /usr/local/share/doc/postgresql/html/install-short.html 0644 root root 2868 18122 1347419305 1 f none /usr/local/share/doc/postgresql/html/install-windows-full.html 0644 root root 18981 34755 1347419305 1 f none /usr/local/share/doc/postgresql/html/install-windows-libpq.html 0644 root root 6281 13266 1347419305 1 f none /usr/local/share/doc/postgresql/html/install-windows.html 0644 root root 6620 46278 1347419305 1 f none /usr/local/share/doc/postgresql/html/installation-platform-notes.html 0644 root root 39366 53400 1347419305 1 f none /usr/local/share/doc/postgresql/html/installation.html 0644 root root 4158 46609 1347419305 1 f none /usr/local/share/doc/postgresql/html/intagg.html 0644 root root 6252 22527 1347419305 1 f none /usr/local/share/doc/postgresql/html/intarray.html 0644 root root 13751 34439 1347419305 1 f none /usr/local/share/doc/postgresql/html/internals.html 0644 root root 15544 34175 1347419305 1 f none /usr/local/share/doc/postgresql/html/intro-whatis.html 0644 root root 4009 32997 1347419305 1 f none /usr/local/share/doc/postgresql/html/isn.html 0644 root root 13354 22377 1347419305 1 f none /usr/local/share/doc/postgresql/html/kernel-resources.html 0644 root root 37936 61251 1347419305 1 f none /usr/local/share/doc/postgresql/html/largeobjects.html 0644 root root 4673 22851 1347419305 1 f none /usr/local/share/doc/postgresql/html/libpq-async.html 0644 root root 20513 50045 1347419305 1 f none /usr/local/share/doc/postgresql/html/libpq-build.html 0644 root root 6367 22860 1347419305 1 f none /usr/local/share/doc/postgresql/html/libpq-cancel.html 0644 root root 6775 44727 1347419305 1 f none /usr/local/share/doc/postgresql/html/libpq-connect.html 0644 root root 51022 1143 1347419305 1 f none /usr/local/share/doc/postgresql/html/libpq-control.html 0644 root root 6278 8328 1347419305 1 f none /usr/local/share/doc/postgresql/html/libpq-copy.html 0644 root root 22440 60308 1347419305 1 f none /usr/local/share/doc/postgresql/html/libpq-envars.html 0644 root root 10176 25815 1347419305 1 f none /usr/local/share/doc/postgresql/html/libpq-events.html 0644 root root 23091 39346 1347419305 1 f none /usr/local/share/doc/postgresql/html/libpq-example.html 0644 root root 16022 59905 1347419305 1 f none /usr/local/share/doc/postgresql/html/libpq-exec.html 0644 root root 64802 23972 1347419305 1 f none /usr/local/share/doc/postgresql/html/libpq-fastpath.html 0644 root root 5654 39060 1347419305 1 f none /usr/local/share/doc/postgresql/html/libpq-ldap.html 0644 root root 5504 28999 1347419305 1 f none /usr/local/share/doc/postgresql/html/libpq-misc.html 0644 root root 13813 3094 1347419305 1 f none /usr/local/share/doc/postgresql/html/libpq-notice-processing.html 0644 root root 6282 36285 1347419305 1 f none /usr/local/share/doc/postgresql/html/libpq-notify.html 0644 root root 6713 54290 1347419305 1 f none /usr/local/share/doc/postgresql/html/libpq-pgpass.html 0644 root root 4859 42499 1347419305 1 f none /usr/local/share/doc/postgresql/html/libpq-pgservice.html 0644 root root 3882 31953 1347419305 1 f none /usr/local/share/doc/postgresql/html/libpq-single-row-mode.html 0644 root root 6351 28724 1347419305 1 f none /usr/local/share/doc/postgresql/html/libpq-ssl.html 0644 root root 19969 48565 1347419305 1 f none /usr/local/share/doc/postgresql/html/libpq-status.html 0644 root root 17693 21816 1347419305 1 f none /usr/local/share/doc/postgresql/html/libpq-threading.html 0644 root root 5542 27026 1347419305 1 f none /usr/local/share/doc/postgresql/html/libpq.html 0644 root root 7916 4769 1347419305 1 f none /usr/local/share/doc/postgresql/html/lo-examplesect.html 0644 root root 8694 29565 1347419305 1 f none /usr/local/share/doc/postgresql/html/lo-funcs.html 0644 root root 4219 57571 1347419305 1 f none /usr/local/share/doc/postgresql/html/lo-implementation.html 0644 root root 3351 52804 1347419305 1 f none /usr/local/share/doc/postgresql/html/lo-interfaces.html 0644 root root 15153 27811 1347419305 1 f none /usr/local/share/doc/postgresql/html/lo-intro.html 0644 root root 3204 41975 1347419305 1 f none /usr/local/share/doc/postgresql/html/lo.html 0644 root root 6625 45931 1347419305 1 f none /usr/local/share/doc/postgresql/html/locale.html 0644 root root 13689 24185 1347419305 1 f none /usr/local/share/doc/postgresql/html/locking-indexes.html 0644 root root 4495 17132 1347419305 1 f none /usr/local/share/doc/postgresql/html/log-shipping-alternative.html 0644 root root 11055 39202 1347419305 1 f none /usr/local/share/doc/postgresql/html/logfile-maintenance.html 0644 root root 7144 36285 1347419305 1 f none /usr/local/share/doc/postgresql/html/ltree.html 0644 root root 27293 8462 1347419305 1 f none /usr/local/share/doc/postgresql/html/maintenance.html 0644 root root 5539 35988 1347419305 1 f none /usr/local/share/doc/postgresql/html/manage-ag-config.html 0644 root root 3744 20458 1347419305 1 f none /usr/local/share/doc/postgresql/html/manage-ag-createdb.html 0644 root root 6308 22091 1347419305 1 f none /usr/local/share/doc/postgresql/html/manage-ag-dropdb.html 0644 root root 3603 5981 1347419305 1 f none /usr/local/share/doc/postgresql/html/manage-ag-overview.html 0644 root root 5142 4927 1347419305 1 f none /usr/local/share/doc/postgresql/html/manage-ag-tablespaces.html 0644 root root 9156 14126 1347419305 1 f none /usr/local/share/doc/postgresql/html/manage-ag-templatedbs.html 0644 root root 8160 44006 1347419305 1 f none /usr/local/share/doc/postgresql/html/managing-databases.html 0644 root root 3271 44618 1347419305 1 f none /usr/local/share/doc/postgresql/html/monitoring-locks.html 0644 root root 3671 14216 1347419305 1 f none /usr/local/share/doc/postgresql/html/monitoring-ps.html 0644 root root 6780 61275 1347419305 1 f none /usr/local/share/doc/postgresql/html/monitoring-stats.html 0644 root root 58061 37060 1347419305 1 f none /usr/local/share/doc/postgresql/html/monitoring.html 0644 root root 4456 6630 1347419305 1 f none /usr/local/share/doc/postgresql/html/multibyte.html 0644 root root 32225 45488 1347419305 1 f none /usr/local/share/doc/postgresql/html/mvcc-intro.html 0644 root root 4550 26454 1347419305 1 f none /usr/local/share/doc/postgresql/html/mvcc.html 0644 root root 4242 55528 1347419305 1 f none /usr/local/share/doc/postgresql/html/nls-programmer.html 0644 root root 10076 47254 1347419305 1 f none /usr/local/share/doc/postgresql/html/nls-translator.html 0644 root root 14528 41982 1347419305 1 f none /usr/local/share/doc/postgresql/html/nls.html 0644 root root 3132 30388 1347419305 1 f none /usr/local/share/doc/postgresql/html/non-durability.html 0644 root root 4483 12023 1347419305 1 f none /usr/local/share/doc/postgresql/html/notation.html 0644 root root 4413 8982 1347419305 1 f none /usr/local/share/doc/postgresql/html/oid2name.html 0644 root root 11960 8478 1347419305 1 f none /usr/local/share/doc/postgresql/html/overview.html 0644 root root 4091 44521 1347419305 1 f none /usr/local/share/doc/postgresql/html/pageinspect.html 0644 root root 8046 59655 1347419305 1 f none /usr/local/share/doc/postgresql/html/parser-stage.html 0644 root root 8115 31206 1347419305 1 f none /usr/local/share/doc/postgresql/html/passwordcheck.html 0644 root root 4786 42384 1347419305 1 f none /usr/local/share/doc/postgresql/html/performance-tips.html 0644 root root 4499 64617 1347419305 1 f none /usr/local/share/doc/postgresql/html/perm-functions.html 0644 root root 3348 59492 1347419305 1 f none /usr/local/share/doc/postgresql/html/pgarchivecleanup.html 0644 root root 9153 32166 1347419305 1 f none /usr/local/share/doc/postgresql/html/pgbench.html 0644 root root 30830 20817 1347419305 1 f none /usr/local/share/doc/postgresql/html/pgbuffercache.html 0644 root root 7633 34911 1347419305 1 f none /usr/local/share/doc/postgresql/html/pgcrypto.html 0644 root root 38487 31742 1347419305 1 f none /usr/local/share/doc/postgresql/html/pgfreespacemap.html 0644 root root 5228 53380 1347419305 1 f none /usr/local/share/doc/postgresql/html/pgrowlocks.html 0644 root root 6076 49410 1347419305 1 f none /usr/local/share/doc/postgresql/html/pgstandby.html 0644 root root 15202 38310 1347419305 1 f none /usr/local/share/doc/postgresql/html/pgstatstatements.html 0644 root root 16066 48547 1347419305 1 f none /usr/local/share/doc/postgresql/html/pgstattuple.html 0644 root root 8654 40398 1347419305 1 f none /usr/local/share/doc/postgresql/html/pgtestfsync.html 0644 root root 5252 54958 1347419305 1 f none /usr/local/share/doc/postgresql/html/pgtesttiming.html 0644 root root 12474 62936 1347419305 1 f none /usr/local/share/doc/postgresql/html/pgtrgm.html 0644 root root 12331 22245 1347419305 1 f none /usr/local/share/doc/postgresql/html/pgupgrade.html 0644 root root 24293 33768 1347419305 1 f none /usr/local/share/doc/postgresql/html/planner-optimizer.html 0644 root root 9394 33298 1347419305 1 f none /usr/local/share/doc/postgresql/html/planner-stats-details.html 0644 root root 3024 31396 1347419305 1 f none /usr/local/share/doc/postgresql/html/planner-stats.html 0644 root root 9056 20122 1347419305 1 f none /usr/local/share/doc/postgresql/html/plhandler.html 0644 root root 12836 50845 1347419305 1 f none /usr/local/share/doc/postgresql/html/plperl-builtins.html 0644 root root 18274 40619 1347419305 1 f none /usr/local/share/doc/postgresql/html/plperl-data.html 0644 root root 2876 15594 1347419305 1 f none /usr/local/share/doc/postgresql/html/plperl-funcs.html 0644 root root 13367 58177 1347419305 1 f none /usr/local/share/doc/postgresql/html/plperl-global.html 0644 root root 5065 56645 1347419305 1 f none /usr/local/share/doc/postgresql/html/plperl-triggers.html 0644 root root 6444 64627 1347419305 1 f none /usr/local/share/doc/postgresql/html/plperl-trusted.html 0644 root root 6710 62670 1347419305 1 f none /usr/local/share/doc/postgresql/html/plperl-under-the-hood.html 0644 root root 8989 39328 1347419305 1 f none /usr/local/share/doc/postgresql/html/plperl.html 0644 root root 4928 43554 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpgsql-control-structures.html 0644 root root 46184 30959 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpgsql-cursors.html 0644 root root 25584 59790 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpgsql-declarations.html 0644 root root 21731 29608 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpgsql-development-tips.html 0644 root root 9509 7499 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpgsql-errors-and-messages.html 0644 root root 10092 23678 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpgsql-expressions.html 0644 root root 4660 18503 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpgsql-implementation.html 0644 root root 18041 49004 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpgsql-overview.html 0644 root root 9030 33993 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpgsql-porting.html 0644 root root 27092 22236 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpgsql-statements.html 0644 root root 32219 23055 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpgsql-structure.html 0644 root root 7372 31104 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpgsql-trigger.html 0644 root root 22320 60092 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpgsql.html 0644 root root 6963 61431 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpython-data.html 0644 root root 14646 63134 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpython-database.html 0644 root root 15347 4877 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpython-do.html 0644 root root 2769 6934 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpython-envar.html 0644 root root 3883 24959 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpython-funcs.html 0644 root root 5476 24342 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpython-python23.html 0644 root root 7205 40471 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpython-sharing.html 0644 root root 3030 26970 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpython-subtransaction.html 0644 root root 7886 32353 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpython-trigger.html 0644 root root 5067 30321 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpython-util.html 0644 root root 5102 54240 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpython.html 0644 root root 6065 2245 1347419305 1 f none /usr/local/share/doc/postgresql/html/pltcl-data.html 0644 root root 2904 16638 1347419305 1 f none /usr/local/share/doc/postgresql/html/pltcl-dbaccess.html 0644 root root 13579 18915 1347419305 1 f none /usr/local/share/doc/postgresql/html/pltcl-functions.html 0644 root root 6175 4328 1347419305 1 f none /usr/local/share/doc/postgresql/html/pltcl-global.html 0644 root root 5064 63960 1347419305 1 f none /usr/local/share/doc/postgresql/html/pltcl-overview.html 0644 root root 5284 12177 1347419305 1 f none /usr/local/share/doc/postgresql/html/pltcl-procnames.html 0644 root root 3220 43397 1347419305 1 f none /usr/local/share/doc/postgresql/html/pltcl-trigger.html 0644 root root 8738 50578 1347419305 1 f none /usr/local/share/doc/postgresql/html/pltcl-unknown.html 0644 root root 5073 57673 1347419305 1 f none /usr/local/share/doc/postgresql/html/pltcl.html 0644 root root 3398 52290 1347419305 1 f none /usr/local/share/doc/postgresql/html/populate.html 0644 root root 17112 23059 1347419305 1 f none /usr/local/share/doc/postgresql/html/postgres-user.html 0644 root root 3312 52082 1347419305 1 f none /usr/local/share/doc/postgresql/html/preface.html 0644 root root 5065 53060 1347419305 1 f none /usr/local/share/doc/postgresql/html/preventing-server-spoofing.html 0644 root root 4598 32846 1347419305 1 f none /usr/local/share/doc/postgresql/html/protocol-changes.html 0644 root root 6648 20146 1347419305 1 f none /usr/local/share/doc/postgresql/html/protocol-error-fields.html 0644 root root 6129 5619 1347419305 1 f none /usr/local/share/doc/postgresql/html/protocol-flow.html 0644 root root 46200 36869 1347419305 1 f none /usr/local/share/doc/postgresql/html/protocol-message-formats.html 0644 root root 40842 51631 1347419305 1 f none /usr/local/share/doc/postgresql/html/protocol-message-types.html 0644 root root 4931 25761 1347419305 1 f none /usr/local/share/doc/postgresql/html/protocol-overview.html 0644 root root 9668 9077 1347419305 1 f none /usr/local/share/doc/postgresql/html/protocol-replication.html 0644 root root 14262 22077 1347419305 1 f none /usr/local/share/doc/postgresql/html/protocol.html 0644 root root 5650 38271 1347419305 1 f none /usr/local/share/doc/postgresql/html/queries-limit.html 0644 root root 5333 2072 1347419305 1 f none /usr/local/share/doc/postgresql/html/queries-order.html 0644 root root 7367 26762 1347419305 1 f none /usr/local/share/doc/postgresql/html/queries-overview.html 0644 root root 5066 56278 1347419305 1 f none /usr/local/share/doc/postgresql/html/queries-select-lists.html 0644 root root 9216 53254 1347419305 1 f none /usr/local/share/doc/postgresql/html/queries-table-expressions.html 0644 root root 36620 34313 1347419305 1 f none /usr/local/share/doc/postgresql/html/queries-union.html 0644 root root 5112 45989 1347419305 1 f none /usr/local/share/doc/postgresql/html/queries-values.html 0644 root root 4928 36021 1347419305 1 f none /usr/local/share/doc/postgresql/html/queries-with.html 0644 root root 20819 39895 1347419305 1 f none /usr/local/share/doc/postgresql/html/queries.html 0644 root root 4347 52593 1347419305 1 f none /usr/local/share/doc/postgresql/html/query-path.html 0644 root root 5468 20161 1347419305 1 f none /usr/local/share/doc/postgresql/html/querytree.html 0644 root root 11134 4033 1347419305 1 f none /usr/local/share/doc/postgresql/html/rangetypes.html 0644 root root 22687 25382 1347419305 1 f none /usr/local/share/doc/postgresql/html/recovery-config.html 0644 root root 3548 1950 1347419305 1 f none /usr/local/share/doc/postgresql/html/recovery-target-settings.html 0644 root root 7760 7853 1347419305 1 f none /usr/local/share/doc/postgresql/html/reference-client.html 0644 root root 6100 1481 1347419305 1 f none /usr/local/share/doc/postgresql/html/reference-server.html 0644 root root 3962 30986 1347419305 1 f none /usr/local/share/doc/postgresql/html/reference.html 0644 root root 23160 2318 1347419305 1 f none /usr/local/share/doc/postgresql/html/regress-coverage.html 0644 root root 3323 52205 1347419305 1 f none /usr/local/share/doc/postgresql/html/regress-evaluation.html 0644 root root 11604 11110 1347419305 1 f none /usr/local/share/doc/postgresql/html/regress-run.html 0644 root root 12226 188 1347419305 1 f none /usr/local/share/doc/postgresql/html/regress-variant.html 0644 root root 7175 41158 1347419305 1 f none /usr/local/share/doc/postgresql/html/regress.html 0644 root root 4100 38612 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-0-01.html 0644 root root 2587 51644 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-0-02.html 0644 root root 4323 61994 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-0-03.html 0644 root root 7830 33307 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-1-0.html 0644 root root 4261 60988 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-1-01.html 0644 root root 9378 20962 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-1-02.html 0644 root root 6521 40750 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-1-09.html 0644 root root 2557 48014 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-6-0.html 0644 root root 7952 2794 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-6-1-1.html 0644 root root 3751 21175 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-6-1.html 0644 root root 9059 27582 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-6-2-1.html 0644 root root 4437 7259 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-6-2.html 0644 root root 8915 5084 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-6-3-1.html 0644 root root 4476 14574 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-6-3-2.html 0644 root root 4189 54647 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-6-3.html 0644 root root 16344 40850 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-6-4-1.html 0644 root root 4093 46925 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-6-4-2.html 0644 root root 2940 8890 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-6-4.html 0644 root root 14765 5239 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-6-5-1.html 0644 root root 3874 25241 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-6-5-2.html 0644 root root 4134 48685 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-6-5-3.html 0644 root root 3085 18900 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-6-5.html 0644 root root 17419 56598 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-0-1.html 0644 root root 3952 31008 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-0-2.html 0644 root root 2919 5086 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-0-3.html 0644 root root 4688 30216 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-0.html 0644 root root 23136 25041 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-1-1.html 0644 root root 3294 37433 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-1-2.html 0644 root root 3007 13119 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-1-3.html 0644 root root 3171 27581 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-1.html 0644 root root 13049 27112 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-2-1.html 0644 root root 4043 31682 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-2-2.html 0644 root root 3825 11351 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-2-3.html 0644 root root 3396 44903 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-2-4.html 0644 root root 3619 64971 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-2-5.html 0644 root root 3778 13693 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-2-6.html 0644 root root 3656 6039 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-2-7.html 0644 root root 3758 13926 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-2-8.html 0644 root root 3980 30556 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-2.html 0644 root root 27130 38107 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-3-1.html 0644 root root 4200 44473 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-3-10.html 0644 root root 7525 63600 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-3-11.html 0644 root root 4122 38225 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-3-12.html 0644 root root 3538 57017 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-3-13.html 0644 root root 4629 18899 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-3-14.html 0644 root root 3942 25854 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-3-15.html 0644 root root 6326 25539 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-3-16.html 0644 root root 3435 47422 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-3-17.html 0644 root root 3561 51809 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-3-18.html 0644 root root 3658 963 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-3-19.html 0644 root root 3697 1312 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-3-2.html 0644 root root 5237 536 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-3-20.html 0644 root root 3535 51596 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-3-21.html 0644 root root 6227 4984 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-3-3.html 0644 root root 10322 3045 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-3-4.html 0644 root root 3534 56477 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-3-5.html 0644 root root 4525 9287 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-3-6.html 0644 root root 4460 9581 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-3-7.html 0644 root root 3384 48231 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-3-8.html 0644 root root 3603 1839 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-3-9.html 0644 root root 4111 44070 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-3.html 0644 root root 33085 20492 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-1.html 0644 root root 7148 19769 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-10.html 0644 root root 3817 14760 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-11.html 0644 root root 4868 38903 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-12.html 0644 root root 4232 48333 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-13.html 0644 root root 6972 12724 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-14.html 0644 root root 3684 739 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-15.html 0644 root root 4281 38908 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-16.html 0644 root root 3983 26575 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-17.html 0644 root root 4024 25423 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-18.html 0644 root root 3938 16700 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-19.html 0644 root root 7253 16511 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-2.html 0644 root root 8292 46338 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-20.html 0644 root root 6616 26933 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-21.html 0644 root root 3933 20065 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-22.html 0644 root root 4082 28479 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-23.html 0644 root root 4434 60084 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-24.html 0644 root root 4300 43570 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-25.html 0644 root root 4517 4669 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-26.html 0644 root root 5466 85 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-27.html 0644 root root 5175 53062 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-28.html 0644 root root 5640 22180 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-29.html 0644 root root 6971 383 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-3.html 0644 root root 4647 16143 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-30.html 0644 root root 6222 14189 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-4.html 0644 root root 4117 40254 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-5.html 0644 root root 3226 33531 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-6.html 0644 root root 4763 28567 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-7.html 0644 root root 4306 60111 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-8.html 0644 root root 10188 16285 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-9.html 0644 root root 5129 52969 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4.html 0644 root root 57409 5729 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-1.html 0644 root root 4776 31681 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-10.html 0644 root root 4762 9634 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-11.html 0644 root root 3980 25763 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-12.html 0644 root root 3145 23832 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-13.html 0644 root root 4129 33438 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-14.html 0644 root root 4529 62735 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-15.html 0644 root root 9112 29063 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-16.html 0644 root root 8957 5122 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-17.html 0644 root root 3931 20001 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-18.html 0644 root root 5590 13313 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-19.html 0644 root root 4987 36425 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-2.html 0644 root root 9598 15885 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-20.html 0644 root root 4323 46637 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-21.html 0644 root root 4515 4462 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-22.html 0644 root root 6451 6542 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-23.html 0644 root root 6034 54441 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-24.html 0644 root root 7013 63923 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-25.html 0644 root root 7438 36790 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-26.html 0644 root root 8037 21518 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-3.html 0644 root root 7457 55820 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-4.html 0644 root root 6691 43668 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-5.html 0644 root root 4827 33150 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-6.html 0644 root root 5705 46499 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-7.html 0644 root root 5920 47699 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-8.html 0644 root root 7236 34033 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-9.html 0644 root root 4317 48486 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0.html 0644 root root 66850 58259 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-1.html 0644 root root 5488 19717 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-10.html 0644 root root 4789 16921 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-11.html 0644 root root 9954 26297 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-12.html 0644 root root 9349 35284 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-13.html 0644 root root 4300 45828 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-14.html 0644 root root 6909 52277 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-15.html 0644 root root 6282 3536 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-16.html 0644 root root 5286 60129 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-17.html 0644 root root 6043 59072 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-18.html 0644 root root 6450 6594 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-19.html 0644 root root 6620 34498 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-2.html 0644 root root 6364 32977 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-20.html 0644 root root 7306 21622 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-21.html 0644 root root 7221 19219 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-22.html 0644 root root 8332 44893 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-23.html 0644 root root 7941 65292 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-3.html 0644 root root 7034 5858 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-4.html 0644 root root 8881 37956 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-5.html 0644 root root 5487 9479 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-6.html 0644 root root 5345 53556 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-7.html 0644 root root 4566 6310 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-8.html 0644 root root 3124 22933 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-9.html 0644 root root 4396 54424 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1.html 0644 root root 62145 26657 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-1.html 0644 root root 5093 34876 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-10.html 0644 root root 8187 19095 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-11.html 0644 root root 7154 3172 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-12.html 0644 root root 6755 41908 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-13.html 0644 root root 7355 26235 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-14.html 0644 root root 7883 51717 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-15.html 0644 root root 8162 25663 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-16.html 0644 root root 9300 43262 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-17.html 0644 root root 8221 29892 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-18.html 0644 root root 10284 892 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-19.html 0644 root root 8596 44938 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-2.html 0644 root root 5830 33832 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-20.html 0644 root root 6251 4157 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-21.html 0644 root root 5600 19524 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-22.html 0644 root root 9624 61231 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-23.html 0644 root root 9566 7862 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-3.html 0644 root root 3123 22178 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-4.html 0644 root root 5456 113 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-5.html 0644 root root 6023 41215 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-6.html 0644 root root 10579 1772 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-7.html 0644 root root 9339 44374 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-8.html 0644 root root 7528 25429 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-9.html 0644 root root 4288 45331 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2.html 0644 root root 69408 31634 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-3-1.html 0644 root root 10613 9735 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-3-10.html 0644 root root 10732 23609 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-3-11.html 0644 root root 8970 23302 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-3-12.html 0644 root root 12126 8914 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-3-13.html 0644 root root 9513 53023 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-3-14.html 0644 root root 6249 4075 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-3-15.html 0644 root root 6388 17750 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-3-16.html 0644 root root 11022 34364 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-3-17.html 0644 root root 10597 20734 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-3-18.html 0644 root root 11272 20494 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-3-19.html 0644 root root 8473 49605 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-3-2.html 0644 root root 12210 52383 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-3-20.html 0644 root root 9240 45065 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-3-3.html 0644 root root 4282 44983 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-3-4.html 0644 root root 11280 61259 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-3-5.html 0644 root root 8696 50558 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-3-6.html 0644 root root 9204 32920 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-3-7.html 0644 root root 9736 18658 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-3-8.html 0644 root root 9267 21877 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-3-9.html 0644 root root 10213 52510 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-3.html 0644 root root 69776 613 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-4-1.html 0644 root root 9607 43986 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-4-10.html 0644 root root 11944 64047 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-4-11.html 0644 root root 13799 30085 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-4-12.html 0644 root root 9999 36083 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-4-13.html 0644 root root 9708 6282 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-4-2.html 0644 root root 15729 4441 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-4-3.html 0644 root root 13940 5763 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-4-4.html 0644 root root 10748 27438 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-4-5.html 0644 root root 15945 39253 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-4-6.html 0644 root root 10442 60671 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-4-7.html 0644 root root 6232 3293 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-4-8.html 0644 root root 8876 15359 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-4-9.html 0644 root root 14540 42424 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-4.html 0644 root root 88008 12741 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-9-0-1.html 0644 root root 5978 57177 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-9-0-2.html 0644 root root 13668 48818 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-9-0-3.html 0644 root root 7288 19259 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-9-0-4.html 0644 root root 11391 12508 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-9-0-5.html 0644 root root 17927 40399 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-9-0-6.html 0644 root root 13438 49292 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-9-0-7.html 0644 root root 18103 41778 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-9-0-8.html 0644 root root 11002 48734 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-9-0-9.html 0644 root root 11734 33904 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-9-0.html 0644 root root 96159 47009 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-9-1-1.html 0644 root root 3698 428 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-9-1-2.html 0644 root root 21602 31917 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-9-1-3.html 0644 root root 21161 6996 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-9-1-4.html 0644 root root 16026 48826 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-9-1-5.html 0644 root root 14038 16693 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-9-1.html 0644 root root 79097 6835 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-9-2.html 0644 root root 79601 61842 1347419305 1 f none /usr/local/share/doc/postgresql/html/release.html 0644 root root 18194 55284 1347419305 1 f none /usr/local/share/doc/postgresql/html/resources.html 0644 root root 4220 54030 1347419305 1 f none /usr/local/share/doc/postgresql/html/role-attributes.html 0644 root root 7860 2927 1347419305 1 f none /usr/local/share/doc/postgresql/html/role-membership.html 0644 root root 8616 8859 1347419305 1 f none /usr/local/share/doc/postgresql/html/routine-reindex.html 0644 root root 3626 18749 1347419305 1 f none /usr/local/share/doc/postgresql/html/routine-vacuuming.html 0644 root root 37670 11511 1347419305 1 f none /usr/local/share/doc/postgresql/html/row-estimation-examples.html 0644 root root 20657 59939 1347419305 1 f none /usr/local/share/doc/postgresql/html/rowtypes.html 0644 root root 14320 27824 1347419305 1 f none /usr/local/share/doc/postgresql/html/rule-system.html 0644 root root 4115 45741 1347419305 1 f none /usr/local/share/doc/postgresql/html/rules-privileges.html 0644 root root 11661 20801 1347419305 1 f none /usr/local/share/doc/postgresql/html/rules-status.html 0644 root root 4510 14587 1347419305 1 f none /usr/local/share/doc/postgresql/html/rules-triggers.html 0644 root root 9474 29156 1347419305 1 f none /usr/local/share/doc/postgresql/html/rules-update.html 0644 root root 32613 44373 1347419305 1 f none /usr/local/share/doc/postgresql/html/rules-views.html 0644 root root 26886 24545 1347419305 1 f none /usr/local/share/doc/postgresql/html/rules.html 0644 root root 4946 44594 1347419305 1 f none /usr/local/share/doc/postgresql/html/runtime-config-autovacuum.html 0644 root root 10972 55471 1347419305 1 f none /usr/local/share/doc/postgresql/html/runtime-config-client.html 0644 root root 32538 1553 1347419305 1 f none /usr/local/share/doc/postgresql/html/runtime-config-compatible.html 0644 root root 14087 10695 1347419305 1 f none /usr/local/share/doc/postgresql/html/runtime-config-connection.html 0644 root root 22109 40418 1347419305 1 f none /usr/local/share/doc/postgresql/html/runtime-config-custom.html 0644 root root 3546 9645 1347419305 1 f none /usr/local/share/doc/postgresql/html/runtime-config-developer.html 0644 root root 14068 9524 1347419305 1 f none /usr/local/share/doc/postgresql/html/runtime-config-error-handling.html 0644 root root 3568 2933 1347419305 1 f none /usr/local/share/doc/postgresql/html/runtime-config-file-locations.html 0644 root root 6965 4101 1347419305 1 f none /usr/local/share/doc/postgresql/html/runtime-config-locks.html 0644 root root 7632 7462 1347419305 1 f none /usr/local/share/doc/postgresql/html/runtime-config-logging.html 0644 root root 45385 54413 1347419305 1 f none /usr/local/share/doc/postgresql/html/runtime-config-preset.html 0644 root root 8708 56077 1347419305 1 f none /usr/local/share/doc/postgresql/html/runtime-config-query.html 0644 root root 24948 22344 1347419305 1 f none /usr/local/share/doc/postgresql/html/runtime-config-replication.html 0644 root root 18292 5594 1347419305 1 f none /usr/local/share/doc/postgresql/html/runtime-config-resource.html 0644 root root 27899 22680 1347419305 1 f none /usr/local/share/doc/postgresql/html/runtime-config-short.html 0644 root root 6679 4191 1347419305 1 f none /usr/local/share/doc/postgresql/html/runtime-config-statistics.html 0644 root root 8614 65351 1347419305 1 f none /usr/local/share/doc/postgresql/html/runtime-config-wal.html 0644 root root 27091 9949 1347419305 1 f none /usr/local/share/doc/postgresql/html/runtime-config.html 0644 root root 8247 34161 1347419305 1 f none /usr/local/share/doc/postgresql/html/runtime.html 0644 root root 4996 39962 1347419305 1 f none /usr/local/share/doc/postgresql/html/seg.html 0644 root root 15468 34859 1347419305 1 f none /usr/local/share/doc/postgresql/html/sepgsql.html 0644 root root 30825 34849 1347419305 1 f none /usr/local/share/doc/postgresql/html/server-programming.html 0644 root root 9616 2053 1347419305 1 f none /usr/local/share/doc/postgresql/html/server-shutdown.html 0644 root root 6467 39377 1347419305 1 f none /usr/local/share/doc/postgresql/html/server-start.html 0644 root root 14189 1159 1347419305 1 f none /usr/local/share/doc/postgresql/html/source-format.html 0644 root root 5131 65212 1347419305 1 f none /usr/local/share/doc/postgresql/html/source.html 0644 root root 4069 35153 1347419305 1 f none /usr/local/share/doc/postgresql/html/sourcerepo.html 0644 root root 3382 57222 1347419305 1 f none /usr/local/share/doc/postgresql/html/spgist-examples.html 0644 root root 2701 194 1347419305 1 f none /usr/local/share/doc/postgresql/html/spgist-extensibility.html 0644 root root 31280 30209 1347419305 1 f none /usr/local/share/doc/postgresql/html/spgist-implementation.html 0644 root root 8096 50414 1347419305 1 f none /usr/local/share/doc/postgresql/html/spgist-intro.html 0644 root root 4321 7328 1347419305 1 f none /usr/local/share/doc/postgresql/html/spgist.html 0644 root root 2964 17057 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-examples.html 0644 root root 6215 49607 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-interface-support.html 0644 root root 3768 25517 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-interface.html 0644 root root 5996 14865 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-memory.html 0644 root root 7087 35196 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-realloc.html 0644 root root 3625 63293 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-connect.html 0644 root root 4050 32314 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-copytuple.html 0644 root root 3451 50690 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-cursor-close.html 0644 root root 3334 46296 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-cursor-fetch.html 0644 root root 4108 32573 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-cursor-find.html 0644 root root 3462 55871 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-cursor-move.html 0644 root root 3888 18856 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-cursor-open-with-args.html 0644 root root 6176 57572 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-cursor-open-with-paramlist.html 0644 root root 5033 43677 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-cursor-open.html 0644 root root 5730 30345 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-exec.html 0644 root root 3548 55542 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-execp.html 0644 root root 4823 20623 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-execute-plan-with-paramlist.html 0644 root root 4850 24289 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-execute-plan.html 0644 root root 5858 29270 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-execute-with-args.html 0644 root root 6178 56255 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-execute.html 0644 root root 12172 43426 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-finish.html 0644 root root 3653 3806 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-fname.html 0644 root root 3765 8727 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-fnumber.html 0644 root root 3934 23517 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-freeplan.html 0644 root root 3503 53705 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-freetuple.html 0644 root root 3275 40622 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-freetupletable.html 0644 root root 3626 2540 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-getargcount.html 0644 root root 3696 4183 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-getargtypeid.html 0644 root root 4139 36765 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-getbinval.html 0644 root root 4285 46025 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-getnspname.html 0644 root root 3465 54323 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-getrelname.html 0644 root root 3349 44366 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-gettype.html 0644 root root 3712 4601 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-gettypeid.html 0644 root root 3716 3149 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-getvalue.html 0644 root root 4164 36889 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-is-cursor-plan.html 0644 root root 4558 4231 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-keepplan.html 0644 root root 3882 19275 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-modifytuple.html 0644 root root 5629 7378 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-palloc.html 0644 root root 3155 27314 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-pfree.html 0644 root root 3273 37308 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-pop.html 0644 root root 2741 64108 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-prepare-cursor.html 0644 root root 5053 34838 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-prepare-params.html 0644 root root 4410 57827 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-prepare.html 0644 root root 7659 61366 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-push.html 0644 root root 3735 14192 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-returntuple.html 0644 root root 4095 35687 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-saveplan.html 0644 root root 4574 6903 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-scroll-cursor-fetch.html 0644 root root 4807 15886 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-scroll-cursor-move.html 0644 root root 4897 23019 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-visibility.html 0644 root root 4150 50098 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi.html 0644 root root 10841 25901 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-abort.html 0644 root root 4175 35015 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-alteraggregate.html 0644 root root 6109 45094 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-altercollation.html 0644 root root 5082 32720 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-alterconversion.html 0644 root root 5168 41251 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-alterdatabase.html 0644 root root 8776 58357 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-alterdefaultprivileges.html 0644 root root 9453 33643 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-alterdomain.html 0644 root root 11111 17312 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-alterextension.html 0644 root root 11743 54685 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-alterforeigndatawrapper.html 0644 root root 7376 7604 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-alterforeigntable.html 0644 root root 12705 61003 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-alterfunction.html 0644 root root 12778 9336 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-altergroup.html 0644 root root 5237 47553 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-alterindex.html 0644 root root 7647 23806 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-alterlanguage.html 0644 root root 4020 18788 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-alterlargeobject.html 0644 root root 3728 64999 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-alteropclass.html 0644 root root 5112 37000 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-alteroperator.html 0644 root root 5433 61164 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-alteropfamily.html 0644 root root 13562 30490 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-alterrole.html 0644 root root 13026 49987 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-alterschema.html 0644 root root 4312 41915 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-altersequence.html 0644 root root 13029 27214 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-alterserver.html 0644 root root 5926 28351 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-altertable.html 0644 root root 42806 52233 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-altertablespace.html 0644 root root 5864 27956 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-altertrigger.html 0644 root root 4645 1555 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-altertsconfig.html 0644 root root 8124 62109 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-altertsdictionary.html 0644 root root 6510 16092 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-altertsparser.html 0644 root root 4255 37715 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-altertstemplate.html 0644 root root 4221 35094 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-altertype.html 0644 root root 11191 27629 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-alteruser.html 0644 root root 4438 45841 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-alterusermapping.html 0644 root root 5720 15089 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-alterview.html 0644 root root 6966 35081 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-analyze.html 0644 root root 10672 49339 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-begin.html 0644 root root 6693 39832 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-checkpoint.html 0644 root root 3756 11075 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-close.html 0644 root root 4982 30530 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-cluster.html 0644 root root 9402 593 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-commands.html 0644 root root 18808 55687 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-comment.html 0644 root root 13797 32566 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-commit-prepared.html 0644 root root 4514 273 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-commit.html 0644 root root 3990 20489 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-copy.html 0644 root root 37443 11367 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createaggregate.html 0644 root root 13827 13816 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createcast.html 0644 root root 19630 46801 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createcollation.html 0644 root root 6737 31192 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createconversion.html 0644 root root 6536 16737 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createdatabase.html 0644 root root 12383 13042 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createdomain.html 0644 root root 8542 42518 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createextension.html 0644 root root 8823 9327 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createforeigndatawrapper.html 0644 root root 8057 10911 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createforeigntable.html 0644 root root 7716 38858 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createfunction.html 0644 root root 30952 17301 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-creategroup.html 0644 root root 4010 13119 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createindex.html 0644 root root 25738 52890 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createlanguage.html 0644 root root 14886 37135 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createopclass.html 0644 root root 12674 34466 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createoperator.html 0644 root root 10686 2015 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createopfamily.html 0644 root root 5624 27814 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createrole.html 0644 root root 19508 12286 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createrule.html 0644 root root 12654 25019 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createschema.html 0644 root root 8159 18288 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createsequence.html 0644 root root 14070 3745 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createserver.html 0644 root root 6249 58577 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createtable.html 0644 root root 58375 24680 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createtableas.html 0644 root root 12770 14235 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createtablespace.html 0644 root root 6102 47594 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createtrigger.html 0644 root root 23173 43336 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createtsconfig.html 0644 root root 5350 65388 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createtsdictionary.html 0644 root root 5531 11145 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createtsparser.html 0644 root root 5945 43537 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createtstemplate.html 0644 root root 5435 10386 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createtype.html 0644 root root 39458 38119 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createuser.html 0644 root root 4522 51543 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createusermapping.html 0644 root root 5501 4479 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createview.html 0644 root root 10305 53050 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-deallocate.html 0644 root root 3783 3960 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-declare.html 0644 root root 15398 60627 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-delete.html 0644 root root 11792 15900 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-discard.html 0644 root root 4307 45870 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-do.html 0644 root root 5202 48974 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-drop-owned.html 0644 root root 4798 20348 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-dropaggregate.html 0644 root root 4559 59826 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-dropcast.html 0644 root root 4342 42855 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-dropcollation.html 0644 root root 4407 48169 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-dropconversion.html 0644 root root 4435 51890 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-dropdatabase.html 0644 root root 4342 48314 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-dropdomain.html 0644 root root 4255 36186 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-dropextension.html 0644 root root 4783 14378 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-dropforeigndatawrapper.html 0644 root root 4524 57528 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-dropforeigntable.html 0644 root root 4558 61588 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-dropfunction.html 0644 root root 5836 24799 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-dropgroup.html 0644 root root 3045 15469 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-dropindex.html 0644 root root 5255 52569 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-droplanguage.html 0644 root root 4839 15570 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-dropopclass.html 0644 root root 5676 17956 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-dropoperator.html 0644 root root 5220 41797 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-dropopfamily.html 0644 root root 5277 53921 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-droprole.html 0644 root root 5064 41173 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-droprule.html 0644 root root 4149 25961 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-dropschema.html 0644 root root 4527 59300 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-dropsequence.html 0644 root root 4365 45496 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-dropserver.html 0644 root root 4263 36348 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-droptable.html 0644 root root 5026 34551 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-droptablespace.html 0644 root root 4583 203 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-droptrigger.html 0644 root root 4709 5467 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-droptsconfig.html 0644 root root 4770 14824 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-droptsdictionary.html 0644 root root 4687 7501 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-droptsparser.html 0644 root root 4593 65445 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-droptstemplate.html 0644 root root 4565 63010 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-droptype.html 0644 root root 4461 53790 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-dropuser.html 0644 root root 3164 25310 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-dropusermapping.html 0644 root root 4677 2505 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-dropview.html 0644 root root 4260 37957 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-end.html 0644 root root 4155 32990 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-execute.html 0644 root root 5071 42620 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-explain.html 0644 root root 17092 20392 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-expressions.html 0644 root root 45028 16684 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-fetch.html 0644 root root 14249 30491 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-grant.html 0644 root root 28864 42335 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-insert.html 0644 root root 12858 29330 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-keywords-appendix.html 0644 root root 106531 8660 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-listen.html 0644 root root 5901 44835 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-load.html 0644 root root 4205 46333 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-lock.html 0644 root root 11689 28605 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-move.html 0644 root root 4982 20769 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-notify.html 0644 root root 10946 21048 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-prepare-transaction.html 0644 root root 8599 3617 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-prepare.html 0644 root root 9179 55879 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-reassign-owned.html 0644 root root 5240 52956 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-reindex.html 0644 root root 11098 63798 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-release-savepoint.html 0644 root root 5003 37567 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-reset.html 0644 root root 4991 36825 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-revoke.html 0644 root root 14877 51654 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-rollback-prepared.html 0644 root root 4625 8579 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-rollback-to.html 0644 root root 6399 14505 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-rollback.html 0644 root root 3994 19367 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-savepoint.html 0644 root root 5603 18892 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-security-label.html 0644 root root 8877 57783 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-select.html 0644 root root 78892 29071 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-selectinto.html 0644 root root 7632 16069 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-set-constraints.html 0644 root root 7066 9502 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-set-role.html 0644 root root 6913 58164 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-set-session-authorization.html 0644 root root 6060 58988 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-set-transaction.html 0644 root root 12694 51704 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-set.html 0644 root root 12055 30128 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-show.html 0644 root root 6849 31804 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-start-transaction.html 0644 root root 4981 34758 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-syntax-calling-funcs.html 0644 root root 7802 11227 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-syntax-lexical.html 0644 root root 43368 15565 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-syntax.html 0644 root root 5428 13261 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-truncate.html 0644 root root 9996 42434 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-unlisten.html 0644 root root 4921 24680 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-update.html 0644 root root 15483 52503 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-vacuum.html 0644 root root 11932 63998 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-values.html 0644 root root 10638 53825 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql.html 0644 root root 13425 38646 1347419305 1 f none /usr/local/share/doc/postgresql/html/ssh-tunnels.html 0644 root root 6261 26784 1347419305 1 f none /usr/local/share/doc/postgresql/html/ssl-tcp.html 0644 root root 13475 18397 1347419305 1 f none /usr/local/share/doc/postgresql/html/sslinfo.html 0644 root root 7592 90 1347419305 1 f none /usr/local/share/doc/postgresql/html/standby-settings.html 0644 root root 5425 10388 1347419305 1 f none /usr/local/share/doc/postgresql/html/storage-file-layout.html 0644 root root 12899 40984 1347419305 1 f none /usr/local/share/doc/postgresql/html/storage-fsm.html 0644 root root 3819 28976 1347419305 1 f none /usr/local/share/doc/postgresql/html/storage-init.html 0644 root root 2758 8936 1347419305 1 f none /usr/local/share/doc/postgresql/html/storage-page-layout.html 0644 root root 13889 48106 1347419305 1 f none /usr/local/share/doc/postgresql/html/storage-toast.html 0644 root root 11476 14635 1347419305 1 f none /usr/local/share/doc/postgresql/html/storage-vm.html 0644 root root 3538 10557 1347419305 1 f none /usr/local/share/doc/postgresql/html/storage.html 0644 root root 2950 17901 1347419305 1 f none /usr/local/share/doc/postgresql/html/stylesheet.css 0644 root root 1538 52916 1347419305 1 f none /usr/local/share/doc/postgresql/html/supported-platforms.html 0644 root root 5039 2500 1347419305 1 f none /usr/local/share/doc/postgresql/html/tablefunc.html 0644 root root 32191 53466 1347419305 1 f none /usr/local/share/doc/postgresql/html/tcn.html 0644 root root 4972 51087 1347419305 1 f none /usr/local/share/doc/postgresql/html/test-parser.html 0644 root root 4528 3833 1347419305 1 f none /usr/local/share/doc/postgresql/html/textsearch-configuration.html 0644 root root 6255 22329 1347419305 1 f none /usr/local/share/doc/postgresql/html/textsearch-controls.html 0644 root root 26963 34711 1347419305 1 f none /usr/local/share/doc/postgresql/html/textsearch-debugging.html 0644 root root 17225 21468 1347419305 1 f none /usr/local/share/doc/postgresql/html/textsearch-dictionaries.html 0644 root root 31265 48482 1347419305 1 f none /usr/local/share/doc/postgresql/html/textsearch-features.html 0644 root root 21308 49075 1347419305 1 f none /usr/local/share/doc/postgresql/html/textsearch-indexes.html 0644 root root 7385 51309 1347419305 1 f none /usr/local/share/doc/postgresql/html/textsearch-intro.html 0644 root root 18451 30569 1347419305 1 f none /usr/local/share/doc/postgresql/html/textsearch-limitations.html 0644 root root 3857 23462 1347419305 1 f none /usr/local/share/doc/postgresql/html/textsearch-migration.html 0644 root root 5032 57480 1347419305 1 f none /usr/local/share/doc/postgresql/html/textsearch-parsers.html 0644 root root 9208 25293 1347419305 1 f none /usr/local/share/doc/postgresql/html/textsearch-psql.html 0644 root root 9343 43987 1347419305 1 f none /usr/local/share/doc/postgresql/html/textsearch-tables.html 0644 root root 9748 47182 1347419305 1 f none /usr/local/share/doc/postgresql/html/textsearch.html 0644 root root 5876 43941 1347419305 1 f none /usr/local/share/doc/postgresql/html/transaction-iso.html 0644 root root 26729 4486 1347419305 1 f none /usr/local/share/doc/postgresql/html/trigger-datachanges.html 0644 root root 5070 58495 1347419305 1 f none /usr/local/share/doc/postgresql/html/trigger-definition.html 0644 root root 15505 48285 1347419305 1 f none /usr/local/share/doc/postgresql/html/trigger-example.html 0644 root root 7747 40969 1347419305 1 f none /usr/local/share/doc/postgresql/html/trigger-interface.html 0644 root root 10717 3827 1347419305 1 f none /usr/local/share/doc/postgresql/html/triggers.html 0644 root root 3796 25110 1347419305 1 f none /usr/local/share/doc/postgresql/html/tsearch2.html 0644 root root 9948 55577 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-accessdb.html 0644 root root 7023 57950 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-advanced-intro.html 0644 root root 3339 52498 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-advanced.html 0644 root root 2854 10995 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-agg.html 0644 root root 7592 44928 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-arch.html 0644 root root 4850 47198 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-concepts.html 0644 root root 3837 24614 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-conclusion.html 0644 root root 2846 12072 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-createdb.html 0644 root root 9198 65487 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-delete.html 0644 root root 3515 56740 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-fk.html 0644 root root 4420 4627 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-inheritance.html 0644 root root 6135 61093 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-install.html 0644 root root 4520 24421 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-join.html 0644 root root 9683 9202 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-populate.html 0644 root root 4837 37213 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-select.html 0644 root root 8031 52292 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-sql-intro.html 0644 root root 4902 33168 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-sql.html 0644 root root 3058 25615 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-start.html 0644 root root 2627 58222 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-table.html 0644 root root 5702 30762 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-transactions.html 0644 root root 9946 13892 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-update.html 0644 root root 3157 26920 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-views.html 0644 root root 3373 56776 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-window.html 0644 root root 12479 23583 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial.html 0644 root root 5207 64909 1347419305 1 f none /usr/local/share/doc/postgresql/html/typeconv-func.html 0644 root root 11995 55805 1347419305 1 f none /usr/local/share/doc/postgresql/html/typeconv-oper.html 0644 root root 12013 55871 1347419305 1 f none /usr/local/share/doc/postgresql/html/typeconv-overview.html 0644 root root 8288 14912 1347419305 1 f none /usr/local/share/doc/postgresql/html/typeconv-query.html 0644 root root 5448 29685 1347419305 1 f none /usr/local/share/doc/postgresql/html/typeconv-union-case.html 0644 root root 5785 37862 1347419305 1 f none /usr/local/share/doc/postgresql/html/typeconv.html 0644 root root 3719 18586 1347419305 1 f none /usr/local/share/doc/postgresql/html/unaccent.html 0644 root root 6740 43397 1347419305 1 f none /usr/local/share/doc/postgresql/html/unsupported-features-sql-standard.html 0644 root root 35113 18896 1347419305 1 f none /usr/local/share/doc/postgresql/html/upgrading.html 0644 root root 12792 25885 1347419305 1 f none /usr/local/share/doc/postgresql/html/user-manag.html 0644 root root 3902 34660 1347419305 1 f none /usr/local/share/doc/postgresql/html/using-explain.html 0644 root root 41822 50889 1347419305 1 f none /usr/local/share/doc/postgresql/html/uuid-ossp.html 0644 root root 7226 2960 1347419305 1 f none /usr/local/share/doc/postgresql/html/vacuumlo.html 0644 root root 7546 34525 1347419305 1 f none /usr/local/share/doc/postgresql/html/view-pg-available-extension-versions.html 0644 root root 4640 14380 1347419305 1 f none /usr/local/share/doc/postgresql/html/view-pg-available-extensions.html 0644 root root 3942 27963 1347419305 1 f none /usr/local/share/doc/postgresql/html/view-pg-cursors.html 0644 root root 5667 23723 1347419305 1 f none /usr/local/share/doc/postgresql/html/view-pg-group.html 0644 root root 3895 18031 1347419305 1 f none /usr/local/share/doc/postgresql/html/view-pg-indexes.html 0644 root root 4153 34180 1347419305 1 f none /usr/local/share/doc/postgresql/html/view-pg-locks.html 0644 root root 14020 50330 1347419305 1 f none /usr/local/share/doc/postgresql/html/view-pg-prepared-statements.html 0644 root root 5058 47011 1347419305 1 f none /usr/local/share/doc/postgresql/html/view-pg-prepared-xacts.html 0644 root root 4910 37739 1347419305 1 f none /usr/local/share/doc/postgresql/html/view-pg-roles.html 0644 root root 6071 48813 1347419305 1 f none /usr/local/share/doc/postgresql/html/view-pg-rules.html 0644 root root 3997 23567 1347419305 1 f none /usr/local/share/doc/postgresql/html/view-pg-seclabels.html 0644 root root 5121 40126 1347419305 1 f none /usr/local/share/doc/postgresql/html/view-pg-settings.html 0644 root root 10598 14750 1347419305 1 f none /usr/local/share/doc/postgresql/html/view-pg-shadow.html 0644 root root 5379 62827 1347419305 1 f none /usr/local/share/doc/postgresql/html/view-pg-stats.html 0644 root root 8885 17377 1347419305 1 f none /usr/local/share/doc/postgresql/html/view-pg-tables.html 0644 root root 4834 20823 1347419305 1 f none /usr/local/share/doc/postgresql/html/view-pg-timezone-abbrevs.html 0644 root root 3574 64443 1347419305 1 f none /usr/local/share/doc/postgresql/html/view-pg-timezone-names.html 0644 root root 4175 45632 1347419305 1 f none /usr/local/share/doc/postgresql/html/view-pg-user-mappings.html 0644 root root 4691 10406 1347419305 1 f none /usr/local/share/doc/postgresql/html/view-pg-user.html 0644 root root 4515 64021 1347419305 1 f none /usr/local/share/doc/postgresql/html/view-pg-views.html 0644 root root 3851 13982 1347419305 1 f none /usr/local/share/doc/postgresql/html/views-overview.html 0644 root root 6540 37642 1347419305 1 f none /usr/local/share/doc/postgresql/html/wal-async-commit.html 0644 root root 9014 15912 1347419305 1 f none /usr/local/share/doc/postgresql/html/wal-configuration.html 0644 root root 14958 61441 1347419305 1 f none /usr/local/share/doc/postgresql/html/wal-internals.html 0644 root root 6149 26113 1347419305 1 f none /usr/local/share/doc/postgresql/html/wal-intro.html 0644 root root 5532 41896 1347419305 1 f none /usr/local/share/doc/postgresql/html/wal-reliability.html 0644 root root 11477 1053 1347419305 1 f none /usr/local/share/doc/postgresql/html/wal.html 0644 root root 2926 14956 1347419305 1 f none /usr/local/share/doc/postgresql/html/warm-standby-failover.html 0644 root root 6100 37261 1347419305 1 f none /usr/local/share/doc/postgresql/html/warm-standby.html 0644 root root 34549 2904 1347419305 1 f none /usr/local/share/doc/postgresql/html/xaggr.html 0644 root root 9900 1755 1347419305 1 f none /usr/local/share/doc/postgresql/html/xfunc-c.html 0644 root root 78710 28145 1347419305 1 f none /usr/local/share/doc/postgresql/html/xfunc-internal.html 0644 root root 4002 35905 1347419305 1 f none /usr/local/share/doc/postgresql/html/xfunc-overload.html 0644 root root 5909 3036 1347419305 1 f none /usr/local/share/doc/postgresql/html/xfunc-pl.html 0644 root root 2989 23841 1347419305 1 f none /usr/local/share/doc/postgresql/html/xfunc-sql.html 0644 root root 38566 3138 1347419305 1 f none /usr/local/share/doc/postgresql/html/xfunc-volatility.html 0644 root root 9837 50930 1347419305 1 f none /usr/local/share/doc/postgresql/html/xfunc.html 0644 root root 4516 9504 1347419305 1 f none /usr/local/share/doc/postgresql/html/xindex.html 0644 root root 44591 17481 1347419305 1 f none /usr/local/share/doc/postgresql/html/xml2.html 0644 root root 16794 15041 1347419305 1 f none /usr/local/share/doc/postgresql/html/xoper-optimization.html 0644 root root 23141 21241 1347419305 1 f none /usr/local/share/doc/postgresql/html/xoper.html 0644 root root 4833 41866 1347419305 1 f none /usr/local/share/doc/postgresql/html/xplang-install.html 0644 root root 11125 59353 1347419305 1 f none /usr/local/share/doc/postgresql/html/xplang.html 0644 root root 4233 62375 1347419305 1 f none /usr/local/share/doc/postgresql/html/xtypes.html 0644 root root 12112 39397 1347419305 1 d none /usr/local/share/man 0755 root root 1 d none /usr/local/share/man/man1 0755 root root 1 f none /usr/local/share/man/man1/clusterdb.1 0644 root root 5811 26853 1347419306 1 f none /usr/local/share/man/man1/createdb.1 0644 root root 7419 32174 1347419306 1 f none /usr/local/share/man/man1/createlang.1 0644 root root 5419 55483 1347419306 1 f none /usr/local/share/man/man1/createuser.1 0644 root root 9329 64941 1347419306 1 f none /usr/local/share/man/man1/dropdb.1 0644 root root 5369 51493 1347419306 1 f none /usr/local/share/man/man1/droplang.1 0644 root root 5211 36534 1347419306 1 f none /usr/local/share/man/man1/dropuser.1 0644 root root 5347 51714 1347419306 1 f none /usr/local/share/man/man1/ecpg.1 0644 root root 5326 48861 1347419306 1 f none /usr/local/share/man/man1/initdb.1 0644 root root 9340 23215 1347419306 1 f none /usr/local/share/man/man1/oid2name.1 0644 root root 8874 33070 1347419306 1 f none /usr/local/share/man/man1/pg_archivecleanup.1 0644 root root 5749 22088 1347419306 1 f none /usr/local/share/man/man1/pg_basebackup.1 0644 root root 13194 36714 1347419306 1 f none /usr/local/share/man/man1/pg_config.1 0644 root root 6800 49813 1347419306 1 f none /usr/local/share/man/man1/pg_controldata.1 0644 root root 2293 51640 1347419306 1 f none /usr/local/share/man/man1/pg_ctl.1 0644 root root 12877 64039 1347419306 1 f none /usr/local/share/man/man1/pg_dump.1 0644 root root 28996 61703 1347419306 1 f none /usr/local/share/man/man1/pg_dumpall.1 0644 root root 12881 5591 1347419306 1 f none /usr/local/share/man/man1/pg_receivexlog.1 0644 root root 6776 58497 1347419306 1 f none /usr/local/share/man/man1/pg_resetxlog.1 0644 root root 8233 49916 1347419306 1 f none /usr/local/share/man/man1/pg_restore.1 0644 root root 19578 58308 1347419306 1 f none /usr/local/share/man/man1/pg_standby.1 0644 root root 10596 47700 1347419306 1 f none /usr/local/share/man/man1/pg_test_fsync.1 0644 root root 2807 29256 1347419306 1 f none /usr/local/share/man/man1/pg_test_timing.1 0644 root root 9816 39715 1347419306 1 f none /usr/local/share/man/man1/pg_upgrade.1 0644 root root 17916 17702 1347419306 1 f none /usr/local/share/man/man1/pgbench.1 0644 root root 21411 43673 1347419306 1 f none /usr/local/share/man/man1/postgres.1 0644 root root 20851 8000 1347419306 1 f none /usr/local/share/man/man1/postmaster.1 0644 root root 1535 47114 1347419306 1 f none /usr/local/share/man/man1/psql.1 0644 root root 87146 36253 1347419306 1 f none /usr/local/share/man/man1/reindexdb.1 0644 root root 6128 52103 1347419306 1 f none /usr/local/share/man/man1/vacuumdb.1 0644 root root 7090 2079 1347419306 1 f none /usr/local/share/man/man1/vacuumlo.1 0644 root root 4314 31093 1347419306 1 d none /usr/local/share/man/man3 0755 root root 1 f none /usr/local/share/man/man3/SPI_connect.3 0644 root root 2261 45257 1347419306 1 f none /usr/local/share/man/man3/SPI_copytuple.3 0644 root root 1834 7398 1347419306 1 f none /usr/local/share/man/man3/SPI_cursor_close.3 0644 root root 1784 4490 1347419306 1 f none /usr/local/share/man/man3/SPI_cursor_fetch.3 0644 root root 2137 33539 1347419306 1 f none /usr/local/share/man/man3/SPI_cursor_find.3 0644 root root 1779 2587 1347419306 1 f none /usr/local/share/man/man3/SPI_cursor_move.3 0644 root root 2003 22323 1347419306 1 f none /usr/local/share/man/man3/SPI_cursor_open.3 0644 root root 3353 9921 1347419306 1 f none /usr/local/share/man/man3/SPI_cursor_open_with_args.3 0644 root root 3426 11406 1347419306 1 f none /usr/local/share/man/man3/SPI_cursor_open_with_paramlist.3 0644 root root 2890 32520 1347419306 1 f none /usr/local/share/man/man3/SPI_exec.3 0644 root root 1778 1451 1347419306 1 f none /usr/local/share/man/man3/SPI_execp.3 0644 root root 2474 62739 1347419306 1 f none /usr/local/share/man/man3/SPI_execute.3 0644 root root 7476 32494 1347419306 1 f none /usr/local/share/man/man3/SPI_execute_plan.3 0644 root root 2985 41007 1347419306 1 f none /usr/local/share/man/man3/SPI_execute_plan_with_paramlist.3 0644 root root 2733 18601 1347419306 1 f none /usr/local/share/man/man3/SPI_execute_with_args.3 0644 root root 3516 22953 1347419306 1 f none /usr/local/share/man/man3/SPI_finish.3 0644 root root 2128 33446 1347419306 1 f none /usr/local/share/man/man3/SPI_fname.3 0644 root root 1934 14950 1347419306 1 f none /usr/local/share/man/man3/SPI_fnumber.3 0644 root root 2176 37587 1347419306 1 f none /usr/local/share/man/man3/SPI_freeplan.3 0644 root root 1766 869 1347419306 1 f none /usr/local/share/man/man3/SPI_freetuple.3 0644 root root 1752 1128 1347419306 1 f none /usr/local/share/man/man3/SPI_freetuptable.3 0644 root root 2053 28399 1347419306 1 f none /usr/local/share/man/man3/SPI_getargcount.3 0644 root root 1909 13940 1347419306 1 f none /usr/local/share/man/man3/SPI_getargtypeid.3 0644 root root 2176 37262 1347419306 1 f none /usr/local/share/man/man3/SPI_getbinval.3 0644 root root 2321 48094 1347419306 1 f none /usr/local/share/man/man3/SPI_getnspname.3 0644 root root 1853 9394 1347419306 1 f none /usr/local/share/man/man3/SPI_getrelname.3 0644 root root 1757 95 1347419306 1 f none /usr/local/share/man/man3/SPI_gettype.3 0644 root root 1948 16448 1347419306 1 f none /usr/local/share/man/man3/SPI_gettypeid.3 0644 root root 1868 9322 1347419306 1 f none /usr/local/share/man/man3/SPI_getvalue.3 0644 root root 2192 38190 1347419306 1 f none /usr/local/share/man/man3/SPI_is_cursor_plan.3 0644 root root 2424 60306 1347419306 1 f none /usr/local/share/man/man3/SPI_keepplan.3 0644 root root 2101 31120 1347419306 1 f none /usr/local/share/man/man3/SPI_modifytuple.3 0644 root root 2938 34893 1347419306 1 f none /usr/local/share/man/man3/SPI_palloc.3 0644 root root 1664 57738 1347419306 1 f none /usr/local/share/man/man3/SPI_pfree.3 0644 root root 1752 658 1347419306 1 f none /usr/local/share/man/man3/SPI_pop.3 0644 root root 1508 44478 1347419306 1 f none /usr/local/share/man/man3/SPI_prepare.3 0644 root root 4742 8009 1347419306 1 f none /usr/local/share/man/man3/SPI_prepare_cursor.3 0644 root root 2626 8929 1347419306 1 f none /usr/local/share/man/man3/SPI_prepare_params.3 0644 root root 2432 57597 1347419306 1 f none /usr/local/share/man/man3/SPI_push.3 0644 root root 2274 49164 1347419306 1 f none /usr/local/share/man/man3/SPI_repalloc.3 0644 root root 1987 21471 1347419306 1 f none /usr/local/share/man/man3/SPI_returntuple.3 0644 root root 2209 41611 1347419306 1 f none /usr/local/share/man/man3/SPI_saveplan.3 0644 root root 2498 1103 1347419306 1 f none /usr/local/share/man/man3/SPI_scroll_cursor_fetch.3 0644 root root 2462 58627 1347419306 1 f none /usr/local/share/man/man3/SPI_scroll_cursor_move.3 0644 root root 2510 63003 1347419306 1 f none /usr/local/share/man/man3/dblink.3 0644 root root 6485 11858 1347419306 1 f none /usr/local/share/man/man3/dblink_build_sql_delete.3 0644 root root 3351 2690 1347419306 1 f none /usr/local/share/man/man3/dblink_build_sql_insert.3 0644 root root 3955 55290 1347419306 1 f none /usr/local/share/man/man3/dblink_build_sql_update.3 0644 root root 4208 11649 1347419306 1 f none /usr/local/share/man/man3/dblink_cancel_query.3 0644 root root 2162 36823 1347419306 1 f none /usr/local/share/man/man3/dblink_close.3 0644 root root 2756 19156 1347419306 1 f none /usr/local/share/man/man3/dblink_connect.3 0644 root root 5597 57568 1347419306 1 f none /usr/local/share/man/man3/dblink_connect_u.3 0644 root root 2810 35901 1347419306 1 f none /usr/local/share/man/man3/dblink_disconnect.3 0644 root root 2155 33368 1347419306 1 f none /usr/local/share/man/man3/dblink_error_message.3 0644 root root 1877 10710 1347419306 1 f none /usr/local/share/man/man3/dblink_exec.3 0644 root root 3831 41899 1347419306 1 f none /usr/local/share/man/man3/dblink_fetch.3 0644 root root 4238 14975 1347419306 1 f none /usr/local/share/man/man3/dblink_get_connections.3 0644 root root 1756 509 1347419306 1 f none /usr/local/share/man/man3/dblink_get_notify.3 0644 root root 2547 64712 1347419306 1 f none /usr/local/share/man/man3/dblink_get_pkey.3 0644 root root 2711 13092 1347419306 1 f none /usr/local/share/man/man3/dblink_get_result.3 0644 root root 4993 8095 1347419306 1 f none /usr/local/share/man/man3/dblink_is_busy.3 0644 root root 1871 9466 1347419306 1 f none /usr/local/share/man/man3/dblink_open.3 0644 root root 3270 1427 1347419306 1 f none /usr/local/share/man/man3/dblink_send_query.3 0644 root root 2389 56536 1347419306 1 d none /usr/local/share/man/man5 0755 root root 1 f none /usr/local/share/man/man5/ABORT.5sql 0644 root root 2249 38840 1347419306 1 f none /usr/local/share/man/man5/ALTER_AGGREGATE.5sql 0644 root root 3614 21849 1347419306 1 f none /usr/local/share/man/man5/ALTER_COLLATION.5sql 0644 root root 2867 22957 1347419306 1 f none /usr/local/share/man/man5/ALTER_CONVERSION.5sql 0644 root root 2965 32729 1347419306 1 f none /usr/local/share/man/man5/ALTER_DATABASE.5sql 0644 root root 5407 52474 1347419306 1 f none /usr/local/share/man/man5/ALTER_DEFAULT_PRIVILEGES.5sql 0644 root root 6528 51584 1347419306 1 f none /usr/local/share/man/man5/ALTER_DOMAIN.5sql 0644 root root 6949 33855 1347419306 1 f none /usr/local/share/man/man5/ALTER_EXTENSION.5sql 0644 root root 6703 26197 1347419306 1 f none /usr/local/share/man/man5/ALTER_FOREIGN_DATA_WRAPPER.5sql 0644 root root 4479 27521 1347419306 1 f none /usr/local/share/man/man5/ALTER_FOREIGN_TABLE.5sql 0644 root root 7785 36653 1347419306 1 f none /usr/local/share/man/man5/ALTER_FUNCTION.5sql 0644 root root 7774 42956 1347419306 1 f none /usr/local/share/man/man5/ALTER_GROUP.5sql 0644 root root 3077 42258 1347419306 1 f none /usr/local/share/man/man5/ALTER_INDEX.5sql 0644 root root 4623 38935 1347419306 1 f none /usr/local/share/man/man5/ALTER_LANGUAGE.5sql 0644 root root 2148 28538 1347419306 1 f none /usr/local/share/man/man5/ALTER_LARGE_OBJECT.5sql 0644 root root 2020 19525 1347419306 1 f none /usr/local/share/man/man5/ALTER_OPERATOR.5sql 0644 root root 3082 44361 1347419306 1 f none /usr/local/share/man/man5/ALTER_OPERATOR_CLASS.5sql 0644 root root 2917 29823 1347419306 1 f none /usr/local/share/man/man5/ALTER_OPERATOR_FAMILY.5sql 0644 root root 9305 50336 1347419306 1 f none /usr/local/share/man/man5/ALTER_ROLE.5sql 0644 root root 8431 36513 1347419306 1 f none /usr/local/share/man/man5/ALTER_SCHEMA.5sql 0644 root root 2368 48567 1347419306 1 f none /usr/local/share/man/man5/ALTER_SEQUENCE.5sql 0644 root root 7703 50439 1347419306 1 f none /usr/local/share/man/man5/ALTER_SERVER.5sql 0644 root root 3487 9196 1347419306 1 f none /usr/local/share/man/man5/ALTER_TABLE.5sql 0644 root root 30596 55413 1347419306 1 f none /usr/local/share/man/man5/ALTER_TABLESPACE.5sql 0644 root root 3349 940 1347419306 1 f none /usr/local/share/man/man5/ALTER_TEXT_SEARCH_CONFIGURATION.5sql 0644 root root 4919 65482 1347419306 1 f none /usr/local/share/man/man5/ALTER_TEXT_SEARCH_DICTIONARY.5sql 0644 root root 4131 875 1347419306 1 f none /usr/local/share/man/man5/ALTER_TEXT_SEARCH_PARSER.5sql 0644 root root 2325 42773 1347419306 1 f none /usr/local/share/man/man5/ALTER_TEXT_SEARCH_TEMPLATE.5sql 0644 root root 2363 45874 1347419306 1 f none /usr/local/share/man/man5/ALTER_TRIGGER.5sql 0644 root root 2567 65013 1347419306 1 f none /usr/local/share/man/man5/ALTER_TYPE.5sql 0644 root root 7035 49202 1347419306 1 f none /usr/local/share/man/man5/ALTER_USER.5sql 0644 root root 2410 46578 1347419306 1 f none /usr/local/share/man/man5/ALTER_USER_MAPPING.5sql 0644 root root 3378 65480 1347419306 1 f none /usr/local/share/man/man5/ALTER_VIEW.5sql 0644 root root 3987 51260 1347419306 1 f none /usr/local/share/man/man5/ANALYZE.5sql 0644 root root 7700 7433 1347419306 1 f none /usr/local/share/man/man5/BEGIN.5sql 0644 root root 4184 9843 1347419306 1 f none /usr/local/share/man/man5/CHECKPOINT.5sql 0644 root root 2372 54926 1347419306 1 f none /usr/local/share/man/man5/CLOSE.5sql 0644 root root 2827 24655 1347419306 1 f none /usr/local/share/man/man5/CLUSTER.5sql 0644 root root 6414 19024 1347419306 1 f none /usr/local/share/man/man5/COMMENT.5sql 0644 root root 9213 39363 1347419306 1 f none /usr/local/share/man/man5/COMMIT.5sql 0644 root root 2173 32141 1347419306 1 f none /usr/local/share/man/man5/COMMIT_PREPARED.5sql 0644 root root 2677 12751 1347419306 1 f none /usr/local/share/man/man5/COPY.5sql 0644 root root 26759 31964 1347419306 1 f none /usr/local/share/man/man5/CREATE_AGGREGATE.5sql 0644 root root 9672 46164 1347419306 1 f none /usr/local/share/man/man5/CREATE_CAST.5sql 0644 root root 14412 12550 1347419306 1 f none /usr/local/share/man/man5/CREATE_COLLATION.5sql 0644 root root 4102 65406 1347419306 1 f none /usr/local/share/man/man5/CREATE_CONVERSION.5sql 0644 root root 3914 48756 1347419306 1 f none /usr/local/share/man/man5/CREATE_DATABASE.5sql 0644 root root 8246 35212 1347419306 1 f none /usr/local/share/man/man5/CREATE_DOMAIN.5sql 0644 root root 5501 59781 1347419306 1 f none /usr/local/share/man/man5/CREATE_EXTENSION.5sql 0644 root root 5594 11144 1347419306 1 f none /usr/local/share/man/man5/CREATE_FOREIGN_DATA_WRAPPER.5sql 0644 root root 5205 32783 1347419306 1 f none /usr/local/share/man/man5/CREATE_FOREIGN_TABLE.5sql 0644 root root 4818 55354 1347419306 1 f none /usr/local/share/man/man5/CREATE_FUNCTION.5sql 0644 root root 22095 64284 1347419306 1 f none /usr/local/share/man/man5/CREATE_GROUP.5sql 0644 root root 2222 27733 1347419306 1 f none /usr/local/share/man/man5/CREATE_INDEX.5sql 0644 root root 18915 8517 1347419306 1 f none /usr/local/share/man/man5/CREATE_LANGUAGE.5sql 0644 root root 10100 18650 1347419306 1 f none /usr/local/share/man/man5/CREATE_OPERATOR.5sql 0644 root root 7086 50814 1347419306 1 f none /usr/local/share/man/man5/CREATE_OPERATOR_CLASS.5sql 0644 root root 8748 5282 1347419306 1 f none /usr/local/share/man/man5/CREATE_OPERATOR_FAMILY.5sql 0644 root root 3727 40122 1347419306 1 f none /usr/local/share/man/man5/CREATE_ROLE.5sql 0644 root root 12625 12988 1347419306 1 f none /usr/local/share/man/man5/CREATE_RULE.5sql 0644 root root 8102 19993 1347419306 1 f none /usr/local/share/man/man5/CREATE_SCHEMA.5sql 0644 root root 5428 50496 1347419306 1 f none /usr/local/share/man/man5/CREATE_SEQUENCE.5sql 0644 root root 9505 10557 1347419306 1 f none /usr/local/share/man/man5/CREATE_SERVER.5sql 0644 root root 3771 34572 1347419306 1 f none /usr/local/share/man/man5/CREATE_TABLE.5sql 0644 root root 40334 13745 1347419306 1 f none /usr/local/share/man/man5/CREATE_TABLESPACE.5sql 0644 root root 3604 21823 1347419306 1 f none /usr/local/share/man/man5/CREATE_TABLE_AS.5sql 0644 root root 8135 63490 1347419306 1 f none /usr/local/share/man/man5/CREATE_TEXT_SEARCH_CONFIGURATION.5sql 0644 root root 3323 1958 1347419306 1 f none /usr/local/share/man/man5/CREATE_TEXT_SEARCH_DICTIONARY.5sql 0644 root root 3473 12442 1347419306 1 f none /usr/local/share/man/man5/CREATE_TEXT_SEARCH_PARSER.5sql 0644 root root 3696 34425 1347419306 1 f none /usr/local/share/man/man5/CREATE_TEXT_SEARCH_TEMPLATE.5sql 0644 root root 3512 20464 1347419306 1 f none /usr/local/share/man/man5/CREATE_TRIGGER.5sql 0644 root root 15476 61047 1347419306 1 f none /usr/local/share/man/man5/CREATE_TYPE.5sql 0644 root root 29012 7556 1347419306 1 f none /usr/local/share/man/man5/CREATE_USER.5sql 0644 root root 2539 54653 1347419306 1 f none /usr/local/share/man/man5/CREATE_USER_MAPPING.5sql 0644 root root 3387 1899 1347419306 1 f none /usr/local/share/man/man5/CREATE_VIEW.5sql 0644 root root 7109 64218 1347419306 1 f none /usr/local/share/man/man5/DEALLOCATE.5sql 0644 root root 2096 26204 1347419306 1 f none /usr/local/share/man/man5/DECLARE.5sql 0644 root root 10504 43117 1347419306 1 f none /usr/local/share/man/man5/DELETE.5sql 0644 root root 7576 35293 1347419306 1 f none /usr/local/share/man/man5/DISCARD.5sql 0644 root root 2591 3176 1347419306 1 f none /usr/local/share/man/man5/DO.5sql 0644 root root 3200 54407 1347419306 1 f none /usr/local/share/man/man5/DROP_AGGREGATE.5sql 0644 root root 2639 4243 1347419306 1 f none /usr/local/share/man/man5/DROP_CAST.5sql 0644 root root 2340 44264 1347419306 1 f none /usr/local/share/man/man5/DROP_COLLATION.5sql 0644 root root 2393 47845 1347419306 1 f none /usr/local/share/man/man5/DROP_CONVERSION.5sql 0644 root root 2454 53663 1347419306 1 f none /usr/local/share/man/man5/DROP_DATABASE.5sql 0644 root root 2468 57872 1347419306 1 f none /usr/local/share/man/man5/DROP_DOMAIN.5sql 0644 root root 2302 39464 1347419306 1 f none /usr/local/share/man/man5/DROP_EXTENSION.5sql 0644 root root 2705 10644 1347419306 1 f none /usr/local/share/man/man5/DROP_FOREIGN_DATA_WRAPPER.5sql 0644 root root 2577 61275 1347419306 1 f none /usr/local/share/man/man5/DROP_FOREIGN_TABLE.5sql 0644 root root 2564 61586 1347419306 1 f none /usr/local/share/man/man5/DROP_FUNCTION.5sql 0644 root root 3344 339 1347419306 1 f none /usr/local/share/man/man5/DROP_GROUP.5sql 0644 root root 1638 51591 1347419306 1 f none /usr/local/share/man/man5/DROP_INDEX.5sql 0644 root root 3177 53363 1347419306 1 f none /usr/local/share/man/man5/DROP_LANGUAGE.5sql 0644 root root 2835 18953 1347419306 1 f none /usr/local/share/man/man5/DROP_OPERATOR.5sql 0644 root root 2968 30322 1347419306 1 f none /usr/local/share/man/man5/DROP_OPERATOR_CLASS.5sql 0644 root root 3461 9115 1347419306 1 f none /usr/local/share/man/man5/DROP_OPERATOR_FAMILY.5sql 0644 root root 3235 54559 1347419306 1 f none /usr/local/share/man/man5/DROP_OWNED.5sql 0644 root root 2854 26469 1347419306 1 f none /usr/local/share/man/man5/DROP_ROLE.5sql 0644 root root 3055 42553 1347419306 1 f none /usr/local/share/man/man5/DROP_RULE.5sql 0644 root root 2248 35865 1347419306 1 f none /usr/local/share/man/man5/DROP_SCHEMA.5sql 0644 root root 2612 1707 1347419306 1 f none /usr/local/share/man/man5/DROP_SEQUENCE.5sql 0644 root root 2433 51499 1347419306 1 f none /usr/local/share/man/man5/DROP_SERVER.5sql 0644 root root 2353 44067 1347419306 1 f none /usr/local/share/man/man5/DROP_TABLE.5sql 0644 root root 2945 31785 1347419306 1 f none /usr/local/share/man/man5/DROP_TABLESPACE.5sql 0644 root root 2576 78 1347419306 1 f none /usr/local/share/man/man5/DROP_TEXT_SEARCH_CONFIGURATION.5sql 0644 root root 2830 20437 1347419306 1 f none /usr/local/share/man/man5/DROP_TEXT_SEARCH_DICTIONARY.5sql 0644 root root 2739 12229 1347419306 1 f none /usr/local/share/man/man5/DROP_TEXT_SEARCH_PARSER.5sql 0644 root root 2639 3401 1347419306 1 f none /usr/local/share/man/man5/DROP_TEXT_SEARCH_TEMPLATE.5sql 0644 root root 2677 6542 1347419306 1 f none /usr/local/share/man/man5/DROP_TRIGGER.5sql 0644 root root 2576 65449 1347419306 1 f none /usr/local/share/man/man5/DROP_TYPE.5sql 0644 root root 2490 57187 1347419306 1 f none /usr/local/share/man/man5/DROP_USER.5sql 0644 root root 1702 57707 1347419306 1 f none /usr/local/share/man/man5/DROP_USER_MAPPING.5sql 0644 root root 2657 4306 1347419306 1 f none /usr/local/share/man/man5/DROP_VIEW.5sql 0644 root root 2394 48866 1347419306 1 f none /usr/local/share/man/man5/END.5sql 0644 root root 2265 40199 1347419306 1 f none /usr/local/share/man/man5/EXECUTE.5sql 0644 root root 3034 46233 1347419306 1 f none /usr/local/share/man/man5/EXPLAIN.5sql 0644 root root 13203 13114 1347419306 1 f none /usr/local/share/man/man5/FETCH.5sql 0644 root root 8727 47513 1347419306 1 f none /usr/local/share/man/man5/GRANT.5sql 0644 root root 21607 44659 1347419306 1 f none /usr/local/share/man/man5/INSERT.5sql 0644 root root 8951 8641 1347419306 1 f none /usr/local/share/man/man5/LISTEN.5sql 0644 root root 3621 35096 1347419306 1 f none /usr/local/share/man/man5/LOAD.5sql 0644 root root 2645 13315 1347419306 1 f none /usr/local/share/man/man5/LOCK.5sql 0644 root root 7972 8098 1347419306 1 f none /usr/local/share/man/man5/MOVE.5sql 0644 root root 3034 30914 1347419306 1 f none /usr/local/share/man/man5/NOTIFY.5sql 0644 root root 8154 56763 1347419306 1 f none /usr/local/share/man/man5/PREPARE.5sql 0644 root root 6352 15495 1347419306 1 f none /usr/local/share/man/man5/PREPARE_TRANSACTION.5sql 0644 root root 5900 37134 1347419306 1 f none /usr/local/share/man/man5/REASSIGN_OWNED.5sql 0644 root root 3134 49730 1347419306 1 f none /usr/local/share/man/man5/REINDEX.5sql 0644 root root 8039 21596 1347419306 1 f none /usr/local/share/man/man5/RELEASE_SAVEPOINT.5sql 0644 root root 3139 49779 1347419306 1 f none /usr/local/share/man/man5/RESET.5sql 0644 root root 3029 44847 1347419306 1 f none /usr/local/share/man/man5/REVOKE.5sql 0644 root root 10714 6386 1347419306 1 f none /usr/local/share/man/man5/ROLLBACK.5sql 0644 root root 2172 30471 1347419306 1 f none /usr/local/share/man/man5/ROLLBACK_PREPARED.5sql 0644 root root 2702 14383 1347419306 1 f none /usr/local/share/man/man5/ROLLBACK_TO_SAVEPOINT.5sql 0644 root root 4102 64973 1347419306 1 f none /usr/local/share/man/man5/SAVEPOINT.5sql 0644 root root 3639 23106 1347419306 1 f none /usr/local/share/man/man5/SECURITY_LABEL.5sql 0644 root root 5421 52744 1347419306 1 f none /usr/local/share/man/man5/SELECT.5sql 0644 root root 53674 35360 1347419306 1 f none /usr/local/share/man/man5/SELECT_INTO.5sql 0644 root root 4635 30826 1347419306 1 f none /usr/local/share/man/man5/SET.5sql 0644 root root 7642 44585 1347419306 1 f none /usr/local/share/man/man5/SET_CONSTRAINTS.5sql 0644 root root 4669 59825 1347419306 1 f none /usr/local/share/man/man5/SET_ROLE.5sql 0644 root root 4486 35384 1347419306 1 f none /usr/local/share/man/man5/SET_SESSION_AUTHORIZATION.5sql 0644 root root 4013 61308 1347419306 1 f none /usr/local/share/man/man5/SET_TRANSACTION.5sql 0644 root root 8646 13385 1347419306 1 f none /usr/local/share/man/man5/SHOW.5sql 0644 root root 4347 14736 1347419306 1 f none /usr/local/share/man/man5/START_TRANSACTION.5sql 0644 root root 3004 36805 1347419306 1 f none /usr/local/share/man/man5/TABLE.5sql 0644 root root 21 1613 1347419306 1 f none /usr/local/share/man/man5/TRUNCATE.5sql 0644 root root 6924 58938 1347419306 1 f none /usr/local/share/man/man5/UNLISTEN.5sql 0644 root root 2842 24918 1347419306 1 f none /usr/local/share/man/man5/UPDATE.5sql 0644 root root 10747 48240 1347419306 1 f none /usr/local/share/man/man5/VACUUM.5sql 0644 root root 8613 4580 1347419306 1 f none /usr/local/share/man/man5/VALUES.5sql 0644 root root 7140 46198 1347419306 1 f none /usr/local/share/man/man5/WITH.5sql 0644 root root 21 1613 1347419306 1 d none /usr/local/share/postgresql 0755 root root 1 f none /usr/local/share/postgresql/conversion_create.sql 0644 root root 74932 16952 1347419308 1 d none /usr/local/share/postgresql/extension 0755 root root 1 f none /usr/local/share/postgresql/extension/adminpack--1.0.sql 0644 root root 1535 55172 1347419310 1 f none /usr/local/share/postgresql/extension/adminpack.control 0644 root root 176 15922 1347419310 1 f none /usr/local/share/postgresql/extension/autoinc--1.0.sql 0644 root root 249 19868 1347419312 1 f none /usr/local/share/postgresql/extension/autoinc--unpackaged--1.0.sql 0644 root root 234 19493 1347419312 1 f none /usr/local/share/postgresql/extension/autoinc.control 0644 root root 149 13551 1347419312 1 f none /usr/local/share/postgresql/extension/btree_gin--1.0.sql 0644 root root 24818 50641 1347419311 1 f none /usr/local/share/postgresql/extension/btree_gin--unpackaged--1.0.sql 0644 root root 10091 1722 1347419311 1 f none /usr/local/share/postgresql/extension/btree_gin.control 0644 root root 160 14395 1347419311 1 f none /usr/local/share/postgresql/extension/btree_gist--1.0.sql 0644 root root 37814 841 1347419311 1 f none /usr/local/share/postgresql/extension/btree_gist--unpackaged--1.0.sql 0644 root root 21463 53290 1347419311 1 f none /usr/local/share/postgresql/extension/btree_gist.control 0644 root root 163 14758 1347419311 1 f none /usr/local/share/postgresql/extension/chkpass--1.0.sql 0644 root root 1154 22673 1347419311 1 f none /usr/local/share/postgresql/extension/chkpass--unpackaged--1.0.sql 0644 root root 619 52275 1347419311 1 f none /usr/local/share/postgresql/extension/chkpass.control 0644 root root 150 13549 1347419311 1 f none /usr/local/share/postgresql/extension/citext--1.0.sql 0644 root root 12337 52626 1347419311 1 f none /usr/local/share/postgresql/extension/citext--unpackaged--1.0.sql 0644 root root 8694 17079 1347419311 1 f none /usr/local/share/postgresql/extension/citext.control 0644 root root 158 14316 1347419311 1 f none /usr/local/share/postgresql/extension/cube--1.0.sql 0644 root root 7831 54747 1347419311 1 f none /usr/local/share/postgresql/extension/cube--unpackaged--1.0.sql 0644 root root 3179 6767 1347419311 1 f none /usr/local/share/postgresql/extension/cube.control 0644 root root 142 12679 1347419311 1 f none /usr/local/share/postgresql/extension/dblink--1.0.sql 0644 root root 5569 50377 1347419311 1 f none /usr/local/share/postgresql/extension/dblink--unpackaged--1.0.sql 0644 root root 2847 52141 1347419311 1 f none /usr/local/share/postgresql/extension/dblink.control 0644 root root 170 15238 1347419311 1 f none /usr/local/share/postgresql/extension/dict_int--1.0.sql 0644 root root 711 54377 1347419311 1 f none /usr/local/share/postgresql/extension/dict_int--unpackaged--1.0.sql 0644 root root 477 41646 1347419311 1 f none /usr/local/share/postgresql/extension/dict_int.control 0644 root root 158 14343 1347419311 1 f none /usr/local/share/postgresql/extension/dict_xsyn--1.0.sql 0644 root root 694 52924 1347419311 1 f none /usr/local/share/postgresql/extension/dict_xsyn--unpackaged--1.0.sql 0644 root root 472 41451 1347419311 1 f none /usr/local/share/postgresql/extension/dict_xsyn.control 0644 root root 179 16543 1347419311 1 f none /usr/local/share/postgresql/extension/earthdistance--1.0.sql 0644 root root 3096 46938 1347419311 1 f none /usr/local/share/postgresql/extension/earthdistance--unpackaged--1.0.sql 0644 root root 943 17025 1347419311 1 f none /usr/local/share/postgresql/extension/earthdistance.control 0644 root root 202 18215 1347419311 1 f none /usr/local/share/postgresql/extension/file_fdw--1.0.sql 0644 root root 475 37941 1347419311 1 f none /usr/local/share/postgresql/extension/file_fdw.control 0644 root root 155 13864 1347419311 1 f none /usr/local/share/postgresql/extension/fuzzystrmatch--1.0.sql 0644 root root 1436 48605 1347419311 1 f none /usr/local/share/postgresql/extension/fuzzystrmatch--unpackaged--1.0.sql 0644 root root 1092 29830 1347419311 1 f none /usr/local/share/postgresql/extension/fuzzystrmatch.control 0644 root root 175 16272 1347419311 1 f none /usr/local/share/postgresql/extension/hstore--1.0--1.1.sql 0644 root root 280 22033 1347419311 1 f none /usr/local/share/postgresql/extension/hstore--1.1.sql 0644 root root 12322 63009 1347419311 1 f none /usr/local/share/postgresql/extension/hstore--unpackaged--1.0.sql 0644 root root 5493 19041 1347419311 1 f none /usr/local/share/postgresql/extension/hstore.control 0644 root root 158 14016 1347419311 1 f none /usr/local/share/postgresql/extension/insert_username--1.0.sql 0644 root root 273 22463 1347419312 1 f none /usr/local/share/postgresql/extension/insert_username--unpackaged--1.0.sql 0644 root root 266 22953 1347419312 1 f none /usr/local/share/postgresql/extension/insert_username.control 0644 root root 170 15538 1347419312 1 f none /usr/local/share/postgresql/extension/intagg--1.0.sql 0644 root root 1041 22141 1347419311 1 f none /usr/local/share/postgresql/extension/intagg--unpackaged--1.0.sql 0644 root root 452 39006 1347419311 1 f none /usr/local/share/postgresql/extension/intagg.control 0644 root root 119 10675 1347419311 1 f none /usr/local/share/postgresql/extension/intarray--1.0.sql 0644 root root 10473 62938 1347419311 1 f none /usr/local/share/postgresql/extension/intarray--unpackaged--1.0.sql 0644 root root 6755 4808 1347419311 1 f none /usr/local/share/postgresql/extension/intarray.control 0644 root root 176 15795 1347419311 1 f none /usr/local/share/postgresql/extension/isn--1.0.sql 0644 root root 66205 43539 1347419311 1 f none /usr/local/share/postgresql/extension/isn--unpackaged--1.0.sql 0644 root root 23689 63473 1347419311 1 f none /usr/local/share/postgresql/extension/isn.control 0644 root root 160 14532 1347419311 1 f none /usr/local/share/postgresql/extension/lo--1.0.sql 0644 root root 708 57927 1347419311 1 f none /usr/local/share/postgresql/extension/lo--unpackaged--1.0.sql 0644 root root 298 24051 1347419311 1 f none /usr/local/share/postgresql/extension/lo.control 0644 root root 126 11025 1347419311 1 f none /usr/local/share/postgresql/extension/ltree--1.0.sql 0644 root root 18297 17636 1347419312 1 f none /usr/local/share/postgresql/extension/ltree--unpackaged--1.0.sql 0644 root root 7982 33494 1347419312 1 f none /usr/local/share/postgresql/extension/ltree.control 0644 root root 155 13974 1347419311 1 f none /usr/local/share/postgresql/extension/moddatetime--1.0.sql 0644 root root 261 21098 1347419312 1 f none /usr/local/share/postgresql/extension/moddatetime--unpackaged--1.0.sql 0644 root root 250 21133 1347419312 1 f none /usr/local/share/postgresql/extension/moddatetime.control 0644 root root 165 15068 1347419312 1 f none /usr/local/share/postgresql/extension/pageinspect--1.0.sql 0644 root root 2339 49575 1347419312 1 f none /usr/local/share/postgresql/extension/pageinspect--unpackaged--1.0.sql 0644 root root 1100 28168 1347419312 1 f none /usr/local/share/postgresql/extension/pageinspect.control 0644 root root 173 15611 1347419312 1 f none /usr/local/share/postgresql/extension/pg_buffercache--1.0.sql 0644 root root 755 63160 1347419312 1 f none /usr/local/share/postgresql/extension/pg_buffercache--unpackaged--1.0.sql 0644 root root 335 28822 1347419312 1 f none /usr/local/share/postgresql/extension/pg_buffercache.control 0644 root root 157 14123 1347419312 1 f none /usr/local/share/postgresql/extension/pg_freespacemap--1.0.sql 0644 root root 871 6061 1347419312 1 f none /usr/local/share/postgresql/extension/pg_freespacemap--unpackaged--1.0.sql 0644 root root 359 31338 1347419312 1 f none /usr/local/share/postgresql/extension/pg_freespacemap.control 0644 root root 160 14213 1347419312 1 f none /usr/local/share/postgresql/extension/pg_stat_statements--1.0--1.1.sql 0644 root root 1237 36608 1347419312 1 f none /usr/local/share/postgresql/extension/pg_stat_statements--1.1.sql 0644 root root 1205 33384 1347419312 1 f none /usr/local/share/postgresql/extension/pg_stat_statements--unpackaged--1.0.sql 0644 root root 433 38696 1347419312 1 f none /usr/local/share/postgresql/extension/pg_stat_statements.control 0644 root root 191 17722 1347419312 1 f none /usr/local/share/postgresql/extension/pg_trgm--1.0.sql 0644 root root 4977 46103 1347419312 1 f none /usr/local/share/postgresql/extension/pg_trgm--unpackaged--1.0.sql 0644 root root 4230 23225 1347419312 1 f none /usr/local/share/postgresql/extension/pg_trgm.control 0644 root root 177 16172 1347419312 1 f none /usr/local/share/postgresql/extension/pgcrypto--1.0.sql 0644 root root 4812 52313 1347419312 1 f none /usr/local/share/postgresql/extension/pgcrypto--unpackaged--1.0.sql 0644 root root 2433 19577 1347419312 1 f none /usr/local/share/postgresql/extension/pgcrypto.control 0644 root root 137 12478 1347419312 1 f none /usr/local/share/postgresql/extension/pgrowlocks--1.0.sql 0644 root root 534 41617 1347419312 1 f none /usr/local/share/postgresql/extension/pgrowlocks--unpackaged--1.0.sql 0644 root root 257 22089 1347419312 1 f none /usr/local/share/postgresql/extension/pgrowlocks.control 0644 root root 152 13879 1347419312 1 f none /usr/local/share/postgresql/extension/pgstattuple--1.0.sql 0644 root root 1910 20325 1347419312 1 f none /usr/local/share/postgresql/extension/pgstattuple--unpackaged--1.0.sql 0644 root root 441 38463 1347419312 1 f none /usr/local/share/postgresql/extension/pgstattuple.control 0644 root root 147 13451 1347419312 1 f none /usr/local/share/postgresql/extension/plpgsql--1.0.sql 0644 root root 332 27082 1347419310 1 f none /usr/local/share/postgresql/extension/plpgsql--unpackaged--1.0.sql 0644 root root 381 31702 1347419310 1 f none /usr/local/share/postgresql/extension/plpgsql.control 0644 root root 179 15991 1347419310 1 f none /usr/local/share/postgresql/extension/pltcl--1.0.sql 0644 root root 316 25411 1347419310 1 f none /usr/local/share/postgresql/extension/pltcl--unpackaged--1.0.sql 0644 root root 231 18450 1347419310 1 f none /usr/local/share/postgresql/extension/pltcl.control 0644 root root 173 15371 1347419310 1 f none /usr/local/share/postgresql/extension/pltclu--1.0.sql 0644 root root 330 26885 1347419310 1 f none /usr/local/share/postgresql/extension/pltclu--unpackaged--1.0.sql 0644 root root 236 19035 1347419310 1 f none /usr/local/share/postgresql/extension/pltclu.control 0644 root root 184 16536 1347419310 1 f none /usr/local/share/postgresql/extension/refint--1.0.sql 0644 root root 343 27206 1347419312 1 f none /usr/local/share/postgresql/extension/refint--unpackaged--1.0.sql 0644 root root 298 25099 1347419312 1 f none /usr/local/share/postgresql/extension/refint.control 0644 root root 169 15437 1347419312 1 f none /usr/local/share/postgresql/extension/seg--1.0.sql 0644 root root 7726 37487 1347419312 1 f none /usr/local/share/postgresql/extension/seg--unpackaged--1.0.sql 0644 root root 2766 32953 1347419312 1 f none /usr/local/share/postgresql/extension/seg.control 0644 root root 172 15615 1347419312 1 f none /usr/local/share/postgresql/extension/sslinfo--1.0.sql 0644 root root 1153 25468 1347419313 1 f none /usr/local/share/postgresql/extension/sslinfo--unpackaged--1.0.sql 0644 root root 830 3606 1347419313 1 f none /usr/local/share/postgresql/extension/sslinfo.control 0644 root root 146 13147 1347419313 1 f none /usr/local/share/postgresql/extension/tablefunc--1.0.sql 0644 root root 2153 42550 1347419312 1 f none /usr/local/share/postgresql/extension/tablefunc--unpackaged--1.0.sql 0644 root root 1144 34768 1347419312 1 f none /usr/local/share/postgresql/extension/tablefunc.control 0644 root root 174 15900 1347419312 1 f none /usr/local/share/postgresql/extension/tcn--1.0.sql 0644 root root 274 22381 1347419313 1 f none /usr/local/share/postgresql/extension/tcn.control 0644 root root 134 11933 1347419313 1 f none /usr/local/share/postgresql/extension/test_parser--1.0.sql 0644 root root 814 64847 1347419313 1 f none /usr/local/share/postgresql/extension/test_parser--unpackaged--1.0.sql 0644 root root 559 49683 1347419313 1 f none /usr/local/share/postgresql/extension/test_parser.control 0644 root root 167 15162 1347419313 1 f none /usr/local/share/postgresql/extension/timetravel--1.0.sql 0644 root root 486 37699 1347419312 1 f none /usr/local/share/postgresql/extension/timetravel--unpackaged--1.0.sql 0644 root root 378 32539 1347419312 1 f none /usr/local/share/postgresql/extension/timetravel.control 0644 root root 156 14262 1347419312 1 f none /usr/local/share/postgresql/extension/tsearch2--1.0.sql 0644 root root 15712 61127 1347419313 1 f none /usr/local/share/postgresql/extension/tsearch2--unpackaged--1.0.sql 0644 root root 9090 13125 1347419313 1 f none /usr/local/share/postgresql/extension/tsearch2.control 0644 root root 313 28094 1347419313 1 f none /usr/local/share/postgresql/extension/unaccent--1.0.sql 0644 root root 854 1374 1347419313 1 f none /usr/local/share/postgresql/extension/unaccent--unpackaged--1.0.sql 0644 root root 750 64613 1347419313 1 f none /usr/local/share/postgresql/extension/unaccent.control 0644 root root 157 14236 1347419313 1 f none /usr/local/share/postgresql/extension/xml2--1.0.sql 0644 root root 1867 15364 1347419313 1 f none /usr/local/share/postgresql/extension/xml2--unpackaged--1.0.sql 0644 root root 1325 48085 1347419313 1 f none /usr/local/share/postgresql/extension/xml2.control 0644 root root 208 18230 1347419313 1 f none /usr/local/share/postgresql/information_schema.sql 0644 root root 106299 41008 1347419307 1 f none /usr/local/share/postgresql/pg_hba.conf.sample 0644 root root 4420 35114 1347419307 1 f none /usr/local/share/postgresql/pg_ident.conf.sample 0644 root root 1636 5990 1347419307 1 f none /usr/local/share/postgresql/pg_service.conf.sample 0644 root root 604 53878 1347419309 1 f none /usr/local/share/postgresql/postgres.bki 0644 root root 519298 5463 1347419307 1 f none /usr/local/share/postgresql/postgres.description 0644 root root 98573 8879 1347419307 1 f none /usr/local/share/postgresql/postgres.shdescription 0644 root root 49 4530 1347419307 1 f none /usr/local/share/postgresql/postgresql.conf.sample 0644 root root 19579 64258 1347419307 1 f none /usr/local/share/postgresql/psqlrc.sample 0644 root root 211 18203 1347419310 1 f none /usr/local/share/postgresql/recovery.conf.sample 0644 root root 4704 50755 1347419307 1 f none /usr/local/share/postgresql/snowball_create.sql 0644 root root 13337 37703 1347419308 1 f none /usr/local/share/postgresql/sql_features.txt 0644 root root 33035 51692 1347419307 1 f none /usr/local/share/postgresql/system_views.sql 0644 root root 27302 25797 1347419307 1 d none /usr/local/share/postgresql/timezone 0755 root root 1 d none /usr/local/share/postgresql/timezone/Africa 0755 root root 1 f none /usr/local/share/postgresql/timezone/Africa/Abidjan 0644 root root 156 5984 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Accra 0644 root root 378 37100 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Addis_Ababa 0644 root root 180 7157 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Algiers 0644 root root 734 62353 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Asmara 0644 root root 201 9012 1347419306 1 l none /usr/local/share/postgresql/timezone/Africa/Asmera=/usr/local/share/postgresql/timezone/Africa/Asmara 1 f none /usr/local/share/postgresql/timezone/Africa/Bamako 0644 root root 208 12622 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Bangui 0644 root root 157 4570 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Banjul 0644 root root 232 14560 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Bissau 0644 root root 194 8834 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Blantyre 0644 root root 157 4901 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Brazzaville 0644 root root 157 4570 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Bujumbura 0644 root root 140 3870 1347419306 1 l none /usr/local/share/postgresql/timezone/Africa/Cairo=/usr/local/share/postgresql/timezone/Egypt 1 f none /usr/local/share/postgresql/timezone/Africa/Casablanca 0644 root root 1346 27095 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Ceuta 0644 root root 2049 1023 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Conakry 0644 root root 208 12712 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Dakar 0644 root root 194 10846 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Dar_es_Salaam 0644 root root 213 11094 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Djibouti 0644 root root 157 4878 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Douala 0644 root root 157 4570 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/El_Aaiun 0644 root root 194 10028 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Freetown 0644 root root 665 11978 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Gaborone 0644 root root 194 8500 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Harare 0644 root root 157 4391 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Johannesburg 0644 root root 245 14912 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Juba 0644 root root 669 33364 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Kampala 0644 root root 253 13934 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Khartoum 0644 root root 669 32854 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Kigali 0644 root root 157 4481 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Kinshasa 0644 root root 140 3539 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Lagos 0644 root root 157 4510 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Libreville 0644 root root 157 5080 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Lome 0644 root root 139 3391 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Luanda 0644 root root 178 6113 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Lubumbashi 0644 root root 140 3540 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Lusaka 0644 root root 157 4901 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Malabo 0644 root root 195 7532 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Maputo 0644 root root 157 4901 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Maseru 0644 root root 204 9670 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Mbabane 0644 root root 160 4690 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Mogadishu 0644 root root 194 9300 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Monrovia 0644 root root 215 12455 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Nairobi 0644 root root 253 14654 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Ndjamena 0644 root root 211 6812 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Niamey 0644 root root 225 11818 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Nouakchott 0644 root root 208 13432 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Ouagadougou 0644 root root 156 6494 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Porto-Novo 0644 root root 195 7382 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Sao_Tome 0644 root root 173 7551 1347419306 1 l none /usr/local/share/postgresql/timezone/Africa/Timbuktu=/usr/local/share/postgresql/timezone/Africa/Bamako 1 l none /usr/local/share/postgresql/timezone/Africa/Tripoli=/usr/local/share/postgresql/timezone/Libya 1 f none /usr/local/share/postgresql/timezone/Africa/Tunis 0644 root root 684 51500 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Windhoek 0644 root root 1556 23610 1347419306 1 d none /usr/local/share/postgresql/timezone/America 0755 root root 1 l none /usr/local/share/postgresql/timezone/America/Adak=/usr/local/share/postgresql/timezone/America/Atka 1 f none /usr/local/share/postgresql/timezone/America/Anchorage 0644 root root 2358 26983 1347419306 1 f none /usr/local/share/postgresql/timezone/America/Anguilla 0644 root root 156 7400 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Antigua 0644 root root 194 11842 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Araguaina 0644 root root 854 15298 1347419307 1 d none /usr/local/share/postgresql/timezone/America/Argentina 0755 root root 1 l none /usr/local/share/postgresql/timezone/America/Argentina/Buenos_Aires=/usr/local/share/postgresql/timezone/America/Buenos_Aires 1 l none /usr/local/share/postgresql/timezone/America/Argentina/Catamarca=/usr/local/share/postgresql/timezone/America/Catamarca 1 l none /usr/local/share/postgresql/timezone/America/Argentina/ComodRivadavia=/usr/local/share/postgresql/timezone/America/Catamarca 1 l none /usr/local/share/postgresql/timezone/America/Argentina/Cordoba=/usr/local/share/postgresql/timezone/America/Rosario 1 l none /usr/local/share/postgresql/timezone/America/Argentina/Jujuy=/usr/local/share/postgresql/timezone/America/Jujuy 1 f none /usr/local/share/postgresql/timezone/America/Argentina/La_Rioja 0644 root root 1101 60325 1347419307 1 l none /usr/local/share/postgresql/timezone/America/Argentina/Mendoza=/usr/local/share/postgresql/timezone/America/Mendoza 1 f none /usr/local/share/postgresql/timezone/America/Argentina/Rio_Gallegos 0644 root root 1087 59772 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Argentina/Salta 0644 root root 1059 58025 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Argentina/San_Juan 0644 root root 1101 60070 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Argentina/San_Luis 0644 root root 1125 64168 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Argentina/Tucuman 0644 root root 1115 62329 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Argentina/Ushuaia 0644 root root 1087 59697 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Aruba 0644 root root 194 11764 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Asuncion 0644 root root 2020 2515 1347419307 1 l none /usr/local/share/postgresql/timezone/America/Atikokan=/usr/local/share/postgresql/timezone/America/Coral_Harbour 1 f none /usr/local/share/postgresql/timezone/America/Atka 0644 root root 2353 31091 1347419306 1 f none /usr/local/share/postgresql/timezone/America/Bahia 0644 root root 1777 8238 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Bahia_Banderas 0644 root root 1558 44889 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Barbados 0644 root root 330 21178 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Belem 0644 root root 574 63873 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Belize 0644 root root 962 59845 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Blanc-Sablon 0644 root root 281 24420 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Boa_Vista 0644 root root 630 2799 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Bogota 0644 root root 231 13834 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Boise 0644 root root 2377 27205 1347419306 1 f none /usr/local/share/postgresql/timezone/America/Buenos_Aires 0644 root root 1061 57344 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Cambridge_Bay 0644 root root 2052 714 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Campo_Grande 0644 root root 2001 26193 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Cancun 0644 root root 1450 32355 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Caracas 0644 root root 224 14676 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Catamarca 0644 root root 1087 59834 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Cayenne 0644 root root 186 12292 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Cayman 0644 root root 177 9618 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Chicago 0644 root root 3543 26898 1347419306 1 f none /usr/local/share/postgresql/timezone/America/Chihuahua 0644 root root 1492 29758 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Coral_Harbour 0644 root root 319 28726 1347419307 1 l none /usr/local/share/postgresql/timezone/America/Cordoba=/usr/local/share/postgresql/timezone/America/Rosario 1 f none /usr/local/share/postgresql/timezone/America/Costa_Rica 0644 root root 315 18724 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Creston 0644 root root 191 12056 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Cuiaba 0644 root root 1973 24593 1347419307 1 l none /usr/local/share/postgresql/timezone/America/Curacao=/usr/local/share/postgresql/timezone/America/Lower_Princes 1 f none /usr/local/share/postgresql/timezone/America/Danmarkshavn 0644 root root 700 40484 1347419306 1 f none /usr/local/share/postgresql/timezone/America/Dawson 0644 root root 2067 10138 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Dawson_Creek 0644 root root 1033 62916 1347419307 1 l none /usr/local/share/postgresql/timezone/America/Denver=/usr/local/share/postgresql/timezone/America/Shiprock 1 f none /usr/local/share/postgresql/timezone/America/Detroit 0644 root root 2202 32128 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Dominica 0644 root root 156 7640 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Edmonton 0644 root root 2388 36832 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Eirunepe 0644 root root 640 4331 1347419307 1 f none /usr/local/share/postgresql/timezone/America/El_Salvador 0644 root root 236 13512 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Ensenada 0644 root root 2342 44117 1347419307 1 l none /usr/local/share/postgresql/timezone/America/Fort_Wayne=/usr/local/share/postgresql/timezone/America/Indiana/Indianapolis 1 f none /usr/local/share/postgresql/timezone/America/Fortaleza 0644 root root 714 7958 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Glace_Bay 0644 root root 2192 25601 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Godthab 0644 root root 8296 56379 1347419306 1 f none /usr/local/share/postgresql/timezone/America/Goose_Bay 0644 root root 3177 44944 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Grand_Turk 0644 root root 1871 63699 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Grenada 0644 root root 156 7520 1347419307 1 l none /usr/local/share/postgresql/timezone/America/Guadeloupe=/usr/local/share/postgresql/timezone/America/Marigot 1 f none /usr/local/share/postgresql/timezone/America/Guatemala 0644 root root 292 17312 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Guayaquil 0644 root root 177 9717 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Guyana 0644 root root 256 17404 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Halifax 0644 root root 3424 16864 1347419307 1 l none /usr/local/share/postgresql/timezone/America/Havana=/usr/local/share/postgresql/timezone/Cuba 1 f none /usr/local/share/postgresql/timezone/America/Hermosillo 0644 root root 424 34895 1347419307 1 d none /usr/local/share/postgresql/timezone/America/Indiana 0755 root root 1 f none /usr/local/share/postgresql/timezone/America/Indiana/Indianapolis 0644 root root 1649 27497 1347419306 1 f none /usr/local/share/postgresql/timezone/America/Indiana/Knox 0644 root root 2395 16709 1347419306 1 f none /usr/local/share/postgresql/timezone/America/Indiana/Marengo 0644 root root 1705 23078 1347419306 1 f none /usr/local/share/postgresql/timezone/America/Indiana/Petersburg 0644 root root 1887 44898 1347419306 1 f none /usr/local/share/postgresql/timezone/America/Indiana/Tell_City 0644 root root 1677 27456 1347419306 1 f none /usr/local/share/postgresql/timezone/America/Indiana/Vevay 0644 root root 1397 48217 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Indiana/Vincennes 0644 root root 1677 32576 1347419306 1 f none /usr/local/share/postgresql/timezone/America/Indiana/Winamac 0644 root root 1761 46389 1347419307 1 l none /usr/local/share/postgresql/timezone/America/Indianapolis=/usr/local/share/postgresql/timezone/America/Indiana/Indianapolis 1 f none /usr/local/share/postgresql/timezone/America/Inuvik 0644 root root 1914 49021 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Iqaluit 0644 root root 2000 13720 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Jamaica 0644 root root 481 28533 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Jujuy 0644 root root 1087 61777 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Juneau 0644 root root 2336 21616 1347419306 1 d none /usr/local/share/postgresql/timezone/America/Kentucky 0755 root root 1 f none /usr/local/share/postgresql/timezone/America/Kentucky/Louisville 0644 root root 2755 47219 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Kentucky/Monticello 0644 root root 2335 38401 1347419307 1 l none /usr/local/share/postgresql/timezone/America/Knox_IN=/usr/local/share/postgresql/timezone/America/Indiana/Knox 1 l none /usr/local/share/postgresql/timezone/America/Kralendijk=/usr/local/share/postgresql/timezone/America/Lower_Princes 1 f none /usr/local/share/postgresql/timezone/America/La_Paz 0644 root root 217 14860 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Lima 0644 root root 395 32150 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Los_Angeles 0644 root root 2819 38311 1347419306 1 l none /usr/local/share/postgresql/timezone/America/Louisville=/usr/local/share/postgresql/timezone/America/Kentucky/Louisville 1 f none /usr/local/share/postgresql/timezone/America/Lower_Princes 0644 root root 194 11764 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Maceio 0644 root root 742 9288 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Managua 0644 root root 421 25986 1347419307 1 l none /usr/local/share/postgresql/timezone/America/Manaus=/usr/local/share/postgresql/timezone/Brazil/West 1 f none /usr/local/share/postgresql/timezone/America/Marigot 0644 root root 156 8060 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Martinique 0644 root root 231 14095 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Matamoros 0644 root root 1402 25394 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Mazatlan 0644 root root 1534 35102 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Mendoza 0644 root root 1115 63114 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Menominee 0644 root root 2241 28442 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Merida 0644 root root 1426 28217 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Metlakatla 0644 root root 717 44064 1347419306 1 f none /usr/local/share/postgresql/timezone/America/Mexico_City 0644 root root 1604 58057 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Miquelon 0644 root root 1670 44401 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Moncton 0644 root root 3137 47231 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Monterrey 0644 root root 1402 26265 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Montevideo 0644 root root 2118 63039 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Montreal 0644 root root 3477 38312 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Montserrat 0644 root root 156 7640 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Nassau 0644 root root 2270 40966 1347419307 1 f none /usr/local/share/postgresql/timezone/America/New_York 0644 root root 3519 46774 1347419306 1 f none /usr/local/share/postgresql/timezone/America/Nipigon 0644 root root 2105 22275 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Nome 0644 root root 2350 28432 1347419306 1 l none /usr/local/share/postgresql/timezone/America/Noronha=/usr/local/share/postgresql/timezone/Brazil/DeNoronha 1 d none /usr/local/share/postgresql/timezone/America/North_Dakota 0755 root root 1 f none /usr/local/share/postgresql/timezone/America/North_Dakota/Beulah 0644 root root 2363 27674 1347419306 1 f none /usr/local/share/postgresql/timezone/America/North_Dakota/Center 0644 root root 2363 30762 1347419306 1 f none /usr/local/share/postgresql/timezone/America/North_Dakota/New_Salem 0644 root root 2363 28564 1347419306 1 f none /usr/local/share/postgresql/timezone/America/Ojinaga 0644 root root 1492 33615 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Panama 0644 root root 177 10127 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Pangnirtung 0644 root root 2062 22092 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Paramaribo 0644 root root 294 21242 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Phoenix 0644 root root 327 31330 1347419306 1 f none /usr/local/share/postgresql/timezone/America/Port-au-Prince 0644 root root 739 47005 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Port_of_Spain 0644 root root 156 7400 1347419307 1 l none /usr/local/share/postgresql/timezone/America/Porto_Acre=/usr/local/share/postgresql/timezone/Brazil/Acre 1 f none /usr/local/share/postgresql/timezone/America/Porto_Velho 0644 root root 574 63874 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Puerto_Rico 0644 root root 229 17996 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Rainy_River 0644 root root 2105 12146 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Rankin_Inlet 0644 root root 1900 58156 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Recife 0644 root root 714 8078 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Regina 0644 root root 980 62715 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Resolute 0644 root root 1900 58640 1347419307 1 l none /usr/local/share/postgresql/timezone/America/Rio_Branco=/usr/local/share/postgresql/timezone/Brazil/Acre 1 f none /usr/local/share/postgresql/timezone/America/Rosario 0644 root root 1087 60145 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Santa_Isabel 0644 root root 2342 40052 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Santarem 0644 root root 612 1408 1347419307 1 l none /usr/local/share/postgresql/timezone/America/Santiago=/usr/local/share/postgresql/timezone/Chile/Continental 1 f none /usr/local/share/postgresql/timezone/America/Santo_Domingo 0644 root root 463 34891 1347419307 1 l none /usr/local/share/postgresql/timezone/America/Sao_Paulo=/usr/local/share/postgresql/timezone/Brazil/East 1 f none /usr/local/share/postgresql/timezone/America/Scoresbysund 0644 root root 1911 49060 1347419306 1 f none /usr/local/share/postgresql/timezone/America/Shiprock 0644 root root 2427 36179 1347419306 1 f none /usr/local/share/postgresql/timezone/America/Sitka 0644 root root 2324 20130 1347419306 1 l none /usr/local/share/postgresql/timezone/America/St_Barthelemy=/usr/local/share/postgresql/timezone/America/Marigot 1 f none /usr/local/share/postgresql/timezone/America/St_Johns 0644 root root 3622 48012 1347419307 1 f none /usr/local/share/postgresql/timezone/America/St_Kitts 0644 root root 156 7400 1347419307 1 f none /usr/local/share/postgresql/timezone/America/St_Lucia 0644 root root 177 10909 1347419307 1 l none /usr/local/share/postgresql/timezone/America/St_Thomas=/usr/local/share/postgresql/timezone/America/Virgin 1 f none /usr/local/share/postgresql/timezone/America/St_Vincent 0644 root root 177 10925 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Swift_Current 0644 root root 560 60208 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Tegucigalpa 0644 root root 264 15502 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Thule 0644 root root 1514 37722 1347419306 1 f none /usr/local/share/postgresql/timezone/America/Thunder_Bay 0644 root root 2185 26584 1347419307 1 l none /usr/local/share/postgresql/timezone/America/Tijuana=/usr/local/share/postgresql/timezone/America/Ensenada 1 f none /usr/local/share/postgresql/timezone/America/Toronto 0644 root root 3477 35777 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Tortola 0644 root root 156 7520 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Vancouver 0644 root root 2875 45893 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Virgin 0644 root root 156 7520 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Whitehorse 0644 root root 2067 11400 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Winnipeg 0644 root root 2865 43735 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Yakutat 0644 root root 2288 18405 1347419306 1 f none /usr/local/share/postgresql/timezone/America/Yellowknife 0644 root root 1966 56841 1347419307 1 d none /usr/local/share/postgresql/timezone/Antarctica 0755 root root 1 f none /usr/local/share/postgresql/timezone/Antarctica/Casey 0644 root root 255 10901 1347419306 1 f none /usr/local/share/postgresql/timezone/Antarctica/Davis 0644 root root 276 13837 1347419306 1 f none /usr/local/share/postgresql/timezone/Antarctica/DumontDUrville 0644 root root 213 10559 1347419306 1 f none /usr/local/share/postgresql/timezone/Antarctica/Macquarie 0644 root root 1549 28221 1347419306 1 f none /usr/local/share/postgresql/timezone/Antarctica/Mawson 0644 root root 190 6045 1347419306 1 l none /usr/local/share/postgresql/timezone/Antarctica/McMurdo=/usr/local/share/postgresql/timezone/Antarctica/South_Pole 1 f none /usr/local/share/postgresql/timezone/Antarctica/Palmer 0644 root root 8780 8000 1347419306 1 f none /usr/local/share/postgresql/timezone/Antarctica/Rothera 0644 root root 159 4676 1347419306 1 f none /usr/local/share/postgresql/timezone/Antarctica/South_Pole 0644 root root 2001 440 1347419306 1 f none /usr/local/share/postgresql/timezone/Antarctica/Syowa 0644 root root 160 4949 1347419306 1 f none /usr/local/share/postgresql/timezone/Antarctica/Vostok 0644 root root 160 5303 1347419306 1 d none /usr/local/share/postgresql/timezone/Arctic 0755 root root 1 l none /usr/local/share/postgresql/timezone/Arctic/Longyearbyen=/usr/local/share/postgresql/timezone/Atlantic/Jan_Mayen 1 d none /usr/local/share/postgresql/timezone/Asia 0755 root root 1 f none /usr/local/share/postgresql/timezone/Asia/Aden 0644 root root 157 4470 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Almaty 0644 root root 922 51675 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Amman 0644 root root 8504 1317 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Anadyr 0644 root root 1167 3739 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Aqtau 0644 root root 1112 60574 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Aqtobe 0644 root root 1038 55520 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Ashgabat 0644 root root 657 32693 1347419306 1 l none /usr/local/share/postgresql/timezone/Asia/Ashkhabad=/usr/local/share/postgresql/timezone/Asia/Ashgabat 1 f none /usr/local/share/postgresql/timezone/Asia/Baghdad 0644 root root 962 49998 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Bahrain 0644 root root 195 6572 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Baku 0644 root root 1942 41162 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Bangkok 0644 root root 178 7056 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Beirut 0644 root root 2149 31718 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Bishkek 0644 root root 1047 56925 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Brunei 0644 root root 187 7515 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Calcutta 0644 root root 265 15172 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Choibalsan 0644 root root 890 48551 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Chongqing 0644 root root 389 16521 1347419306 1 l none /usr/local/share/postgresql/timezone/Asia/Chungking=/usr/local/share/postgresql/timezone/Asia/Chongqing 1 f none /usr/local/share/postgresql/timezone/Asia/Colombo 0644 root root 347 17779 1347419306 1 l none /usr/local/share/postgresql/timezone/Asia/Dacca=/usr/local/share/postgresql/timezone/Asia/Dhaka 1 f none /usr/local/share/postgresql/timezone/Asia/Damascus 0644 root root 2306 42956 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Dhaka 0644 root root 364 20219 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Dili 0644 root root 277 14380 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Dubai 0644 root root 157 5449 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Dushanbe 0644 root root 597 30470 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Gaza 0644 root root 1562 8330 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Harbin 0644 root root 447 24821 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Hebron 0644 root root 1590 9332 1347419306 1 l none /usr/local/share/postgresql/timezone/Asia/Ho_Chi_Minh=/usr/local/share/postgresql/timezone/Asia/Saigon 1 f none /usr/local/share/postgresql/timezone/Asia/Hong_Kong 0644 root root 1159 3228 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Hovd 0644 root root 834 42789 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Irkutsk 0644 root root 1187 1658 1347419306 1 l none /usr/local/share/postgresql/timezone/Asia/Istanbul=/usr/local/share/postgresql/timezone/Turkey 1 f none /usr/local/share/postgresql/timezone/Asia/Jakarta 0644 root root 344 23265 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Jayapura 0644 root root 209 11510 1347419306 1 l none /usr/local/share/postgresql/timezone/Asia/Jerusalem=/usr/local/share/postgresql/timezone/Asia/Tel_Aviv 1 f none /usr/local/share/postgresql/timezone/Asia/Kabul 0644 root root 173 6935 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Kamchatka 0644 root root 1151 3578 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Karachi 0644 root root 389 21593 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Kashgar 0644 root root 419 18469 1347419306 1 l none /usr/local/share/postgresql/timezone/Asia/Kathmandu=/usr/local/share/postgresql/timezone/Asia/Katmandu 1 f none /usr/local/share/postgresql/timezone/Asia/Katmandu 0644 root root 198 7371 1347419306 1 l none /usr/local/share/postgresql/timezone/Asia/Kolkata=/usr/local/share/postgresql/timezone/Asia/Calcutta 1 f none /usr/local/share/postgresql/timezone/Asia/Krasnoyarsk 0644 root root 1166 64951 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Kuala_Lumpur 0644 root root 372 22800 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Kuching 0644 root root 505 46305 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Kuwait 0644 root root 157 4980 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Macao 0644 root root 781 62419 1347419306 1 l none /usr/local/share/postgresql/timezone/Asia/Macau=/usr/local/share/postgresql/timezone/Asia/Macao 1 f none /usr/local/share/postgresql/timezone/Asia/Magadan 0644 root root 1167 4334 1347419306 1 l none /usr/local/share/postgresql/timezone/Asia/Makassar=/usr/local/share/postgresql/timezone/Asia/Ujung_Pandang 1 f none /usr/local/share/postgresql/timezone/Asia/Manila 0644 root root 319 23444 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Muscat 0644 root root 157 5449 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Nicosia 0644 root root 2002 52702 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Novokuznetsk 0644 root root 1220 1920 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Novosibirsk 0644 root root 1180 2412 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Omsk 0644 root root 1166 1960 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Oral 0644 root root 1086 58276 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Phnom_Penh 0644 root root 239 12906 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Pontianak 0644 root root 359 22984 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Pyongyang 0644 root root 242 16670 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Qatar 0644 root root 195 6572 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Qyzylorda 0644 root root 1068 57571 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Rangoon 0644 root root 259 14324 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Riyadh 0644 root root 157 4980 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Riyadh87 0644 root root 8669 45903 1347419307 1 f none /usr/local/share/postgresql/timezone/Asia/Riyadh88 0644 root root 8523 42059 1347419307 1 f none /usr/local/share/postgresql/timezone/Asia/Riyadh89 0644 root root 8523 41415 1347419307 1 f none /usr/local/share/postgresql/timezone/Asia/Saigon 0644 root root 239 12906 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Sakhalin 0644 root root 1197 3067 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Samarkand 0644 root root 677 34551 1347419306 1 l none /usr/local/share/postgresql/timezone/Asia/Seoul=/usr/local/share/postgresql/timezone/ROK 1 l none /usr/local/share/postgresql/timezone/Asia/Shanghai=/usr/local/share/postgresql/timezone/PRC 1 f none /usr/local/share/postgresql/timezone/Asia/Singapore 0644 root root 402 25591 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Taipei 0644 root root 724 21200 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Tashkent 0644 root root 667 33929 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Tbilisi 0644 root root 1100 58787 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Tehran 0644 root root 1622 35051 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Tel_Aviv 0644 root root 2197 52191 1347419306 1 l none /usr/local/share/postgresql/timezone/Asia/Thimbu=/usr/local/share/postgresql/timezone/Asia/Thimphu 1 f none /usr/local/share/postgresql/timezone/Asia/Thimphu 0644 root root 195 6525 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Tokyo 0644 root root 331 28605 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Ujung_Pandang 0644 root root 247 14413 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Ulaanbaatar 0644 root root 834 44805 1347419306 1 l none /usr/local/share/postgresql/timezone/Asia/Ulan_Bator=/usr/local/share/postgresql/timezone/Asia/Ulaanbaatar 1 f none /usr/local/share/postgresql/timezone/Asia/Urumqi 0644 root root 389 16049 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Vientiane 0644 root root 239 12906 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Vladivostok 0644 root root 1181 62618 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Yakutsk 0644 root root 1167 63467 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Yekaterinburg 0644 root root 1252 5653 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Yerevan 0644 root root 1263 5768 1347419306 1 d none /usr/local/share/postgresql/timezone/Atlantic 0755 root root 1 f none /usr/local/share/postgresql/timezone/Atlantic/Azores 0644 root root 3462 11487 1347419306 1 f none /usr/local/share/postgresql/timezone/Atlantic/Bermuda 0644 root root 1990 1965 1347419307 1 f none /usr/local/share/postgresql/timezone/Atlantic/Canary 0644 root root 1899 45340 1347419306 1 f none /usr/local/share/postgresql/timezone/Atlantic/Cape_Verde 0644 root root 240 17456 1347419306 1 f none /usr/local/share/postgresql/timezone/Atlantic/Faeroe 0644 root root 1815 38838 1347419306 1 l none /usr/local/share/postgresql/timezone/Atlantic/Faroe=/usr/local/share/postgresql/timezone/Atlantic/Faeroe 1 f none /usr/local/share/postgresql/timezone/Atlantic/Jan_Mayen 0644 root root 2225 22171 1347419306 1 f none /usr/local/share/postgresql/timezone/Atlantic/Madeira 0644 root root 3452 1316 1347419306 1 f none /usr/local/share/postgresql/timezone/Atlantic/Reykjavik 0644 root root 1141 18180 1347419306 1 f none /usr/local/share/postgresql/timezone/Atlantic/South_Georgia 0644 root root 139 6459 1347419307 1 f none /usr/local/share/postgresql/timezone/Atlantic/St_Helena 0644 root root 177 8952 1347419306 1 f none /usr/local/share/postgresql/timezone/Atlantic/Stanley 0644 root root 1204 27019 1347419307 1 d none /usr/local/share/postgresql/timezone/Australia 0755 root root 1 f none /usr/local/share/postgresql/timezone/Australia/ACT 0644 root root 2183 64415 1347419306 1 l none /usr/local/share/postgresql/timezone/Australia/Adelaide=/usr/local/share/postgresql/timezone/Australia/South 1 f none /usr/local/share/postgresql/timezone/Australia/Brisbane 0644 root root 413 28218 1347419306 1 f none /usr/local/share/postgresql/timezone/Australia/Broken_Hill 0644 root root 2237 5034 1347419306 1 l none /usr/local/share/postgresql/timezone/Australia/Canberra=/usr/local/share/postgresql/timezone/Australia/ACT 1 f none /usr/local/share/postgresql/timezone/Australia/Currie 0644 root root 2183 62119 1347419306 1 l none /usr/local/share/postgresql/timezone/Australia/Darwin=/usr/local/share/postgresql/timezone/Australia/North 1 f none /usr/local/share/postgresql/timezone/Australia/Eucla 0644 root root 446 25452 1347419306 1 f none /usr/local/share/postgresql/timezone/Australia/Hobart 0644 root root 2295 8958 1347419306 1 f none /usr/local/share/postgresql/timezone/Australia/LHI 0644 root root 1821 59909 1347419306 1 f none /usr/local/share/postgresql/timezone/Australia/Lindeman 0644 root root 483 33220 1347419306 1 l none /usr/local/share/postgresql/timezone/Australia/Lord_Howe=/usr/local/share/postgresql/timezone/Australia/LHI 1 l none /usr/local/share/postgresql/timezone/Australia/Melbourne=/usr/local/share/postgresql/timezone/Australia/Victoria 1 l none /usr/local/share/postgresql/timezone/Australia/NSW=/usr/local/share/postgresql/timezone/Australia/ACT 1 f none /usr/local/share/postgresql/timezone/Australia/North 0644 root root 288 23683 1347419306 1 l none /usr/local/share/postgresql/timezone/Australia/Perth=/usr/local/share/postgresql/timezone/Australia/West 1 l none /usr/local/share/postgresql/timezone/Australia/Queensland=/usr/local/share/postgresql/timezone/Australia/Brisbane 1 f none /usr/local/share/postgresql/timezone/Australia/South 0644 root root 2202 956 1347419306 1 l none /usr/local/share/postgresql/timezone/Australia/Sydney=/usr/local/share/postgresql/timezone/Australia/ACT 1 l none /usr/local/share/postgresql/timezone/Australia/Tasmania=/usr/local/share/postgresql/timezone/Australia/Hobart 1 f none /usr/local/share/postgresql/timezone/Australia/Victoria 0644 root root 2183 63395 1347419306 1 f none /usr/local/share/postgresql/timezone/Australia/West 0644 root root 440 28776 1347419306 1 l none /usr/local/share/postgresql/timezone/Australia/Yancowinna=/usr/local/share/postgresql/timezone/Australia/Broken_Hill 1 d none /usr/local/share/postgresql/timezone/Brazil 0755 root root 1 f none /usr/local/share/postgresql/timezone/Brazil/Acre 0644 root root 612 2401 1347419307 1 f none /usr/local/share/postgresql/timezone/Brazil/DeNoronha 0644 root root 714 6427 1347419307 1 f none /usr/local/share/postgresql/timezone/Brazil/East 0644 root root 2001 22898 1347419307 1 f none /usr/local/share/postgresql/timezone/Brazil/West 0644 root root 602 149 1347419307 1 f none /usr/local/share/postgresql/timezone/CET 0644 root root 2102 3261 1347419306 1 f none /usr/local/share/postgresql/timezone/CST6CDT 0644 root root 2294 30587 1347419306 1 d none /usr/local/share/postgresql/timezone/Canada 0755 root root 1 l none /usr/local/share/postgresql/timezone/Canada/Atlantic=/usr/local/share/postgresql/timezone/America/Halifax 1 l none /usr/local/share/postgresql/timezone/Canada/Central=/usr/local/share/postgresql/timezone/America/Winnipeg 1 l none /usr/local/share/postgresql/timezone/Canada/East-Saskatchewan=/usr/local/share/postgresql/timezone/America/Regina 1 l none /usr/local/share/postgresql/timezone/Canada/Eastern=/usr/local/share/postgresql/timezone/America/Toronto 1 l none /usr/local/share/postgresql/timezone/Canada/Mountain=/usr/local/share/postgresql/timezone/America/Edmonton 1 l none /usr/local/share/postgresql/timezone/Canada/Newfoundland=/usr/local/share/postgresql/timezone/America/St_Johns 1 l none /usr/local/share/postgresql/timezone/Canada/Pacific=/usr/local/share/postgresql/timezone/America/Vancouver 1 l none /usr/local/share/postgresql/timezone/Canada/Saskatchewan=/usr/local/share/postgresql/timezone/America/Regina 1 l none /usr/local/share/postgresql/timezone/Canada/Yukon=/usr/local/share/postgresql/timezone/America/Whitehorse 1 d none /usr/local/share/postgresql/timezone/Chile 0755 root root 1 f none /usr/local/share/postgresql/timezone/Chile/Continental 0644 root root 9245 52728 1347419307 1 f none /usr/local/share/postgresql/timezone/Chile/EasterIsland 0644 root root 9007 15424 1347419307 1 f none /usr/local/share/postgresql/timezone/Cuba 0644 root root 2411 62017 1347419307 1 f none /usr/local/share/postgresql/timezone/EET 0644 root root 1876 39332 1347419306 1 f none /usr/local/share/postgresql/timezone/EST 0644 root root 118 3399 1347419306 1 f none /usr/local/share/postgresql/timezone/EST5EDT 0644 root root 2294 44916 1347419306 1 f none /usr/local/share/postgresql/timezone/Egypt 0644 root root 1906 36864 1347419306 1 f none /usr/local/share/postgresql/timezone/Eire 0644 root root 3533 62255 1347419306 1 d none /usr/local/share/postgresql/timezone/Etc 0755 root root 1 l none /usr/local/share/postgresql/timezone/Etc/GMT=/usr/local/share/postgresql/timezone/GMT 1 l none /usr/local/share/postgresql/timezone/Etc/GMT+0=/usr/local/share/postgresql/timezone/GMT 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+1 0644 root root 126 4025 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+10 0644 root root 130 3679 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+11 0644 root root 130 3623 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+12 0644 root root 130 3567 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+2 0644 root root 126 3969 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+3 0644 root root 126 3913 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+4 0644 root root 126 3857 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+5 0644 root root 126 3801 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+6 0644 root root 126 3745 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+7 0644 root root 126 3689 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+8 0644 root root 126 3633 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+9 0644 root root 126 3577 1347419307 1 l none /usr/local/share/postgresql/timezone/Etc/GMT-0=/usr/local/share/postgresql/timezone/GMT 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-1 0644 root root 127 2154 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-10 0644 root root 131 2888 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-11 0644 root root 131 2952 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-12 0644 root root 131 3016 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-13 0644 root root 131 3080 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-14 0644 root root 131 3144 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-2 0644 root root 127 2218 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-3 0644 root root 127 2282 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-4 0644 root root 127 2346 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-5 0644 root root 127 2410 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-6 0644 root root 127 2474 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-7 0644 root root 127 2538 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-8 0644 root root 127 2602 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-9 0644 root root 127 2666 1347419307 1 l none /usr/local/share/postgresql/timezone/Etc/GMT0=/usr/local/share/postgresql/timezone/GMT 1 l none /usr/local/share/postgresql/timezone/Etc/Greenwich=/usr/local/share/postgresql/timezone/GMT 1 l none /usr/local/share/postgresql/timezone/Etc/UCT=/usr/local/share/postgresql/timezone/UCT 1 l none /usr/local/share/postgresql/timezone/Etc/UTC=/usr/local/share/postgresql/timezone/UTC 1 l none /usr/local/share/postgresql/timezone/Etc/Universal=/usr/local/share/postgresql/timezone/UTC 1 l none /usr/local/share/postgresql/timezone/Etc/Zulu=/usr/local/share/postgresql/timezone/UTC 1 d none /usr/local/share/postgresql/timezone/Europe 0755 root root 1 f none /usr/local/share/postgresql/timezone/Europe/Amsterdam 0644 root root 2917 37182 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Andorra 0644 root root 1725 31329 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Athens 0644 root root 2245 8903 1347419306 1 l none /usr/local/share/postgresql/timezone/Europe/Belfast=/usr/local/share/postgresql/timezone/GB-Eire 1 l none /usr/local/share/postgresql/timezone/Europe/Belgrade=/usr/local/share/postgresql/timezone/Europe/Sarajevo 1 f none /usr/local/share/postgresql/timezone/Europe/Berlin 0644 root root 2309 31972 1347419306 1 l none /usr/local/share/postgresql/timezone/Europe/Bratislava=/usr/local/share/postgresql/timezone/Europe/Prague 1 f none /usr/local/share/postgresql/timezone/Europe/Brussels 0644 root root 2944 49652 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Bucharest 0644 root root 2195 15951 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Budapest 0644 root root 2407 54508 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Chisinau 0644 root root 2407 39520 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Copenhagen 0644 root root 2134 9516 1347419306 1 l none /usr/local/share/postgresql/timezone/Europe/Dublin=/usr/local/share/postgresql/timezone/Eire 1 f none /usr/local/share/postgresql/timezone/Europe/Gibraltar 0644 root root 3035 21375 1347419306 1 l none /usr/local/share/postgresql/timezone/Europe/Guernsey=/usr/local/share/postgresql/timezone/GB-Eire 1 l none /usr/local/share/postgresql/timezone/Europe/Helsinki=/usr/local/share/postgresql/timezone/Europe/Mariehamn 1 l none /usr/local/share/postgresql/timezone/Europe/Isle_of_Man=/usr/local/share/postgresql/timezone/GB-Eire 1 l none /usr/local/share/postgresql/timezone/Europe/Istanbul=/usr/local/share/postgresql/timezone/Turkey 1 l none /usr/local/share/postgresql/timezone/Europe/Jersey=/usr/local/share/postgresql/timezone/GB-Eire 1 f none /usr/local/share/postgresql/timezone/Europe/Kaliningrad 0644 root root 1494 30053 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Kiev 0644 root root 2057 60272 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Lisbon 0644 root root 3439 3130 1347419306 1 l none /usr/local/share/postgresql/timezone/Europe/Ljubljana=/usr/local/share/postgresql/timezone/Europe/Sarajevo 1 l none /usr/local/share/postgresql/timezone/Europe/London=/usr/local/share/postgresql/timezone/GB-Eire 1 f none /usr/local/share/postgresql/timezone/Europe/Luxembourg 0644 root root 2960 43302 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Madrid 0644 root root 2593 362 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Malta 0644 root root 2603 61829 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Mariehamn 0644 root root 1883 44323 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Minsk 0644 root root 1328 11431 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Monaco 0644 root root 2927 49386 1347419306 1 l none /usr/local/share/postgresql/timezone/Europe/Moscow=/usr/local/share/postgresql/timezone/W-SU 1 l none /usr/local/share/postgresql/timezone/Europe/Nicosia=/usr/local/share/postgresql/timezone/Asia/Nicosia 1 l none /usr/local/share/postgresql/timezone/Europe/Oslo=/usr/local/share/postgresql/timezone/Atlantic/Jan_Mayen 1 f none /usr/local/share/postgresql/timezone/Europe/Paris 0644 root root 2945 47644 1347419306 1 l none /usr/local/share/postgresql/timezone/Europe/Podgorica=/usr/local/share/postgresql/timezone/Europe/Sarajevo 1 f none /usr/local/share/postgresql/timezone/Europe/Prague 0644 root root 2246 22587 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Riga 0644 root root 2209 9765 1347419306 1 l none /usr/local/share/postgresql/timezone/Europe/Rome=/usr/local/share/postgresql/timezone/Europe/San_Marino 1 f none /usr/local/share/postgresql/timezone/Europe/Samara 0644 root root 1314 6977 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/San_Marino 0644 root root 2652 3498 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Sarajevo 0644 root root 1931 52265 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Simferopol 0644 root root 2113 64622 1347419306 1 l none /usr/local/share/postgresql/timezone/Europe/Skopje=/usr/local/share/postgresql/timezone/Europe/Sarajevo 1 f none /usr/local/share/postgresql/timezone/Europe/Sofia 0644 root root 2104 59048 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Stockholm 0644 root root 1892 44662 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Tallinn 0644 root root 2175 4402 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Tirane 0644 root root 2084 58136 1347419306 1 l none /usr/local/share/postgresql/timezone/Europe/Tiraspol=/usr/local/share/postgresql/timezone/Europe/Chisinau 1 f none /usr/local/share/postgresql/timezone/Europe/Uzhgorod 0644 root root 2077 63323 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Vaduz 0644 root root 1799 36441 1347419306 1 l none /usr/local/share/postgresql/timezone/Europe/Vatican=/usr/local/share/postgresql/timezone/Europe/San_Marino 1 f none /usr/local/share/postgresql/timezone/Europe/Vienna 0644 root root 2211 22045 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Vilnius 0644 root root 2173 2489 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Volgograd 0644 root root 1218 8567 1347419306 1 l none /usr/local/share/postgresql/timezone/Europe/Warsaw=/usr/local/share/postgresql/timezone/Poland 1 l none /usr/local/share/postgresql/timezone/Europe/Zagreb=/usr/local/share/postgresql/timezone/Europe/Sarajevo 1 f none /usr/local/share/postgresql/timezone/Europe/Zaporozhye 0644 root root 2085 62452 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Zurich 0644 root root 1892 46454 1347419306 1 f none /usr/local/share/postgresql/timezone/Factory 0644 root root 255 14338 1347419307 1 l none /usr/local/share/postgresql/timezone/GB=/usr/local/share/postgresql/timezone/GB-Eire 1 f none /usr/local/share/postgresql/timezone/GB-Eire 0644 root root 3661 21636 1347419306 1 f none /usr/local/share/postgresql/timezone/GMT 0644 root root 118 1640 1347419307 1 l none /usr/local/share/postgresql/timezone/GMT+0=/usr/local/share/postgresql/timezone/GMT 1 l none /usr/local/share/postgresql/timezone/GMT-0=/usr/local/share/postgresql/timezone/GMT 1 l none /usr/local/share/postgresql/timezone/GMT0=/usr/local/share/postgresql/timezone/GMT 1 l none /usr/local/share/postgresql/timezone/Greenwich=/usr/local/share/postgresql/timezone/GMT 1 f none /usr/local/share/postgresql/timezone/HST 0644 root root 119 3152 1347419306 1 l none /usr/local/share/postgresql/timezone/Hongkong=/usr/local/share/postgresql/timezone/Asia/Hong_Kong 1 l none /usr/local/share/postgresql/timezone/Iceland=/usr/local/share/postgresql/timezone/Atlantic/Reykjavik 1 d none /usr/local/share/postgresql/timezone/Indian 0755 root root 1 f none /usr/local/share/postgresql/timezone/Indian/Antananarivo 0644 root root 227 11130 1347419306 1 f none /usr/local/share/postgresql/timezone/Indian/Chagos 0644 root root 187 7175 1347419306 1 f none /usr/local/share/postgresql/timezone/Indian/Christmas 0644 root root 140 4064 1347419306 1 f none /usr/local/share/postgresql/timezone/Indian/Cocos 0644 root root 143 4187 1347419306 1 f none /usr/local/share/postgresql/timezone/Indian/Comoro 0644 root root 157 5388 1347419306 1 f none /usr/local/share/postgresql/timezone/Indian/Kerguelen 0644 root root 157 4868 1347419306 1 f none /usr/local/share/postgresql/timezone/Indian/Mahe 0644 root root 157 5257 1347419306 1 f none /usr/local/share/postgresql/timezone/Indian/Maldives 0644 root root 178 7445 1347419306 1 f none /usr/local/share/postgresql/timezone/Indian/Mauritius 0644 root root 239 9549 1347419306 1 f none /usr/local/share/postgresql/timezone/Indian/Mayotte 0644 root root 157 4878 1347419306 1 f none /usr/local/share/postgresql/timezone/Indian/Reunion 0644 root root 157 4630 1347419306 1 l none /usr/local/share/postgresql/timezone/Iran=/usr/local/share/postgresql/timezone/Asia/Tehran 1 l none /usr/local/share/postgresql/timezone/Israel=/usr/local/share/postgresql/timezone/Asia/Tel_Aviv 1 l none /usr/local/share/postgresql/timezone/Jamaica=/usr/local/share/postgresql/timezone/America/Jamaica 1 l none /usr/local/share/postgresql/timezone/Japan=/usr/local/share/postgresql/timezone/Asia/Tokyo 1 f none /usr/local/share/postgresql/timezone/Kwajalein 0644 root root 211 10091 1347419306 1 f none /usr/local/share/postgresql/timezone/Libya 0644 root root 599 40497 1347419306 1 f none /usr/local/share/postgresql/timezone/MET 0644 root root 2102 3321 1347419306 1 f none /usr/local/share/postgresql/timezone/MST 0644 root root 118 3305 1347419306 1 f none /usr/local/share/postgresql/timezone/MST7MDT 0644 root root 2294 17398 1347419306 1 d none /usr/local/share/postgresql/timezone/Mexico 0755 root root 1 l none /usr/local/share/postgresql/timezone/Mexico/BajaNorte=/usr/local/share/postgresql/timezone/America/Ensenada 1 l none /usr/local/share/postgresql/timezone/Mexico/BajaSur=/usr/local/share/postgresql/timezone/America/Mazatlan 1 l none /usr/local/share/postgresql/timezone/Mexico/General=/usr/local/share/postgresql/timezone/America/Mexico_City 1 d none /usr/local/share/postgresql/timezone/Mideast 0755 root root 1 l none /usr/local/share/postgresql/timezone/Mideast/Riyadh87=/usr/local/share/postgresql/timezone/Asia/Riyadh87 1 l none /usr/local/share/postgresql/timezone/Mideast/Riyadh88=/usr/local/share/postgresql/timezone/Asia/Riyadh88 1 l none /usr/local/share/postgresql/timezone/Mideast/Riyadh89=/usr/local/share/postgresql/timezone/Asia/Riyadh89 1 f none /usr/local/share/postgresql/timezone/NZ 0644 root root 2434 2200 1347419306 1 f none /usr/local/share/postgresql/timezone/NZ-CHAT 0644 root root 2018 1082 1347419306 1 l none /usr/local/share/postgresql/timezone/Navajo=/usr/local/share/postgresql/timezone/America/Shiprock 1 f none /usr/local/share/postgresql/timezone/PRC 0644 root root 405 23461 1347419306 1 f none /usr/local/share/postgresql/timezone/PST8PDT 0644 root root 2294 21479 1347419306 1 d none /usr/local/share/postgresql/timezone/Pacific 0755 root root 1 f none /usr/local/share/postgresql/timezone/Pacific/Apia 0644 root root 343 21401 1347419306 1 l none /usr/local/share/postgresql/timezone/Pacific/Auckland=/usr/local/share/postgresql/timezone/NZ 1 l none /usr/local/share/postgresql/timezone/Pacific/Chatham=/usr/local/share/postgresql/timezone/NZ-CHAT 1 f none /usr/local/share/postgresql/timezone/Pacific/Chuuk 0644 root root 144 4450 1347419306 1 l none /usr/local/share/postgresql/timezone/Pacific/Easter=/usr/local/share/postgresql/timezone/Chile/EasterIsland 1 f none /usr/local/share/postgresql/timezone/Pacific/Efate 0644 root root 464 25170 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Enderbury 0644 root root 204 8981 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Fakaofo 0644 root root 171 7664 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Fiji 0644 root root 324 16016 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Funafuti 0644 root root 141 4408 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Galapagos 0644 root root 197 10384 1347419307 1 f none /usr/local/share/postgresql/timezone/Pacific/Gambier 0644 root root 159 7002 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Guadalcanal 0644 root root 158 5540 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Guam 0644 root root 199 8566 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Honolulu 0644 root root 250 18837 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Johnston 0644 root root 119 3152 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Kiritimati 0644 root root 204 9030 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Kosrae 0644 root root 188 8020 1347419306 1 l none /usr/local/share/postgresql/timezone/Pacific/Kwajalein=/usr/local/share/postgresql/timezone/Kwajalein 1 f none /usr/local/share/postgresql/timezone/Pacific/Majuro 0644 root root 171 7032 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Marquesas 0644 root root 162 7162 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Midway 0644 root root 268 18659 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Nauru 0644 root root 240 12212 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Niue 0644 root root 200 11102 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Norfolk 0644 root root 182 7889 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Noumea 0644 root root 300 13682 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Pago_Pago 0644 root root 290 19545 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Palau 0644 root root 140 4177 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Pitcairn 0644 root root 177 8089 1347419306 1 l none /usr/local/share/postgresql/timezone/Pacific/Pohnpei=/usr/local/share/postgresql/timezone/Pacific/Ponape 1 f none /usr/local/share/postgresql/timezone/Pacific/Ponape 0644 root root 144 4550 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Port_Moresby 0644 root root 163 6758 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Rarotonga 0644 root root 548 28554 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Saipan 0644 root root 229 11262 1347419306 1 l none /usr/local/share/postgresql/timezone/Pacific/Samoa=/usr/local/share/postgresql/timezone/Pacific/Pago_Pago 1 f none /usr/local/share/postgresql/timezone/Pacific/Tahiti 0644 root root 160 7516 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Tarawa 0644 root root 144 4560 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Tongatapu 0644 root root 313 15767 1347419306 1 l none /usr/local/share/postgresql/timezone/Pacific/Truk=/usr/local/share/postgresql/timezone/Pacific/Chuuk 1 f none /usr/local/share/postgresql/timezone/Pacific/Wake 0644 root root 144 4581 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Wallis 0644 root root 141 4369 1347419306 1 l none /usr/local/share/postgresql/timezone/Pacific/Yap=/usr/local/share/postgresql/timezone/Pacific/Chuuk 1 f none /usr/local/share/postgresql/timezone/Poland 0644 root root 2679 6024 1347419306 1 l none /usr/local/share/postgresql/timezone/Portugal=/usr/local/share/postgresql/timezone/Europe/Lisbon 1 l none /usr/local/share/postgresql/timezone/ROC=/usr/local/share/postgresql/timezone/Asia/Taipei 1 f none /usr/local/share/postgresql/timezone/ROK 0644 root root 380 27686 1347419306 1 l none /usr/local/share/postgresql/timezone/Singapore=/usr/local/share/postgresql/timezone/Asia/Singapore 1 f none /usr/local/share/postgresql/timezone/Turkey 0644 root root 2721 11692 1347419306 1 f none /usr/local/share/postgresql/timezone/UCT 0644 root root 118 1652 1347419307 1 d none /usr/local/share/postgresql/timezone/US 0755 root root 1 l none /usr/local/share/postgresql/timezone/US/Alaska=/usr/local/share/postgresql/timezone/America/Anchorage 1 l none /usr/local/share/postgresql/timezone/US/Aleutian=/usr/local/share/postgresql/timezone/America/Atka 1 l none /usr/local/share/postgresql/timezone/US/Arizona=/usr/local/share/postgresql/timezone/America/Phoenix 1 l none /usr/local/share/postgresql/timezone/US/Central=/usr/local/share/postgresql/timezone/America/Chicago 1 l none /usr/local/share/postgresql/timezone/US/East-Indiana=/usr/local/share/postgresql/timezone/America/Indiana/Indianapolis 1 l none /usr/local/share/postgresql/timezone/US/Eastern=/usr/local/share/postgresql/timezone/America/New_York 1 l none /usr/local/share/postgresql/timezone/US/Hawaii=/usr/local/share/postgresql/timezone/Pacific/Honolulu 1 l none /usr/local/share/postgresql/timezone/US/Indiana-Starke=/usr/local/share/postgresql/timezone/America/Indiana/Knox 1 l none /usr/local/share/postgresql/timezone/US/Michigan=/usr/local/share/postgresql/timezone/America/Detroit 1 l none /usr/local/share/postgresql/timezone/US/Mountain=/usr/local/share/postgresql/timezone/America/Shiprock 1 l none /usr/local/share/postgresql/timezone/US/Pacific=/usr/local/share/postgresql/timezone/America/Los_Angeles 1 l none /usr/local/share/postgresql/timezone/US/Pacific-New=/usr/local/share/postgresql/timezone/America/Los_Angeles 1 l none /usr/local/share/postgresql/timezone/US/Samoa=/usr/local/share/postgresql/timezone/Pacific/Pago_Pago 1 f none /usr/local/share/postgresql/timezone/UTC 0644 root root 118 1652 1347419307 1 l none /usr/local/share/postgresql/timezone/Universal=/usr/local/share/postgresql/timezone/UTC 1 f none /usr/local/share/postgresql/timezone/W-SU 0644 root root 1448 32492 1347419306 1 f none /usr/local/share/postgresql/timezone/WET 0644 root root 1873 39052 1347419306 1 l none /usr/local/share/postgresql/timezone/Zulu=/usr/local/share/postgresql/timezone/UTC 1 l none /usr/local/share/postgresql/timezone/posixrules=/usr/local/share/postgresql/timezone/America/New_York 1 d none /usr/local/share/postgresql/timezonesets 0755 root root 1 f none /usr/local/share/postgresql/timezonesets/Africa.txt 0644 root root 6973 6439 1347419307 1 f none /usr/local/share/postgresql/timezonesets/America.txt 0644 root root 12717 22411 1347419307 1 f none /usr/local/share/postgresql/timezonesets/Antarctica.txt 0644 root root 1478 34571 1347419307 1 f none /usr/local/share/postgresql/timezonesets/Asia.txt 0644 root root 9509 5304 1347419307 1 f none /usr/local/share/postgresql/timezonesets/Atlantic.txt 0644 root root 3774 43117 1347419307 1 f none /usr/local/share/postgresql/timezonesets/Australia 0644 root root 1404 38525 1347419307 1 f none /usr/local/share/postgresql/timezonesets/Australia.txt 0644 root root 2782 9096 1347419307 1 f none /usr/local/share/postgresql/timezonesets/Default 0644 root root 29620 49534 1347419307 1 f none /usr/local/share/postgresql/timezonesets/Etc.txt 0644 root root 1241 12088 1347419307 1 f none /usr/local/share/postgresql/timezonesets/Europe.txt 0644 root root 8301 24059 1347419307 1 f none /usr/local/share/postgresql/timezonesets/India 0644 root root 593 50003 1347419307 1 f none /usr/local/share/postgresql/timezonesets/Indian.txt 0644 root root 1566 37344 1347419307 1 f none /usr/local/share/postgresql/timezonesets/Pacific.txt 0644 root root 4150 8407 1347419307 1 d none /usr/local/share/postgresql/tsearch_data 0755 root root 1 f none /usr/local/share/postgresql/tsearch_data/danish.stop 0644 root root 424 37100 1347419308 1 f none /usr/local/share/postgresql/tsearch_data/dutch.stop 0644 root root 453 38763 1347419308 1 f none /usr/local/share/postgresql/tsearch_data/english.stop 0644 root root 622 54931 1347419308 1 f none /usr/local/share/postgresql/tsearch_data/finnish.stop 0644 root root 1579 33237 1347419308 1 f none /usr/local/share/postgresql/tsearch_data/french.stop 0644 root root 805 10912 1347419308 1 f none /usr/local/share/postgresql/tsearch_data/german.stop 0644 root root 1349 57331 1347419308 1 f none /usr/local/share/postgresql/tsearch_data/hungarian.stop 0644 root root 1227 57949 1347419309 1 f none /usr/local/share/postgresql/tsearch_data/hunspell_sample.affix 0644 root root 244 13989 1347419307 1 f none /usr/local/share/postgresql/tsearch_data/ispell_sample.affix 0644 root root 465 31429 1347419307 1 f none /usr/local/share/postgresql/tsearch_data/ispell_sample.dict 0644 root root 81 7108 1347419307 1 f none /usr/local/share/postgresql/tsearch_data/italian.stop 0644 root root 1654 20806 1347419309 1 f none /usr/local/share/postgresql/tsearch_data/norwegian.stop 0644 root root 851 11364 1347419309 1 f none /usr/local/share/postgresql/tsearch_data/portuguese.stop 0644 root root 1267 57350 1347419309 1 f none /usr/local/share/postgresql/tsearch_data/russian.stop 0644 root root 1235 9585 1347419309 1 f none /usr/local/share/postgresql/tsearch_data/spanish.stop 0644 root root 2178 21152 1347419309 1 f none /usr/local/share/postgresql/tsearch_data/swedish.stop 0644 root root 559 52354 1347419309 1 f none /usr/local/share/postgresql/tsearch_data/synonym_sample.syn 0644 root root 73 6890 1347419307 1 f none /usr/local/share/postgresql/tsearch_data/thesaurus_sample.ths 0644 root root 473 41646 1347419307 1 f none /usr/local/share/postgresql/tsearch_data/turkish.stop 0644 root root 260 25287 1347419309 1 f none /usr/local/share/postgresql/tsearch_data/unaccent.rules 0644 root root 937 22169 1347419313 1 f none /usr/local/share/postgresql/tsearch_data/xsyn_sample.rules 0644 root root 139 12006 1347419311 1 f none /usr/local/share/postgresql/unknown.pltcl 0644 root root 2406 25686 1347419310 1 i checkinstall 790 2505 1347428601 1 i pkginfo 301 24276 1347428448 07070100000000000000000000000000000000000000010000000000000000000000000000000000000000000000000000000b00000000TRAILER!!!0707010001f5ca000081a4000000000000000000000001505020600000012d000000b600010002ffffffffffffffff0000000800000000pkginfoPKG=postgresql NAME=postgresql 9.2.0 i86pc Solaris 11 VERSION=9.2.0 PSTAMP=12th September 2012 VENDOR=PostgreSQL Global Development Group EMAIL=http://www.postgresql.org/ DESC=Open source object-relational database ARCH=i386 CATEGORY=utility CLASSES=none BASEDIR=/ ISTATES=S s 1 2 3 RSTATES=S s 1 2 3 0707010001f5c9000081a4000000000000000000000001505020600004678b000000b600010002ffffffffffffffff0000000700000000pkgmap: 1 91012 1 d none /usr ? ? ? 1 d none /usr/local ? ? ? 1 d none /usr/local/bin 0755 root root 1 f none /usr/local/bin/clusterdb 0755 root root 69572 38379 1347419310 1 f none /usr/local/bin/createdb 0755 root root 70144 35330 1347419310 1 f none /usr/local/bin/createlang 0755 root root 77888 17038 1347419310 1 f none /usr/local/bin/createuser 0755 root root 71784 56793 1347419310 1 f none /usr/local/bin/dropdb 0755 root root 68120 64433 1347419310 1 f none /usr/local/bin/droplang 0755 root root 77712 51068 1347419310 1 f none /usr/local/bin/dropuser 0755 root root 68096 52169 1347419310 1 f none /usr/local/bin/ecpg 0755 root root 804888 28600 1347419309 1 f none /usr/local/bin/initdb 0755 root root 114800 43427 1347419309 1 f none /usr/local/bin/oid2name 0755 root root 33936 43038 1347419312 1 f none /usr/local/bin/pg_archivecleanup 0755 root root 26396 48401 1347419312 1 f none /usr/local/bin/pg_basebackup 0755 root root 73244 34855 1347419310 1 f none /usr/local/bin/pg_config 0755 root root 34472 26103 1347419310 1 f none /usr/local/bin/pg_controldata 0755 root root 33672 45277 1347419310 1 f none /usr/local/bin/pg_ctl 0755 root root 47828 24391 1347419310 1 f none /usr/local/bin/pg_dump 0755 root root 359344 63794 1347419310 1 f none /usr/local/bin/pg_dumpall 0755 root root 91032 55133 1347419310 1 f none /usr/local/bin/pg_receivexlog 0755 root root 52804 63601 1347419310 1 f none /usr/local/bin/pg_resetxlog 0755 root root 44592 29225 1347419310 1 f none /usr/local/bin/pg_restore 0755 root root 162028 4236 1347419310 1 f none /usr/local/bin/pg_standby 0755 root root 34356 14497 1347419312 1 f none /usr/local/bin/pg_test_fsync 0755 root root 27748 26489 1347419312 1 f none /usr/local/bin/pg_test_timing 0755 root root 21820 23324 1347419312 1 f none /usr/local/bin/pg_upgrade 0755 root root 140704 33346 1347419312 1 f none /usr/local/bin/pgbench 0755 root root 65688 13962 1347419312 1 f none /usr/local/bin/pltcl_delmod 0755 root root 2219 44861 1347419310 1 f none /usr/local/bin/pltcl_listmod 0755 root root 2377 56553 1347419310 1 f none /usr/local/bin/pltcl_loadmod 0755 root root 11455 4231 1347419310 1 f none /usr/local/bin/postgres 0755 root root 6729156 32263 1347419307 1 s none /usr/local/bin/postmaster=postgres 1 f none /usr/local/bin/psql 0755 root root 486960 35237 1347419310 1 f none /usr/local/bin/reindexdb 0755 root root 70944 50321 1347419310 1 f none /usr/local/bin/vacuumdb 0755 root root 42388 42712 1347419310 1 f none /usr/local/bin/vacuumlo 0755 root root 33656 19108 1347419313 1 d none /usr/local/include 0755 root root 1 f none /usr/local/include/ecpg_config.h 0644 root root 714 57266 1347419309 1 f none /usr/local/include/ecpg_informix.h 0644 root root 2758 29110 1347419309 1 f none /usr/local/include/ecpgerrno.h 0644 root root 2540 60981 1347419309 1 f none /usr/local/include/ecpglib.h 0644 root root 2601 15719 1347419309 1 f none /usr/local/include/ecpgtype.h 0644 root root 2621 18076 1347419309 1 d none /usr/local/include/libpq 0755 root root 1 f none /usr/local/include/libpq-events.h 0644 root root 2211 49429 1347419309 1 f none /usr/local/include/libpq-fe.h 0644 root root 20649 29784 1347419309 1 f none /usr/local/include/libpq/libpq-fs.h 0644 root root 633 44679 1347419309 1 f none /usr/local/include/pg_config.h 0644 root root 26297 4763 1347419309 1 f none /usr/local/include/pg_config_manual.h 0644 root root 9261 50041 1347419309 1 f none /usr/local/include/pg_config_os.h 0644 root root 1041 19956 1347419309 1 f none /usr/local/include/pgtypes_date.h 0644 root root 766 65439 1347419309 1 f none /usr/local/include/pgtypes_error.h 0644 root root 530 39306 1347419309 1 f none /usr/local/include/pgtypes_interval.h 0644 root root 1143 28859 1347419309 1 f none /usr/local/include/pgtypes_numeric.h 0644 root root 2227 44302 1347419309 1 f none /usr/local/include/pgtypes_timestamp.h 0644 root root 1010 23484 1347419309 1 f none /usr/local/include/postgres_ext.h 0644 root root 1778 8903 1347419309 1 d none /usr/local/include/postgresql 0755 root root 1 d none /usr/local/include/postgresql/informix 0755 root root 1 d none /usr/local/include/postgresql/informix/esql 0755 root root 1 f none /usr/local/include/postgresql/informix/esql/datetime.h 0644 root root 338 27003 1347419309 1 f none /usr/local/include/postgresql/informix/esql/decimal.h 0644 root root 301 23254 1347419309 1 f none /usr/local/include/postgresql/informix/esql/sqltypes.h 0644 root root 1435 45823 1347419309 1 d none /usr/local/include/postgresql/internal 0755 root root 1 f none /usr/local/include/postgresql/internal/c.h 0644 root root 24689 44709 1347419309 1 d none /usr/local/include/postgresql/internal/libpq 0755 root root 1 f none /usr/local/include/postgresql/internal/libpq-int.h 0644 root root 22813 53598 1347419309 1 f none /usr/local/include/postgresql/internal/libpq/pqcomm.h 0644 root root 5800 11746 1347419309 1 f none /usr/local/include/postgresql/internal/port.h 0644 root root 13841 61945 1347419309 1 f none /usr/local/include/postgresql/internal/postgres_fe.h 0644 root root 730 54063 1347419309 1 f none /usr/local/include/postgresql/internal/pqexpbuffer.h 0644 root root 6527 5186 1347419309 1 d none /usr/local/include/postgresql/server 0755 root root 1 d none /usr/local/include/postgresql/server/access 0755 root root 1 f none /usr/local/include/postgresql/server/access/attnum.h 0644 root root 1553 56964 1347419309 1 f none /usr/local/include/postgresql/server/access/clog.h 0644 root root 1508 62296 1347419309 1 f none /usr/local/include/postgresql/server/access/genam.h 0644 root root 7470 58296 1347419309 1 f none /usr/local/include/postgresql/server/access/gin.h 0644 root root 1664 65164 1347419309 1 f none /usr/local/include/postgresql/server/access/gin_private.h 0644 root root 23313 11499 1347419309 1 f none /usr/local/include/postgresql/server/access/gist.h 0644 root root 5562 59338 1347419309 1 f none /usr/local/include/postgresql/server/access/gist_private.h 0644 root root 18682 60890 1347419309 1 f none /usr/local/include/postgresql/server/access/gistscan.h 0644 root root 718 53420 1347419309 1 f none /usr/local/include/postgresql/server/access/hash.h 0644 root root 13177 63527 1347419309 1 f none /usr/local/include/postgresql/server/access/heapam.h 0644 root root 6344 29310 1347419309 1 f none /usr/local/include/postgresql/server/access/hio.h 0644 root root 1280 35802 1347419309 1 f none /usr/local/include/postgresql/server/access/htup.h 0644 root root 32708 34557 1347419309 1 f none /usr/local/include/postgresql/server/access/itup.h 0644 root root 4404 25058 1347419309 1 f none /usr/local/include/postgresql/server/access/multixact.h 0644 root root 2810 46471 1347419309 1 f none /usr/local/include/postgresql/server/access/nbtree.h 0644 root root 27906 5562 1347419309 1 f none /usr/local/include/postgresql/server/access/printtup.h 0644 root root 1051 18880 1347419309 1 f none /usr/local/include/postgresql/server/access/reloptions.h 0644 root root 8813 55753 1347419309 1 f none /usr/local/include/postgresql/server/access/relscan.h 0644 root root 4168 17731 1347419309 1 f none /usr/local/include/postgresql/server/access/rewriteheap.h 0644 root root 1016 16149 1347419309 1 f none /usr/local/include/postgresql/server/access/rmgr.h 0644 root root 804 58096 1347419309 1 f none /usr/local/include/postgresql/server/access/sdir.h 0644 root root 1466 50616 1347419309 1 f none /usr/local/include/postgresql/server/access/skey.h 0644 root root 7033 60969 1347419309 1 f none /usr/local/include/postgresql/server/access/slru.h 0644 root root 5278 46117 1347419309 1 f none /usr/local/include/postgresql/server/access/spgist.h 0644 root root 6391 59800 1347419309 1 f none /usr/local/include/postgresql/server/access/spgist_private.h 0644 root root 22659 43385 1347419309 1 f none /usr/local/include/postgresql/server/access/subtrans.h 0644 root root 973 19627 1347419309 1 f none /usr/local/include/postgresql/server/access/sysattr.h 0644 root root 891 2124 1347419309 1 f none /usr/local/include/postgresql/server/access/transam.h 0644 root root 6161 59536 1347419309 1 f none /usr/local/include/postgresql/server/access/tupconvert.h 0644 root root 1287 37028 1347419309 1 f none /usr/local/include/postgresql/server/access/tupdesc.h 0644 root root 4241 32279 1347419309 1 f none /usr/local/include/postgresql/server/access/tupmacs.h 0644 root root 7326 56488 1347419309 1 f none /usr/local/include/postgresql/server/access/tuptoaster.h 0644 root root 5821 13150 1347419309 1 f none /usr/local/include/postgresql/server/access/twophase.h 0644 root root 1716 15073 1347419309 1 f none /usr/local/include/postgresql/server/access/twophase_rmgr.h 0644 root root 1272 34879 1347419309 1 f none /usr/local/include/postgresql/server/access/valid.h 0644 root root 1437 37032 1347419309 1 f none /usr/local/include/postgresql/server/access/visibilitymap.h 0644 root root 1178 30998 1347419309 1 f none /usr/local/include/postgresql/server/access/xact.h 0644 root root 8646 13793 1347419309 1 f none /usr/local/include/postgresql/server/access/xlog.h 0644 root root 12301 61077 1347419309 1 f none /usr/local/include/postgresql/server/access/xlog_internal.h 0644 root root 9567 7477 1347419309 1 f none /usr/local/include/postgresql/server/access/xlogdefs.h 0644 root root 4597 41837 1347419309 1 f none /usr/local/include/postgresql/server/access/xlogutils.h 0644 root root 956 18495 1347419309 1 d none /usr/local/include/postgresql/server/bootstrap 0755 root root 1 f none /usr/local/include/postgresql/server/bootstrap/bootstrap.h 0644 root root 1573 61655 1347419309 1 f none /usr/local/include/postgresql/server/c.h 0644 root root 24689 44709 1347419309 1 d none /usr/local/include/postgresql/server/catalog 0755 root root 1 f none /usr/local/include/postgresql/server/catalog/catalog.h 0644 root root 2099 42876 1347419309 1 f none /usr/local/include/postgresql/server/catalog/catversion.h 0644 root root 2586 22604 1347419309 1 f none /usr/local/include/postgresql/server/catalog/dependency.h 0644 root root 9669 16852 1347419309 1 f none /usr/local/include/postgresql/server/catalog/genbki.h 0644 root root 1794 14046 1347419309 1 f none /usr/local/include/postgresql/server/catalog/heap.h 0644 root root 3899 57913 1347419309 1 f none /usr/local/include/postgresql/server/catalog/index.h 0644 root root 2845 28723 1347419309 1 f none /usr/local/include/postgresql/server/catalog/indexing.h 0644 root root 16686 18284 1347419309 1 f none /usr/local/include/postgresql/server/catalog/namespace.h 0644 root root 5769 42170 1347419309 1 f none /usr/local/include/postgresql/server/catalog/objectaccess.h 0644 root root 1654 1004 1347419309 1 f none /usr/local/include/postgresql/server/catalog/objectaddress.h 0644 root root 1236 31185 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_aggregate.h 0644 root root 10609 43944 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_am.h 0644 root root 5941 33137 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_amop.h 0644 root root 25108 20608 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_amproc.h 0644 root root 14345 10564 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_attrdef.h 0644 root root 1670 63088 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_attribute.h 0644 root root 6949 55282 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_auth_members.h 0644 root root 1791 8636 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_authid.h 0644 root root 3270 3767 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_cast.h 0644 root root 11759 13768 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_class.h 0644 root root 6070 18629 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_collation.h 0644 root root 2284 43221 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_collation_fn.h 0644 root root 735 55497 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_constraint.h 0644 root root 8149 17531 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_control.h 0644 root root 8166 24816 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_conversion.h 0644 root root 2175 38551 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_conversion_fn.h 0644 root root 833 64411 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_database.h 0644 root root 2689 16061 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_db_role_setting.h 0644 root root 2008 28577 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_default_acl.h 0644 root root 2150 33859 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_depend.h 0644 root root 2796 27834 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_description.h 0644 root root 2985 46833 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_enum.h 0644 root root 1859 12008 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_extension.h 0644 root root 2136 37516 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_foreign_data_wrapper.h 0644 root root 2066 35018 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_foreign_server.h 0644 root root 1914 21633 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_foreign_table.h 0644 root root 1628 60303 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_index.h 0644 root root 3421 14992 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_inherits.h 0644 root root 1499 47948 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_inherits_fn.h 0644 root root 850 822 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_language.h 0644 root root 2442 57657 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_largeobject.h 0644 root root 1829 12311 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_largeobject_metadata.h 0644 root root 1714 4788 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_namespace.h 0644 root root 2282 40965 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_opclass.h 0644 root root 11699 44490 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_operator.h 0644 root root 98031 1469 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_opfamily.h 0644 root root 6493 63238 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_pltemplate.h 0644 root root 3185 64381 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_proc.h 0644 root root 461504 12506 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_proc_fn.h 0644 root root 1169 23528 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_range.h 0644 root root 2595 4977 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_rewrite.h 0644 root root 1893 18512 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_seclabel.h 0644 root root 1363 37456 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_shdepend.h 0644 root root 2815 28366 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_shdescription.h 0644 root root 2444 64232 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_shseclabel.h 0644 root root 1343 36227 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_statistic.h 0644 root root 11373 57274 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_tablespace.h 0644 root root 1891 14850 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_trigger.h 0644 root root 5746 56772 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_ts_config.h 0644 root root 1645 59783 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_ts_config_map.h 0644 root root 2334 38328 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_ts_dict.h 0644 root root 1822 9954 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_ts_parser.h 0644 root root 1993 26851 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_ts_template.h 0644 root root 2152 40685 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_type.h 0644 root root 42313 24492 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_type_fn.h 0644 root root 2126 30879 1347419309 1 f none /usr/local/include/postgresql/server/catalog/pg_user_mapping.h 0644 root root 1624 60121 1347419309 1 f none /usr/local/include/postgresql/server/catalog/schemapg.h 0644 root root 16154 34939 1347419309 1 f none /usr/local/include/postgresql/server/catalog/storage.h 0644 root root 1366 48541 1347419309 1 f none /usr/local/include/postgresql/server/catalog/toasting.h 0644 root root 1954 25184 1347419309 1 d none /usr/local/include/postgresql/server/commands 0755 root root 1 f none /usr/local/include/postgresql/server/commands/alter.h 0644 root root 942 8016 1347419309 1 f none /usr/local/include/postgresql/server/commands/async.h 0644 root root 1832 23595 1347419309 1 f none /usr/local/include/postgresql/server/commands/cluster.h 0644 root root 1167 27997 1347419309 1 f none /usr/local/include/postgresql/server/commands/collationcmds.h 0644 root root 919 7441 1347419309 1 f none /usr/local/include/postgresql/server/commands/comment.h 0644 root root 1364 38947 1347419309 1 f none /usr/local/include/postgresql/server/commands/conversioncmds.h 0644 root root 941 10217 1347419309 1 f none /usr/local/include/postgresql/server/commands/copy.h 0644 root root 1241 35297 1347419309 1 f none /usr/local/include/postgresql/server/commands/createas.h 0644 root root 801 61384 1347419309 1 f none /usr/local/include/postgresql/server/commands/dbcommands.h 0644 root root 2117 44688 1347419309 1 f none /usr/local/include/postgresql/server/commands/defrem.h 0644 root root 7701 31234 1347419309 1 f none /usr/local/include/postgresql/server/commands/discard.h 0644 root root 471 32118 1347419309 1 f none /usr/local/include/postgresql/server/commands/explain.h 0644 root root 2994 49722 1347419309 1 f none /usr/local/include/postgresql/server/commands/extension.h 0644 root root 1566 779 1347419309 1 f none /usr/local/include/postgresql/server/commands/lockcmds.h 0644 root root 559 39242 1347419309 1 f none /usr/local/include/postgresql/server/commands/portalcmds.h 0644 root root 896 4600 1347419309 1 f none /usr/local/include/postgresql/server/commands/prepare.h 0644 root root 2078 41852 1347419309 1 f none /usr/local/include/postgresql/server/commands/proclang.h 0644 root root 784 61944 1347419309 1 f none /usr/local/include/postgresql/server/commands/schemacmds.h 0644 root root 843 65332 1347419309 1 f none /usr/local/include/postgresql/server/commands/seclabel.h 0644 root root 970 16689 1347419309 1 f none /usr/local/include/postgresql/server/commands/sequence.h 0644 root root 1997 26269 1347419309 1 f none /usr/local/include/postgresql/server/commands/tablecmds.h 0644 root root 2339 735 1347419309 1 f none /usr/local/include/postgresql/server/commands/tablespace.h 0644 root root 1803 19133 1347419309 1 f none /usr/local/include/postgresql/server/commands/trigger.h 0644 root root 6780 25096 1347419309 1 f none /usr/local/include/postgresql/server/commands/typecmds.h 0644 root root 1917 30630 1347419309 1 f none /usr/local/include/postgresql/server/commands/user.h 0644 root root 1105 25135 1347419309 1 f none /usr/local/include/postgresql/server/commands/vacuum.h 0644 root root 6877 59395 1347419309 1 f none /usr/local/include/postgresql/server/commands/variable.h 0644 root root 1881 39127 1347419309 1 f none /usr/local/include/postgresql/server/commands/view.h 0644 root root 510 35677 1347419309 1 d none /usr/local/include/postgresql/server/datatype 0755 root root 1 f none /usr/local/include/postgresql/server/datatype/timestamp.h 0644 root root 5629 47604 1347419309 1 f none /usr/local/include/postgresql/server/dynloader.h 0644 root root 1053 15161 1347419309 1 d none /usr/local/include/postgresql/server/executor 0755 root root 1 f none /usr/local/include/postgresql/server/executor/execdebug.h 0644 root root 4426 64137 1347419309 1 f none /usr/local/include/postgresql/server/executor/execdesc.h 0644 root root 2384 61582 1347419309 1 f none /usr/local/include/postgresql/server/executor/executor.h 0644 root root 14798 50206 1347419309 1 f none /usr/local/include/postgresql/server/executor/functions.h 0644 root root 1150 26343 1347419309 1 f none /usr/local/include/postgresql/server/executor/hashjoin.h 0644 root root 7353 30831 1347419309 1 f none /usr/local/include/postgresql/server/executor/instrument.h 0644 root root 2857 37851 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeAgg.h 0644 root root 782 59303 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeAppend.h 0644 root root 701 52560 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeBitmapAnd.h 0644 root root 738 55773 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeBitmapHeapscan.h 0644 root root 813 62912 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeBitmapIndexscan.h 0644 root root 822 64009 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeBitmapOr.h 0644 root root 724 54721 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeCtescan.h 0644 root root 715 53646 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeForeignscan.h 0644 root root 771 59282 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeFunctionscan.h 0644 root root 785 60922 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeGroup.h 0644 root root 716 54291 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeHash.h 0644 root root 1926 27070 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeHashjoin.h 0644 root root 890 3738 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeIndexonlyscan.h 0644 root root 920 8044 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeIndexscan.h 0644 root root 1558 62898 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeLimit.h 0644 root root 687 51410 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeLockRows.h 0644 root root 729 55544 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeMaterial.h 0644 root root 838 54 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeMergeAppend.h 0644 root root 771 59120 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeMergejoin.h 0644 root root 743 56576 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeModifyTable.h 0644 root root 768 59148 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeNestloop.h 0644 root root 729 55608 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeRecursiveunion.h 0644 root root 813 64174 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeResult.h 0644 root root 802 62613 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeSeqscan.h 0644 root root 812 62745 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeSetOp.h 0644 root root 687 51226 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeSort.h 0644 root root 766 58935 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeSubplan.h 0644 root root 812 63210 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeSubqueryscan.h 0644 root root 785 61286 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeTidscan.h 0644 root root 812 62601 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeUnique.h 0644 root root 701 52994 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeValuesscan.h 0644 root root 866 2808 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeWindowAgg.h 0644 root root 776 59673 1347419309 1 f none /usr/local/include/postgresql/server/executor/nodeWorktablescan.h 0644 root root 799 61952 1347419309 1 f none /usr/local/include/postgresql/server/executor/spi.h 0644 root root 5543 6791 1347419309 1 f none /usr/local/include/postgresql/server/executor/spi_priv.h 0644 root root 3318 17303 1347419309 1 f none /usr/local/include/postgresql/server/executor/tstoreReceiver.h 0644 root root 767 57546 1347419309 1 f none /usr/local/include/postgresql/server/executor/tuptable.h 0644 root root 8591 32493 1347419309 1 f none /usr/local/include/postgresql/server/fmgr.h 0644 root root 30065 54957 1347419309 1 d none /usr/local/include/postgresql/server/foreign 0755 root root 1 f none /usr/local/include/postgresql/server/foreign/fdwapi.h 0644 root root 3083 51822 1347419309 1 f none /usr/local/include/postgresql/server/foreign/foreign.h 0644 root root 2606 12795 1347419309 1 f none /usr/local/include/postgresql/server/funcapi.h 0644 root root 10324 7657 1347419309 1 f none /usr/local/include/postgresql/server/getaddrinfo.h 0644 root root 3936 50846 1347419309 1 f none /usr/local/include/postgresql/server/getopt_long.h 0644 root root 827 2276 1347419309 1 d none /usr/local/include/postgresql/server/lib 0755 root root 1 f none /usr/local/include/postgresql/server/lib/dllist.h 0644 root root 2871 31329 1347419309 1 f none /usr/local/include/postgresql/server/lib/stringinfo.h 0644 root root 5489 56620 1347419309 1 d none /usr/local/include/postgresql/server/libpq 0755 root root 1 f none /usr/local/include/postgresql/server/libpq/auth.h 0644 root root 903 6942 1347419309 1 f none /usr/local/include/postgresql/server/libpq/be-fsstubs.h 0644 root root 1610 63743 1347419309 1 f none /usr/local/include/postgresql/server/libpq/crypt.h 0644 root root 550 39406 1347419309 1 f none /usr/local/include/postgresql/server/libpq/hba.h 0644 root root 1780 10147 1347419309 1 f none /usr/local/include/postgresql/server/libpq/ip.h 0644 root root 1704 5168 1347419309 1 f none /usr/local/include/postgresql/server/libpq/libpq-be.h 0644 root root 5584 61607 1347419309 1 f none /usr/local/include/postgresql/server/libpq/libpq-fs.h 0644 root root 633 44679 1347419309 1 f none /usr/local/include/postgresql/server/libpq/libpq.h 0644 root root 2453 10988 1347419309 1 f none /usr/local/include/postgresql/server/libpq/md5.h 0644 root root 901 2480 1347419309 1 f none /usr/local/include/postgresql/server/libpq/pqcomm.h 0644 root root 5800 11746 1347419309 1 f none /usr/local/include/postgresql/server/libpq/pqformat.h 0644 root root 1997 42679 1347419309 1 f none /usr/local/include/postgresql/server/libpq/pqsignal.h 0644 root root 1300 33631 1347419309 1 d none /usr/local/include/postgresql/server/mb 0755 root root 1 f none /usr/local/include/postgresql/server/mb/pg_wchar.h 0644 root root 17249 36233 1347419309 1 f none /usr/local/include/postgresql/server/miscadmin.h 0644 root root 15125 8175 1347419309 1 d none /usr/local/include/postgresql/server/nodes 0755 root root 1 f none /usr/local/include/postgresql/server/nodes/bitmapset.h 0644 root root 3440 28053 1347419309 1 f none /usr/local/include/postgresql/server/nodes/execnodes.h 0644 root root 66161 1017 1347419309 1 f none /usr/local/include/postgresql/server/nodes/makefuncs.h 0644 root root 2380 147 1347419309 1 f none /usr/local/include/postgresql/server/nodes/memnodes.h 0644 root root 2614 20900 1347419309 1 f none /usr/local/include/postgresql/server/nodes/nodeFuncs.h 0644 root root 2510 3312 1347419309 1 f none /usr/local/include/postgresql/server/nodes/nodes.h 0644 root root 13865 21195 1347419309 1 f none /usr/local/include/postgresql/server/nodes/params.h 0644 root root 3776 47449 1347419309 1 f none /usr/local/include/postgresql/server/nodes/parsenodes.h 0644 root root 88399 53169 1347419309 1 f none /usr/local/include/postgresql/server/nodes/pg_list.h 0644 root root 11367 37318 1347419309 1 f none /usr/local/include/postgresql/server/nodes/plannodes.h 0644 root root 28122 7204 1347419309 1 f none /usr/local/include/postgresql/server/nodes/primnodes.h 0644 root root 50383 64749 1347419309 1 f none /usr/local/include/postgresql/server/nodes/print.h 0644 root root 1070 21166 1347419309 1 f none /usr/local/include/postgresql/server/nodes/readfuncs.h 0644 root root 897 3910 1347419309 1 f none /usr/local/include/postgresql/server/nodes/relation.h 0644 root root 69030 9115 1347419309 1 f none /usr/local/include/postgresql/server/nodes/replnodes.h 0644 root root 1053 8745 1347419309 1 f none /usr/local/include/postgresql/server/nodes/tidbitmap.h 0644 root root 2238 54195 1347419309 1 f none /usr/local/include/postgresql/server/nodes/value.h 0644 root root 1798 10409 1347419309 1 d none /usr/local/include/postgresql/server/optimizer 0755 root root 1 f none /usr/local/include/postgresql/server/optimizer/clauses.h 0644 root root 2999 64034 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/cost.h 0644 root root 7502 46997 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/geqo.h 0644 root root 2173 34361 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/geqo_copy.h 0644 root root 966 2865 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/geqo_gene.h 0644 root root 1114 13818 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/geqo_misc.h 0644 root root 1124 15692 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/geqo_mutation.h 0644 root root 959 2185 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/geqo_pool.h 0644 root root 1317 35034 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/geqo_random.h 0644 root root 1312 31647 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/geqo_recombination.h 0644 root root 2644 13745 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/geqo_selection.h 0644 root root 1015 6141 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/joininfo.h 0644 root root 836 63227 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/pathnode.h 0644 root root 5513 62611 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/paths.h 0644 root root 6734 36713 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/placeholder.h 0644 root root 1233 35170 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/plancat.h 0644 root root 1691 3782 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/planmain.h 0644 root root 4974 30890 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/planner.h 0644 root root 1363 43470 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/predtest.h 0644 root root 668 49780 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/prep.h 0644 root root 1657 8058 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/restrictinfo.h 0644 root root 1754 13971 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/subselect.h 0644 root root 1417 49691 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/tlist.h 0644 root root 1594 3728 1347419309 1 f none /usr/local/include/postgresql/server/optimizer/var.h 0644 root root 1534 59450 1347419309 1 d none /usr/local/include/postgresql/server/parser 0755 root root 1 f none /usr/local/include/postgresql/server/parser/analyze.h 0644 root root 1465 54867 1347419309 1 f none /usr/local/include/postgresql/server/parser/gram.h 0644 root root 11350 22875 1347419309 1 f none /usr/local/include/postgresql/server/parser/gramparse.h 0644 root root 2149 44822 1347419309 1 f none /usr/local/include/postgresql/server/parser/keywords.h 0644 root root 1055 14503 1347419309 1 f none /usr/local/include/postgresql/server/parser/kwlist.h 0644 root root 20745 37109 1347419309 1 f none /usr/local/include/postgresql/server/parser/parse_agg.h 0644 root root 1152 23815 1347419309 1 f none /usr/local/include/postgresql/server/parser/parse_clause.h 0644 root root 1772 15441 1347419309 1 f none /usr/local/include/postgresql/server/parser/parse_coerce.h 0644 root root 3116 57264 1347419309 1 f none /usr/local/include/postgresql/server/parser/parse_collate.h 0644 root root 829 65444 1347419309 1 f none /usr/local/include/postgresql/server/parser/parse_cte.h 0644 root root 694 51806 1347419309 1 f none /usr/local/include/postgresql/server/parser/parse_expr.h 0644 root root 619 45566 1347419309 1 f none /usr/local/include/postgresql/server/parser/parse_func.h 0644 root root 2672 18426 1347419309 1 f none /usr/local/include/postgresql/server/parser/parse_node.h 0644 root root 6244 11590 1347419309 1 f none /usr/local/include/postgresql/server/parser/parse_oper.h 0644 root root 2497 9498 1347419309 1 f none /usr/local/include/postgresql/server/parser/parse_param.h 0644 root root 776 59320 1347419309 1 f none /usr/local/include/postgresql/server/parser/parse_relation.h 0644 root root 3544 24362 1347419309 1 f none /usr/local/include/postgresql/server/parser/parse_target.h 0644 root root 1425 48194 1347419309 1 f none /usr/local/include/postgresql/server/parser/parse_type.h 0644 root root 1710 11912 1347419309 1 f none /usr/local/include/postgresql/server/parser/parse_utilcmd.h 0644 root root 953 10432 1347419309 1 f none /usr/local/include/postgresql/server/parser/parser.h 0644 root root 1146 25345 1347419309 1 f none /usr/local/include/postgresql/server/parser/parsetree.h 0644 root root 2069 32621 1347419309 1 f none /usr/local/include/postgresql/server/parser/scanner.h 0644 root root 4199 25390 1347419309 1 f none /usr/local/include/postgresql/server/parser/scansup.h 0644 root root 752 57084 1347419309 1 f none /usr/local/include/postgresql/server/pg_config.h 0644 root root 26297 4763 1347419309 1 f none /usr/local/include/postgresql/server/pg_config_manual.h 0644 root root 9261 50041 1347419309 1 f none /usr/local/include/postgresql/server/pg_config_os.h 0644 root root 1041 19956 1347419309 1 f none /usr/local/include/postgresql/server/pg_trace.h 0644 root root 316 23828 1347419309 1 f none /usr/local/include/postgresql/server/pgstat.h 0644 root root 24463 41272 1347419309 1 f none /usr/local/include/postgresql/server/pgtime.h 0644 root root 2056 38441 1347419309 1 f none /usr/local/include/postgresql/server/plpgsql.h 0644 root root 26354 20318 1347419310 1 d none /usr/local/include/postgresql/server/port 0755 root root 1 f none /usr/local/include/postgresql/server/port.h 0644 root root 13841 61945 1347419309 1 f none /usr/local/include/postgresql/server/port/aix.h 0644 root root 82 6256 1347419309 1 f none /usr/local/include/postgresql/server/port/cygwin.h 0644 root root 436 35069 1347419309 1 f none /usr/local/include/postgresql/server/port/darwin.h 0644 root root 157 12088 1347419309 1 f none /usr/local/include/postgresql/server/port/freebsd.h 0644 root root 33 2795 1347419309 1 f none /usr/local/include/postgresql/server/port/hpux.h 0644 root root 52 4183 1347419309 1 f none /usr/local/include/postgresql/server/port/irix.h 0644 root root 191 15025 1347419309 1 f none /usr/local/include/postgresql/server/port/linux.h 0644 root root 1051 25270 1347419309 1 f none /usr/local/include/postgresql/server/port/netbsd.h 0644 root root 32 2704 1347419309 1 f none /usr/local/include/postgresql/server/port/openbsd.h 0644 root root 33 2811 1347419309 1 f none /usr/local/include/postgresql/server/port/osf.h 0644 root root 73 5705 1347419309 1 f none /usr/local/include/postgresql/server/port/sco.h 0644 root root 115 9040 1347419309 1 f none /usr/local/include/postgresql/server/port/solaris.h 0644 root root 1041 19956 1347419309 1 f none /usr/local/include/postgresql/server/port/unixware.h 0644 root root 279 19440 1347419309 1 d none /usr/local/include/postgresql/server/port/win32 0755 root root 1 f none /usr/local/include/postgresql/server/port/win32.h 0644 root root 12891 6721 1347419309 1 d none /usr/local/include/postgresql/server/port/win32/arpa 0755 root root 1 f none /usr/local/include/postgresql/server/port/win32/arpa/inet.h 0644 root root 66 5591 1347419309 1 f none /usr/local/include/postgresql/server/port/win32/dlfcn.h 0644 root root 37 3065 1347419309 1 f none /usr/local/include/postgresql/server/port/win32/grp.h 0644 root root 35 2875 1347419309 1 f none /usr/local/include/postgresql/server/port/win32/netdb.h 0644 root root 37 3071 1347419309 1 d none /usr/local/include/postgresql/server/port/win32/netinet 0755 root root 1 f none /usr/local/include/postgresql/server/port/win32/netinet/in.h 0644 root root 67 5713 1347419309 1 f none /usr/local/include/postgresql/server/port/win32/pwd.h 0644 root root 39 2971 1347419309 1 d none /usr/local/include/postgresql/server/port/win32/sys 0755 root root 1 f none /usr/local/include/postgresql/server/port/win32/sys/socket.h 0644 root root 696 57001 1347419309 1 f none /usr/local/include/postgresql/server/port/win32/sys/wait.h 0644 root root 44 3475 1347419309 1 d none /usr/local/include/postgresql/server/port/win32_msvc 0755 root root 1 f none /usr/local/include/postgresql/server/port/win32_msvc/dirent.h 0644 root root 411 33794 1347419309 1 d none /usr/local/include/postgresql/server/port/win32_msvc/sys 0755 root root 1 f none /usr/local/include/postgresql/server/port/win32_msvc/sys/file.h 0644 root root 45 3896 1347419309 1 f none /usr/local/include/postgresql/server/port/win32_msvc/sys/param.h 0644 root root 46 4009 1347419309 1 f none /usr/local/include/postgresql/server/port/win32_msvc/sys/time.h 0644 root root 45 3911 1347419309 1 f none /usr/local/include/postgresql/server/port/win32_msvc/unistd.h 0644 root root 43 3745 1347419309 1 f none /usr/local/include/postgresql/server/port/win32_msvc/utime.h 0644 root root 42 3630 1347419309 1 d none /usr/local/include/postgresql/server/portability 0755 root root 1 f none /usr/local/include/postgresql/server/portability/instr_time.h 0644 root root 4262 61224 1347419309 1 f none /usr/local/include/postgresql/server/postgres.h 0644 root root 20550 48738 1347419309 1 f none /usr/local/include/postgresql/server/postgres_ext.h 0644 root root 1778 8903 1347419309 1 f none /usr/local/include/postgresql/server/postgres_fe.h 0644 root root 730 54063 1347419309 1 d none /usr/local/include/postgresql/server/postmaster 0755 root root 1 f none /usr/local/include/postgresql/server/postmaster/autovacuum.h 0644 root root 1965 40205 1347419309 1 f none /usr/local/include/postgresql/server/postmaster/bgwriter.h 0644 root root 1239 37701 1347419309 1 f none /usr/local/include/postgresql/server/postmaster/fork_process.h 0644 root root 447 30691 1347419309 1 f none /usr/local/include/postgresql/server/postmaster/pgarch.h 0644 root root 641 45645 1347419309 1 f none /usr/local/include/postgresql/server/postmaster/postmaster.h 0644 root root 1765 17711 1347419309 1 f none /usr/local/include/postgresql/server/postmaster/startup.h 0644 root root 635 48878 1347419309 1 f none /usr/local/include/postgresql/server/postmaster/syslogger.h 0644 root root 2571 10401 1347419309 1 f none /usr/local/include/postgresql/server/postmaster/walwriter.h 0644 root root 487 33996 1347419309 1 d none /usr/local/include/postgresql/server/regex 0755 root root 1 f none /usr/local/include/postgresql/server/regex/regcustom.h 0644 root root 2892 31982 1347419309 1 f none /usr/local/include/postgresql/server/regex/regerrs.h 0644 root root 1214 25525 1347419309 1 f none /usr/local/include/postgresql/server/regex/regex.h 0644 root root 6595 52283 1347419309 1 f none /usr/local/include/postgresql/server/regex/regguts.h 0644 root root 15392 50306 1347419309 1 d none /usr/local/include/postgresql/server/replication 0755 root root 1 f none /usr/local/include/postgresql/server/replication/basebackup.h 0644 root root 494 34341 1347419309 1 f none /usr/local/include/postgresql/server/replication/syncrep.h 0644 root root 1518 55943 1347419309 1 f none /usr/local/include/postgresql/server/replication/walprotocol.h 0644 root root 3366 17716 1347419309 1 f none /usr/local/include/postgresql/server/replication/walreceiver.h 0644 root root 3884 981 1347419309 1 f none /usr/local/include/postgresql/server/replication/walsender.h 0644 root root 1001 16364 1347419309 1 f none /usr/local/include/postgresql/server/replication/walsender_private.h 0644 root root 3036 53296 1347419309 1 d none /usr/local/include/postgresql/server/rewrite 0755 root root 1 f none /usr/local/include/postgresql/server/rewrite/prs2lock.h 0644 root root 1070 16122 1347419309 1 f none /usr/local/include/postgresql/server/rewrite/rewriteDefine.h 0644 root root 1143 20696 1347419309 1 f none /usr/local/include/postgresql/server/rewrite/rewriteHandler.h 0644 root root 744 57214 1347419309 1 f none /usr/local/include/postgresql/server/rewrite/rewriteManip.h 0644 root root 2764 37971 1347419309 1 f none /usr/local/include/postgresql/server/rewrite/rewriteRemove.h 0644 root root 537 38035 1347419309 1 f none /usr/local/include/postgresql/server/rewrite/rewriteSupport.h 0644 root root 911 5157 1347419309 1 f none /usr/local/include/postgresql/server/rusagestub.h 0644 root root 843 61889 1347419309 1 d none /usr/local/include/postgresql/server/snowball 0755 root root 1 f none /usr/local/include/postgresql/server/snowball/header.h 0644 root root 1690 5770 1347419309 1 d none /usr/local/include/postgresql/server/snowball/libstemmer 0755 root root 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/api.h 0644 root root 763 64946 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/header.h 0644 root root 2487 16389 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_danish.h 0644 root root 325 28045 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_dutch.h 0644 root root 322 27760 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_english.h 0644 root root 328 28390 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_finnish.h 0644 root root 328 28405 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_french.h 0644 root root 325 28042 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_german.h 0644 root root 325 28054 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_hungarian.h 0644 root root 334 29023 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_italian.h 0644 root root 328 28366 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_norwegian.h 0644 root root 334 29062 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_porter.h 0644 root root 325 28156 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_portuguese.h 0644 root root 337 29473 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_spanish.h 0644 root root 328 28426 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_1_swedish.h 0644 root root 328 28429 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_ISO_8859_2_romanian.h 0644 root root 331 28714 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_KOI8_R_russian.h 0644 root root 316 27763 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_danish.h 0644 root root 310 27127 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_dutch.h 0644 root root 307 26842 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_english.h 0644 root root 313 27472 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_finnish.h 0644 root root 313 27487 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_french.h 0644 root root 310 27124 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_german.h 0644 root root 310 27136 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_hungarian.h 0644 root root 319 28105 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_italian.h 0644 root root 313 27448 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_norwegian.h 0644 root root 319 28144 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_porter.h 0644 root root 310 27238 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_portuguese.h 0644 root root 322 28555 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_romanian.h 0644 root root 316 27793 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_russian.h 0644 root root 313 27553 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_spanish.h 0644 root root 313 27508 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_swedish.h 0644 root root 313 27511 1347419309 1 f none /usr/local/include/postgresql/server/snowball/libstemmer/stem_UTF_8_turkish.h 0644 root root 313 27568 1347419309 1 d none /usr/local/include/postgresql/server/storage 0755 root root 1 f none /usr/local/include/postgresql/server/storage/backendid.h 0644 root root 730 51005 1347419309 1 f none /usr/local/include/postgresql/server/storage/barrier.h 0644 root root 6445 25044 1347419309 1 f none /usr/local/include/postgresql/server/storage/block.h 0644 root root 3281 1187 1347419309 1 f none /usr/local/include/postgresql/server/storage/buf.h 0644 root root 1082 17129 1347419309 1 f none /usr/local/include/postgresql/server/storage/buf_internals.h 0644 root root 7963 13200 1347419309 1 f none /usr/local/include/postgresql/server/storage/buffile.h 0644 root root 1714 12012 1347419309 1 f none /usr/local/include/postgresql/server/storage/bufmgr.h 0644 root root 6950 62401 1347419309 1 f none /usr/local/include/postgresql/server/storage/bufpage.h 0644 root root 13193 12038 1347419309 1 f none /usr/local/include/postgresql/server/storage/copydir.h 0644 root root 561 40290 1347419309 1 f none /usr/local/include/postgresql/server/storage/fd.h 0644 root root 3423 24352 1347419309 1 f none /usr/local/include/postgresql/server/storage/freespace.h 0644 root root 1264 35691 1347419309 1 f none /usr/local/include/postgresql/server/storage/fsm_internals.h 0644 root root 2296 57945 1347419309 1 f none /usr/local/include/postgresql/server/storage/indexfsm.h 0644 root root 795 61420 1347419309 1 f none /usr/local/include/postgresql/server/storage/ipc.h 0644 root root 2600 18517 1347419309 1 f none /usr/local/include/postgresql/server/storage/item.h 0644 root root 469 31708 1347419309 1 f none /usr/local/include/postgresql/server/storage/itemid.h 0644 root root 4341 14322 1347419309 1 f none /usr/local/include/postgresql/server/storage/itemptr.h 0644 root root 3812 54502 1347419309 1 f none /usr/local/include/postgresql/server/storage/large_object.h 0644 root root 2964 48730 1347419309 1 f none /usr/local/include/postgresql/server/storage/latch.h 0644 root root 5399 2495 1347419309 1 f none /usr/local/include/postgresql/server/storage/lmgr.h 0644 root root 3224 12313 1347419309 1 f none /usr/local/include/postgresql/server/storage/lock.h 0644 root root 20611 64853 1347419309 1 f none /usr/local/include/postgresql/server/storage/lwlock.h 0644 root root 3665 42202 1347419309 1 f none /usr/local/include/postgresql/server/storage/off.h 0644 root root 1618 60679 1347419309 1 f none /usr/local/include/postgresql/server/storage/pg_sema.h 0644 root root 2469 10863 1347419309 1 f none /usr/local/include/postgresql/server/storage/pg_shmem.h 0644 root root 1956 27391 1347419309 1 f none /usr/local/include/postgresql/server/storage/pmsignal.h 0644 root root 2080 41129 1347419309 1 f none /usr/local/include/postgresql/server/storage/pos.h 0644 root root 1592 60695 1347419309 1 f none /usr/local/include/postgresql/server/storage/predicate.h 0644 root root 2623 32119 1347419309 1 f none /usr/local/include/postgresql/server/storage/predicate_internals.h 0644 root root 17906 55412 1347419309 1 f none /usr/local/include/postgresql/server/storage/proc.h 0644 root root 9801 33810 1347419309 1 f none /usr/local/include/postgresql/server/storage/procarray.h 0644 root root 2958 62117 1347419309 1 f none /usr/local/include/postgresql/server/storage/procsignal.h 0644 root root 1798 13394 1347419309 1 f none /usr/local/include/postgresql/server/storage/reinit.h 0644 root root 588 41139 1347419309 1 f none /usr/local/include/postgresql/server/storage/relfilenode.h 0644 root root 4416 41241 1347419309 1 f none /usr/local/include/postgresql/server/storage/s_lock.h 0644 root root 26285 63248 1347419309 1 f none /usr/local/include/postgresql/server/storage/shmem.h 0644 root root 2694 26282 1347419309 1 f none /usr/local/include/postgresql/server/storage/sinval.h 0644 root root 5089 33061 1347419309 1 f none /usr/local/include/postgresql/server/storage/sinvaladt.h 0644 root root 1522 61336 1347419309 1 f none /usr/local/include/postgresql/server/storage/smgr.h 0644 root root 5583 30862 1347419309 1 f none /usr/local/include/postgresql/server/storage/spin.h 0644 root root 2568 16803 1347419309 1 f none /usr/local/include/postgresql/server/storage/standby.h 0644 root root 4085 26198 1347419309 1 d none /usr/local/include/postgresql/server/tcop 0755 root root 1 f none /usr/local/include/postgresql/server/tcop/dest.h 0644 root root 5670 24127 1347419309 1 f none /usr/local/include/postgresql/server/tcop/fastpath.h 0644 root root 509 35675 1347419309 1 f none /usr/local/include/postgresql/server/tcop/pquery.h 0644 root root 1161 27113 1347419309 1 f none /usr/local/include/postgresql/server/tcop/tcopdebug.h 0644 root root 1316 21742 1347419309 1 f none /usr/local/include/postgresql/server/tcop/tcopprot.h 0644 root root 2996 55912 1347419309 1 f none /usr/local/include/postgresql/server/tcop/utility.h 0644 root root 1514 59783 1347419309 1 d none /usr/local/include/postgresql/server/tsearch 0755 root root 1 d none /usr/local/include/postgresql/server/tsearch/dicts 0755 root root 1 f none /usr/local/include/postgresql/server/tsearch/dicts/regis.h 0644 root root 915 1629 1347419309 1 f none /usr/local/include/postgresql/server/tsearch/dicts/spell.h 0644 root root 3697 26849 1347419309 1 f none /usr/local/include/postgresql/server/tsearch/ts_cache.h 0644 root root 2109 38292 1347419309 1 f none /usr/local/include/postgresql/server/tsearch/ts_locale.h 0644 root root 2055 33086 1347419309 1 f none /usr/local/include/postgresql/server/tsearch/ts_public.h 0644 root root 2809 21524 1347419309 1 f none /usr/local/include/postgresql/server/tsearch/ts_type.h 0644 root root 8812 55356 1347419309 1 f none /usr/local/include/postgresql/server/tsearch/ts_utils.h 0644 root root 7829 4582 1347419309 1 d none /usr/local/include/postgresql/server/utils 0755 root root 1 f none /usr/local/include/postgresql/server/utils/acl.h 0644 root root 13098 31821 1347419309 1 f none /usr/local/include/postgresql/server/utils/array.h 0644 root root 10863 57414 1347419309 1 f none /usr/local/include/postgresql/server/utils/ascii.h 0644 root root 579 42025 1347419309 1 f none /usr/local/include/postgresql/server/utils/attoptcache.h 0644 root root 716 53471 1347419309 1 f none /usr/local/include/postgresql/server/utils/builtins.h 0644 root root 48719 42868 1347419309 1 f none /usr/local/include/postgresql/server/utils/bytea.h 0644 root root 1615 64112 1347419309 1 f none /usr/local/include/postgresql/server/utils/cash.h 0644 root root 2118 45533 1347419309 1 f none /usr/local/include/postgresql/server/utils/catcache.h 0644 root root 7734 43523 1347419309 1 f none /usr/local/include/postgresql/server/utils/combocid.h 0644 root root 698 52060 1347419309 1 f none /usr/local/include/postgresql/server/utils/date.h 0644 root root 7919 4881 1347419309 1 f none /usr/local/include/postgresql/server/utils/datetime.h 0644 root root 8757 23248 1347419309 1 f none /usr/local/include/postgresql/server/utils/datum.h 0644 root root 1520 57061 1347419309 1 f none /usr/local/include/postgresql/server/utils/dynahash.h 0644 root root 498 34232 1347419309 1 f none /usr/local/include/postgresql/server/utils/dynamic_loader.h 0644 root root 648 47623 1347419309 1 f none /usr/local/include/postgresql/server/utils/elog.h 0644 root root 12857 14027 1347419309 1 f none /usr/local/include/postgresql/server/utils/errcodes.h 0644 root root 20079 65175 1347419309 1 f none /usr/local/include/postgresql/server/utils/fmgroids.h 0644 root root 62560 44991 1347419309 1 f none /usr/local/include/postgresql/server/utils/fmgrtab.h 0644 root root 1181 25590 1347419309 1 f none /usr/local/include/postgresql/server/utils/formatting.h 0644 root root 1261 35536 1347419309 1 f none /usr/local/include/postgresql/server/utils/geo_decls.h 0644 root root 16242 60062 1347419309 1 f none /usr/local/include/postgresql/server/utils/guc.h 0644 root root 13503 20197 1347419309 1 f none /usr/local/include/postgresql/server/utils/guc_tables.h 0644 root root 7319 12077 1347419309 1 f none /usr/local/include/postgresql/server/utils/help_config.h 0644 root root 432 29084 1347419309 1 f none /usr/local/include/postgresql/server/utils/hsearch.h 0644 root root 5639 8050 1347419309 1 f none /usr/local/include/postgresql/server/utils/inet.h 0644 root root 2722 23333 1347419309 1 f none /usr/local/include/postgresql/server/utils/int8.h 0644 root root 4130 8792 1347419309 1 f none /usr/local/include/postgresql/server/utils/inval.h 0644 root root 1849 23057 1347419309 1 f none /usr/local/include/postgresql/server/utils/json.h 0644 root root 916 5604 1347419309 1 f none /usr/local/include/postgresql/server/utils/logtape.h 0644 root root 1539 62057 1347419309 1 f none /usr/local/include/postgresql/server/utils/lsyscache.h 0644 root root 6663 64530 1347419309 1 f none /usr/local/include/postgresql/server/utils/memutils.h 0644 root root 5037 38397 1347419309 1 f none /usr/local/include/postgresql/server/utils/nabstime.h 0644 root root 5927 24841 1347419309 1 f none /usr/local/include/postgresql/server/utils/numeric.h 0644 root root 1833 13366 1347419309 1 f none /usr/local/include/postgresql/server/utils/palloc.h 0644 root root 4006 20054 1347419309 1 f none /usr/local/include/postgresql/server/utils/pg_crc.h 0644 root root 4465 22267 1347419309 1 f none /usr/local/include/postgresql/server/utils/pg_crc_tables.h 0644 root root 20203 47300 1347419309 1 f none /usr/local/include/postgresql/server/utils/pg_locale.h 0644 root root 2614 29074 1347419309 1 f none /usr/local/include/postgresql/server/utils/pg_lzcompress.h 0644 root root 3045 45929 1347419309 1 f none /usr/local/include/postgresql/server/utils/pg_rusage.h 0644 root root 847 65424 1347419309 1 f none /usr/local/include/postgresql/server/utils/plancache.h 0644 root root 7347 35915 1347419309 1 f none /usr/local/include/postgresql/server/utils/portal.h 0644 root root 8911 37494 1347419309 1 f none /usr/local/include/postgresql/server/utils/probes.h 0644 root root 6654 33176 1347419309 1 f none /usr/local/include/postgresql/server/utils/ps_status.h 0644 root root 668 51504 1347419309 1 f none /usr/local/include/postgresql/server/utils/rangetypes.h 0644 root root 7577 38449 1347419309 1 f none /usr/local/include/postgresql/server/utils/rbtree.h 0644 root root 2312 55775 1347419309 1 f none /usr/local/include/postgresql/server/utils/rel.h 0644 root root 12658 16510 1347419309 1 f none /usr/local/include/postgresql/server/utils/relcache.h 0644 root root 3241 11100 1347419309 1 f none /usr/local/include/postgresql/server/utils/relmapper.h 0644 root root 1719 8149 1347419309 1 f none /usr/local/include/postgresql/server/utils/reltrigger.h 0644 root root 1999 33515 1347419309 1 f none /usr/local/include/postgresql/server/utils/resowner.h 0644 root root 4960 36572 1347419309 1 f none /usr/local/include/postgresql/server/utils/selfuncs.h 0644 root root 7533 40605 1347419309 1 f none /usr/local/include/postgresql/server/utils/snapmgr.h 0644 root root 1625 10656 1347419309 1 f none /usr/local/include/postgresql/server/utils/snapshot.h 0644 root root 2653 19559 1347419309 1 f none /usr/local/include/postgresql/server/utils/sortsupport.h 0644 root root 5427 64487 1347419309 1 f none /usr/local/include/postgresql/server/utils/spccache.h 0644 root root 556 39333 1347419309 1 f none /usr/local/include/postgresql/server/utils/syscache.h 0644 root root 5593 50252 1347419309 1 f none /usr/local/include/postgresql/server/utils/timestamp.h 0644 root root 9731 51308 1347419309 1 f none /usr/local/include/postgresql/server/utils/tqual.h 0644 root root 3507 34041 1347419309 1 f none /usr/local/include/postgresql/server/utils/tuplesort.h 0644 root root 4726 19377 1347419309 1 f none /usr/local/include/postgresql/server/utils/tuplestore.h 0644 root root 3213 21407 1347419309 1 f none /usr/local/include/postgresql/server/utils/typcache.h 0644 root root 4361 31294 1347419309 1 f none /usr/local/include/postgresql/server/utils/tzparser.h 0644 root root 993 10973 1347419309 1 f none /usr/local/include/postgresql/server/utils/uuid.h 0644 root root 861 63449 1347419309 1 f none /usr/local/include/postgresql/server/utils/varbit.h 0644 root root 4159 7206 1347419309 1 f none /usr/local/include/postgresql/server/utils/xml.h 0644 root root 3986 15516 1347419309 1 f none /usr/local/include/postgresql/server/windowapi.h 0644 root root 2379 2298 1347419309 1 f none /usr/local/include/sql3types.h 0644 root root 834 59470 1347419309 1 f none /usr/local/include/sqlca.h 0644 root root 1267 26312 1347419309 1 f none /usr/local/include/sqlda-compat.h 0644 root root 1583 59559 1347419309 1 f none /usr/local/include/sqlda-native.h 0644 root root 820 2805 1347419309 1 f none /usr/local/include/sqlda.h 0644 root root 315 27403 1347419309 1 d none /usr/local/lib 0755 root root 1 f none /usr/local/lib/libecpg.a 0644 root root 930228 40688 1347419309 1 s none /usr/local/lib/libecpg.so=libecpg.so.6.4 1 s none /usr/local/lib/libecpg.so.6=libecpg.so.6.4 1 f none /usr/local/lib/libecpg.so.6.4 0755 root root 905000 40215 1347419309 1 f none /usr/local/lib/libecpg_compat.a 0644 root root 17512 16544 1347419309 1 s none /usr/local/lib/libecpg_compat.so=libecpg_compat.so.3.4 1 s none /usr/local/lib/libecpg_compat.so.3=libecpg_compat.so.3.4 1 f none /usr/local/lib/libecpg_compat.so.3.4 0755 root root 22364 2073 1347419309 1 f none /usr/local/lib/libpgport.a 0644 root root 87860 26572 1347419306 1 f none /usr/local/lib/libpgtypes.a 0644 root root 103184 25291 1347419309 1 s none /usr/local/lib/libpgtypes.so=libpgtypes.so.3.3 1 s none /usr/local/lib/libpgtypes.so.3=libpgtypes.so.3.3 1 f none /usr/local/lib/libpgtypes.so.3.3 0755 root root 90716 12815 1347419309 1 f none /usr/local/lib/libpq.a 0644 root root 291928 32488 1347419309 1 s none /usr/local/lib/libpq.so=libpq.so.5.5 1 s none /usr/local/lib/libpq.so.5=libpq.so.5.5 1 f none /usr/local/lib/libpq.so.5.5 0755 root root 249872 45678 1347419309 1 d none /usr/local/lib/postgresql 0755 root root 1 f none /usr/local/lib/postgresql/_int.so 0755 root root 60320 39204 1347419311 1 f none /usr/local/lib/postgresql/adminpack.so 0755 root root 15780 39803 1347419310 1 f none /usr/local/lib/postgresql/ascii_and_mic.so 0755 root root 6764 3651 1347419308 1 f none /usr/local/lib/postgresql/auth_delay.so 0755 root root 7056 18104 1347419310 1 f none /usr/local/lib/postgresql/auto_explain.so 0755 root root 12868 56644 1347419311 1 f none /usr/local/lib/postgresql/autoinc.so 0755 root root 9468 30427 1347419312 1 f none /usr/local/lib/postgresql/btree_gin.so 0755 root root 44400 11442 1347419311 1 f none /usr/local/lib/postgresql/btree_gist.so 0755 root root 124252 24321 1347419311 1 f none /usr/local/lib/postgresql/chkpass.so 0755 root root 9004 17915 1347419311 1 f none /usr/local/lib/postgresql/citext.so 0755 root root 10548 10299 1347419311 1 f none /usr/local/lib/postgresql/cube.so 0755 root root 55508 5275 1347419311 1 f none /usr/local/lib/postgresql/cyrillic_and_mic.so 0755 root root 15212 11693 1347419308 1 f none /usr/local/lib/postgresql/dblink.so 0755 root root 49900 44867 1347419311 1 f none /usr/local/lib/postgresql/dict_int.so 0755 root root 7956 19886 1347419311 1 f none /usr/local/lib/postgresql/dict_snowball.so 0755 root root 435232 7268 1347419308 1 f none /usr/local/lib/postgresql/dict_xsyn.so 0755 root root 10920 14097 1347419311 1 f none /usr/local/lib/postgresql/dummy_seclabel.so 0755 root root 7232 53956 1347419311 1 f none /usr/local/lib/postgresql/earthdistance.so 0755 root root 8016 37738 1347419311 1 f none /usr/local/lib/postgresql/euc2004_sjis2004.so 0755 root root 8872 23523 1347419308 1 f none /usr/local/lib/postgresql/euc_cn_and_mic.so 0755 root root 7364 555 1347419308 1 f none /usr/local/lib/postgresql/euc_jp_and_sjis.so 0755 root root 15160 41925 1347419308 1 f none /usr/local/lib/postgresql/euc_kr_and_mic.so 0755 root root 7492 4229 1347419308 1 f none /usr/local/lib/postgresql/euc_tw_and_big5.so 0755 root root 13812 47798 1347419308 1 f none /usr/local/lib/postgresql/file_fdw.so 0755 root root 19508 16866 1347419311 1 f none /usr/local/lib/postgresql/fuzzystrmatch.so 0755 root root 41156 34232 1347419311 1 f none /usr/local/lib/postgresql/hstore.so 0755 root root 66200 46774 1347419311 1 f none /usr/local/lib/postgresql/insert_username.so 0755 root root 8892 42867 1347419312 1 f none /usr/local/lib/postgresql/isn.so 0755 root root 63360 42805 1347419311 1 f none /usr/local/lib/postgresql/latin2_and_win1250.so 0755 root root 9540 23144 1347419308 1 f none /usr/local/lib/postgresql/latin_and_mic.so 0755 root root 8712 5044 1347419308 1 f none /usr/local/lib/postgresql/libpqwalreceiver.so 0755 root root 13980 44564 1347419309 1 f none /usr/local/lib/postgresql/lo.so 0755 root root 7632 60862 1347419311 1 f none /usr/local/lib/postgresql/ltree.so 0755 root root 83200 17207 1347419311 1 f none /usr/local/lib/postgresql/moddatetime.so 0755 root root 8996 58273 1347419312 1 f none /usr/local/lib/postgresql/pageinspect.so 0755 root root 26272 38163 1347419312 1 f none /usr/local/lib/postgresql/passwordcheck.so 0755 root root 8244 61241 1347419312 1 f none /usr/local/lib/postgresql/pg_buffercache.so 0755 root root 9568 41622 1347419312 1 f none /usr/local/lib/postgresql/pg_freespacemap.so 0755 root root 7236 35547 1347419312 1 f none /usr/local/lib/postgresql/pg_stat_statements.so 0755 root root 33112 51749 1347419312 1 f none /usr/local/lib/postgresql/pg_trgm.so 0755 root root 32004 18918 1347419312 1 f none /usr/local/lib/postgresql/pg_upgrade_support.so 0755 root root 10692 14237 1347419312 1 f none /usr/local/lib/postgresql/pgcrypto.so 0755 root root 184340 39332 1347419312 1 f none /usr/local/lib/postgresql/pgrowlocks.so 0755 root root 11600 3750 1347419312 1 f none /usr/local/lib/postgresql/pgstattuple.so 0755 root root 21492 18242 1347419312 1 f none /usr/local/lib/postgresql/pgxml.so 0755 root root 26812 3032 1347419313 1 d none /usr/local/lib/postgresql/pgxs 0755 root root 1 d none /usr/local/lib/postgresql/pgxs/config 0755 root root 1 f none /usr/local/lib/postgresql/pgxs/config/install-sh 0755 root root 13901 20906 1347419310 1 d none /usr/local/lib/postgresql/pgxs/src 0755 root root 1 f none /usr/local/lib/postgresql/pgxs/src/Makefile.global 0644 root root 23140 51963 1347419310 1 f none /usr/local/lib/postgresql/pgxs/src/Makefile.port 0644 root root 484 35873 1347419310 1 f none /usr/local/lib/postgresql/pgxs/src/Makefile.shlib 0644 root root 14858 31014 1347419310 1 d none /usr/local/lib/postgresql/pgxs/src/makefiles 0755 root root 1 f none /usr/local/lib/postgresql/pgxs/src/makefiles/pgxs.mk 0644 root root 7947 39936 1347419310 1 f none /usr/local/lib/postgresql/pgxs/src/nls-global.mk 0644 root root 5971 12498 1347419310 1 d none /usr/local/lib/postgresql/pgxs/src/test 0755 root root 1 d none /usr/local/lib/postgresql/pgxs/src/test/regress 0755 root root 1 f none /usr/local/lib/postgresql/pgxs/src/test/regress/pg_regress 0755 root root 67160 45221 1347419310 1 f none /usr/local/lib/postgresql/plpgsql.so 0755 root root 186204 51156 1347419310 1 f none /usr/local/lib/postgresql/pltcl.so 0755 root root 39916 25398 1347419310 1 f none /usr/local/lib/postgresql/refint.so 0755 root root 18108 63895 1347419312 1 f none /usr/local/lib/postgresql/seg.so 0755 root root 40296 16327 1347419312 1 f none /usr/local/lib/postgresql/sslinfo.so 0755 root root 13976 35209 1347419313 1 f none /usr/local/lib/postgresql/tablefunc.so 0755 root root 27300 1271 1347419312 1 f none /usr/local/lib/postgresql/tcn.so 0755 root root 9708 8663 1347419313 1 f none /usr/local/lib/postgresql/test_parser.so 0755 root root 7720 63093 1347419313 1 f none /usr/local/lib/postgresql/timetravel.so 0755 root root 15460 32755 1347419312 1 f none /usr/local/lib/postgresql/tsearch2.so 0755 root root 26308 23239 1347419313 1 f none /usr/local/lib/postgresql/unaccent.so 0755 root root 12928 54157 1347419313 1 f none /usr/local/lib/postgresql/utf8_and_ascii.so 0755 root root 6772 4538 1347419308 1 f none /usr/local/lib/postgresql/utf8_and_big5.so 0755 root root 226264 65 1347419308 1 f none /usr/local/lib/postgresql/utf8_and_cyrillic.so 0755 root root 11652 55084 1347419308 1 f none /usr/local/lib/postgresql/utf8_and_euc2004.so 0755 root root 190520 33081 1347419308 1 f none /usr/local/lib/postgresql/utf8_and_euc_cn.so 0755 root root 125988 11677 1347419308 1 f none /usr/local/lib/postgresql/utf8_and_euc_jp.so 0755 root root 217844 55014 1347419308 1 f none /usr/local/lib/postgresql/utf8_and_euc_kr.so 0755 root root 138500 19257 1347419308 1 f none /usr/local/lib/postgresql/utf8_and_euc_tw.so 0755 root root 337156 47618 1347419308 1 f none /usr/local/lib/postgresql/utf8_and_gb18030.so 0755 root root 1020648 50469 1347419308 1 f none /usr/local/lib/postgresql/utf8_and_gbk.so 0755 root root 355500 53067 1347419308 1 f none /usr/local/lib/postgresql/utf8_and_iso8859.so 0755 root root 34132 21787 1347419308 1 f none /usr/local/lib/postgresql/utf8_and_iso8859_1.so 0755 root root 7616 27303 1347419308 1 f none /usr/local/lib/postgresql/utf8_and_johab.so 0755 root root 279644 39697 1347419308 1 f none /usr/local/lib/postgresql/utf8_and_sjis.so 0755 root root 128320 27127 1347419308 1 f none /usr/local/lib/postgresql/utf8_and_sjis2004.so 0755 root root 190040 13395 1347419308 1 f none /usr/local/lib/postgresql/utf8_and_uhc.so 0755 root root 282620 20642 1347419308 1 f none /usr/local/lib/postgresql/utf8_and_win.so 0755 root root 29404 20564 1347419308 1 d none /usr/local/share 0755 root root 1 d none /usr/local/share/doc 0755 root root 1 d none /usr/local/share/doc/postgresql 0755 root root 1 d none /usr/local/share/doc/postgresql/extension 0755 root root 1 f none /usr/local/share/doc/postgresql/extension/autoinc.example 0644 root root 798 56417 1347419312 1 f none /usr/local/share/doc/postgresql/extension/insert_username.example 0644 root root 560 44401 1347419312 1 f none /usr/local/share/doc/postgresql/extension/moddatetime.example 0644 root root 493 34473 1347419312 1 f none /usr/local/share/doc/postgresql/extension/refint.example 0644 root root 2105 24710 1347419312 1 f none /usr/local/share/doc/postgresql/extension/timetravel.example 0644 root root 2372 6310 1347419312 1 d none /usr/local/share/doc/postgresql/html 0755 root root 1 f none /usr/local/share/doc/postgresql/html/LEGALNOTICE.html 0644 root root 2679 62344 1347419305 1 f none /usr/local/share/doc/postgresql/html/acronyms.html 0644 root root 16281 41487 1347419305 1 f none /usr/local/share/doc/postgresql/html/admin.html 0644 root root 12497 39709 1347419305 1 f none /usr/local/share/doc/postgresql/html/adminpack.html 0644 root root 3412 63159 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-clusterdb.html 0644 root root 10600 41712 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-createdb.html 0644 root root 12854 11824 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-createlang.html 0644 root root 9905 55548 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-createuser.html 0644 root root 15638 28555 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-dropdb.html 0644 root root 9640 41596 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-droplang.html 0644 root root 9636 32496 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-dropuser.html 0644 root root 9594 39048 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-ecpg.html 0644 root root 8917 62646 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-initdb.html 0644 root root 15228 19815 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-pg-ctl.html 0644 root root 22127 50394 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-pg-dumpall.html 0644 root root 20079 62364 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-pgbasebackup.html 0644 root root 19816 60387 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-pgconfig.html 0644 root root 11091 34210 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-pgcontroldata.html 0644 root root 3977 29152 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-pgdump.html 0644 root root 42955 48967 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-pgreceivexlog.html 0644 root root 11055 45383 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-pgresetxlog.html 0644 root root 11456 31731 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-pgrestore.html 0644 root root 29944 11035 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-postgres.html 0644 root root 31484 57185 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-postmaster.html 0644 root root 3003 16004 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-psql.html 0644 root root 135001 52252 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-reindexdb.html 0644 root root 11279 16440 1347419305 1 f none /usr/local/share/doc/postgresql/html/app-vacuumdb.html 0644 root root 12614 51902 1347419305 1 f none /usr/local/share/doc/postgresql/html/appendixes.html 0644 root root 21640 36021 1347419305 1 f none /usr/local/share/doc/postgresql/html/applevel-consistency.html 0644 root root 10358 49597 1347419305 1 f none /usr/local/share/doc/postgresql/html/archive-recovery-settings.html 0644 root root 7336 41415 1347419305 1 f none /usr/local/share/doc/postgresql/html/arrays.html 0644 root root 26891 22375 1347419305 1 f none /usr/local/share/doc/postgresql/html/auth-delay.html 0644 root root 3778 18745 1347419305 1 f none /usr/local/share/doc/postgresql/html/auth-methods.html 0644 root root 34495 62877 1347419305 1 f none /usr/local/share/doc/postgresql/html/auth-pg-hba-conf.html 0644 root root 29511 62934 1347419305 1 f none /usr/local/share/doc/postgresql/html/auth-username-maps.html 0644 root root 8595 8467 1347419305 1 f none /usr/local/share/doc/postgresql/html/auto-explain.html 0644 root root 8731 6699 1347419305 1 f none /usr/local/share/doc/postgresql/html/backup-dump.html 0644 root root 15925 53150 1347419305 1 f none /usr/local/share/doc/postgresql/html/backup-file.html 0644 root root 7994 53207 1347419305 1 f none /usr/local/share/doc/postgresql/html/backup.html 0644 root root 4483 3753 1347419305 1 f none /usr/local/share/doc/postgresql/html/biblio.html 0644 root root 11547 37197 1347419305 1 f none /usr/local/share/doc/postgresql/html/bki-commands.html 0644 root root 9644 27707 1347419305 1 f none /usr/local/share/doc/postgresql/html/bki-example.html 0644 root root 3047 25416 1347419305 1 f none /usr/local/share/doc/postgresql/html/bki-format.html 0644 root root 3461 59037 1347419305 1 f none /usr/local/share/doc/postgresql/html/bki-structure.html 0644 root root 4318 46948 1347419305 1 f none /usr/local/share/doc/postgresql/html/bki.html 0644 root root 4328 59268 1347419305 1 f none /usr/local/share/doc/postgresql/html/bookindex.html 0644 root root 241543 4032 1347419305 1 f none /usr/local/share/doc/postgresql/html/btree-gin.html 0644 root root 4598 12803 1347419305 1 f none /usr/local/share/doc/postgresql/html/btree-gist.html 0644 root root 6883 56616 1347419305 1 f none /usr/local/share/doc/postgresql/html/bug-reporting.html 0644 root root 18642 2304 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-aggregate.html 0644 root root 5500 12266 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-am.html 0644 root root 10545 43757 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-amop.html 0644 root root 7591 42402 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-amproc.html 0644 root root 4883 31933 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-attrdef.html 0644 root root 4362 57213 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-attribute.html 0644 root root 10285 40900 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-auth-members.html 0644 root root 4253 43905 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-authid.html 0644 root root 6813 47946 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-cast.html 0644 root root 6953 2178 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-class.html 0644 root root 12659 61309 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-collation.html 0644 root root 5895 46581 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-constraint.html 0644 root root 11574 61380 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-conversion.html 0644 root root 4428 55363 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-database.html 0644 root root 7025 53443 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-db-role-setting.html 0644 root root 4066 35795 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-default-acl.html 0644 root root 5221 57099 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-depend.html 0644 root root 8633 53056 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-description.html 0644 root root 4476 65077 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-enum.html 0644 root root 4714 26295 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-extension.html 0644 root root 5280 60841 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-foreign-data-wrapper.html 0644 root root 4943 34151 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-foreign-server.html 0644 root root 4686 12983 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-foreign-table.html 0644 root root 4034 31619 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-index.html 0644 root root 8783 56030 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-inherits.html 0644 root root 3886 17136 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-language.html 0644 root root 5950 42266 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-largeobject-metadata.html 0644 root root 3628 64076 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-largeobject.html 0644 root root 5152 56700 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-namespace.html 0644 root root 3749 7979 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-opclass.html 0644 root root 5861 39228 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-operator.html 0644 root root 6643 16823 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-opfamily.html 0644 root root 4809 27571 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-pltemplate.html 0644 root root 5362 4885 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-proc.html 0644 root root 13401 7268 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-range.html 0644 root root 5180 49192 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-rewrite.html 0644 root root 5391 52125 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-seclabel.html 0644 root root 4513 873 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-shdepend.html 0644 root root 7041 63424 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-shdescription.html 0644 root root 4245 50284 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-shseclabel.html 0644 root root 4402 61922 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-statistic.html 0644 root root 9487 61999 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-tablespace.html 0644 root root 4156 37978 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-trigger.html 0644 root root 8285 19924 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-ts-config-map.html 0644 root root 4191 42147 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-ts-config.html 0644 root root 4479 490 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-ts-dict.html 0644 root root 4714 20646 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-ts-parser.html 0644 root root 5080 41813 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-ts-template.html 0644 root root 4256 47689 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-type.html 0644 root root 19903 10119 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalog-pg-user-mapping.html 0644 root root 3845 14862 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalogs-overview.html 0644 root root 10429 7457 1347419305 1 f none /usr/local/share/doc/postgresql/html/catalogs.html 0644 root root 10385 47073 1347419305 1 f none /usr/local/share/doc/postgresql/html/charset.html 0644 root root 4160 42323 1347419305 1 f none /usr/local/share/doc/postgresql/html/chkpass.html 0644 root root 4389 6520 1347419305 1 f none /usr/local/share/doc/postgresql/html/citext.html 0644 root root 11067 51544 1347419305 1 f none /usr/local/share/doc/postgresql/html/client-authentication-problems.html 0644 root root 4222 61941 1347419305 1 f none /usr/local/share/doc/postgresql/html/client-authentication.html 0644 root root 5912 62842 1347419305 1 f none /usr/local/share/doc/postgresql/html/client-interfaces.html 0644 root root 13715 56270 1347419305 1 f none /usr/local/share/doc/postgresql/html/collation.html 0644 root root 14220 13137 1347419305 1 f none /usr/local/share/doc/postgresql/html/config-setting.html 0644 root root 11144 21158 1347419305 1 f none /usr/local/share/doc/postgresql/html/connect-estab.html 0644 root root 4313 780 1347419305 1 f none /usr/local/share/doc/postgresql/html/continuous-archiving.html 0644 root root 49828 27905 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-build-sql-delete.html 0644 root root 5449 9666 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-build-sql-insert.html 0644 root root 6050 57453 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-build-sql-update.html 0644 root root 6279 8843 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-cancel-query.html 0644 root root 3817 18926 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-close.html 0644 root root 4647 12124 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-connect-u.html 0644 root root 4480 17507 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-connect.html 0644 root root 7322 30195 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-disconnect.html 0644 root root 3715 7521 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-error-message.html 0644 root root 3505 59507 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-exec.html 0644 root root 5463 11085 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-fetch.html 0644 root root 5976 56717 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-function.html 0644 root root 8627 10270 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-get-connections.html 0644 root root 3204 37625 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-get-notify.html 0644 root root 4165 43401 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-get-pkey.html 0644 root root 4496 3375 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-get-result.html 0644 root root 6956 614 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-is-busy.html 0644 root root 3487 55869 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-open.html 0644 root root 5461 7861 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-dblink-send-query.html 0644 root root 4167 45398 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-prog-client.html 0644 root root 3432 57231 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-prog-server.html 0644 root root 3835 24165 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-prog.html 0644 root root 3318 49965 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib-spi.html 0644 root root 11234 40034 1347419305 1 f none /usr/local/share/doc/postgresql/html/contrib.html 0644 root root 8902 27116 1347419305 1 f none /usr/local/share/doc/postgresql/html/creating-cluster.html 0644 root root 10596 51326 1347419305 1 f none /usr/local/share/doc/postgresql/html/cube.html 0644 root root 15939 63423 1347419305 1 f none /usr/local/share/doc/postgresql/html/database-roles.html 0644 root root 6090 18532 1347419305 1 f none /usr/local/share/doc/postgresql/html/datatype-binary.html 0644 root root 12891 8592 1347419305 1 f none /usr/local/share/doc/postgresql/html/datatype-bit.html 0644 root root 5094 46557 1347419305 1 f none /usr/local/share/doc/postgresql/html/datatype-boolean.html 0644 root root 5265 37817 1347419305 1 f none /usr/local/share/doc/postgresql/html/datatype-character.html 0644 root root 11891 47501 1347419305 1 f none /usr/local/share/doc/postgresql/html/datatype-datetime.html 0644 root root 49768 36313 1347419305 1 f none /usr/local/share/doc/postgresql/html/datatype-enum.html 0644 root root 6431 26182 1347419305 1 f none /usr/local/share/doc/postgresql/html/datatype-geometric.html 0644 root root 12501 8577 1347419305 1 f none /usr/local/share/doc/postgresql/html/datatype-json.html 0644 root root 3437 58197 1347419305 1 f none /usr/local/share/doc/postgresql/html/datatype-money.html 0644 root root 5050 51908 1347419305 1 f none /usr/local/share/doc/postgresql/html/datatype-net-types.html 0644 root root 10421 18397 1347419305 1 f none /usr/local/share/doc/postgresql/html/datatype-numeric.html 0644 root root 21774 26175 1347419305 1 f none /usr/local/share/doc/postgresql/html/datatype-oid.html 0644 root root 9684 21941 1347419305 1 f none /usr/local/share/doc/postgresql/html/datatype-pseudo.html 0644 root root 7283 32210 1347419305 1 f none /usr/local/share/doc/postgresql/html/datatype-textsearch.html 0644 root root 10031 20419 1347419305 1 f none /usr/local/share/doc/postgresql/html/datatype-uuid.html 0644 root root 4558 22456 1347419305 1 f none /usr/local/share/doc/postgresql/html/datatype-xml.html 0644 root root 11332 31454 1347419305 1 f none /usr/local/share/doc/postgresql/html/datatype.html 0644 root root 16481 14858 1347419305 1 f none /usr/local/share/doc/postgresql/html/datetime-appendix.html 0644 root root 3523 5135 1347419305 1 f none /usr/local/share/doc/postgresql/html/datetime-config-files.html 0644 root root 7705 8230 1347419305 1 f none /usr/local/share/doc/postgresql/html/datetime-input-rules.html 0644 root root 6761 27690 1347419305 1 f none /usr/local/share/doc/postgresql/html/datetime-keywords.html 0644 root root 5094 32747 1347419305 1 f none /usr/local/share/doc/postgresql/html/datetime-units-history.html 0644 root root 7632 10430 1347419305 1 f none /usr/local/share/doc/postgresql/html/dblink.html 0644 root root 5320 31223 1347419305 1 f none /usr/local/share/doc/postgresql/html/ddl-alter.html 0644 root root 10412 18193 1347419305 1 f none /usr/local/share/doc/postgresql/html/ddl-basics.html 0644 root root 7814 36594 1347419305 1 f none /usr/local/share/doc/postgresql/html/ddl-constraints.html 0644 root root 22383 25109 1347419305 1 f none /usr/local/share/doc/postgresql/html/ddl-default.html 0644 root root 4538 15232 1347419305 1 f none /usr/local/share/doc/postgresql/html/ddl-depend.html 0644 root root 5247 8571 1347419305 1 f none /usr/local/share/doc/postgresql/html/ddl-foreign-data.html 0644 root root 4483 18410 1347419305 1 f none /usr/local/share/doc/postgresql/html/ddl-inherit.html 0644 root root 15171 12329 1347419305 1 f none /usr/local/share/doc/postgresql/html/ddl-others.html 0644 root root 3078 29115 1347419305 1 f none /usr/local/share/doc/postgresql/html/ddl-partitioning.html 0644 root root 27761 62472 1347419305 1 f none /usr/local/share/doc/postgresql/html/ddl-priv.html 0644 root root 6064 3345 1347419305 1 f none /usr/local/share/doc/postgresql/html/ddl-schemas.html 0644 root root 18044 50485 1347419305 1 f none /usr/local/share/doc/postgresql/html/ddl-system-columns.html 0644 root root 8047 31236 1347419305 1 f none /usr/local/share/doc/postgresql/html/ddl.html 0644 root root 6222 3598 1347419305 1 f none /usr/local/share/doc/postgresql/html/dict-int.html 0644 root root 4791 33919 1347419305 1 f none /usr/local/share/doc/postgresql/html/dict-xsyn.html 0644 root root 6479 24063 1347419305 1 f none /usr/local/share/doc/postgresql/html/different-replication-solutions.html 0644 root root 14790 58665 1347419305 1 f none /usr/local/share/doc/postgresql/html/disk-full.html 0644 root root 3515 5910 1347419305 1 f none /usr/local/share/doc/postgresql/html/disk-usage.html 0644 root root 5659 30483 1347419305 1 f none /usr/local/share/doc/postgresql/html/diskusage.html 0644 root root 2666 60845 1347419305 1 f none /usr/local/share/doc/postgresql/html/dml-delete.html 0644 root root 3467 63548 1347419305 1 f none /usr/local/share/doc/postgresql/html/dml-insert.html 0644 root root 5367 15740 1347419305 1 f none /usr/local/share/doc/postgresql/html/dml-update.html 0644 root root 5554 34625 1347419305 1 f none /usr/local/share/doc/postgresql/html/dml.html 0644 root root 2858 12169 1347419305 1 f none /usr/local/share/doc/postgresql/html/docguide-authoring.html 0644 root root 6755 53625 1347419305 1 f none /usr/local/share/doc/postgresql/html/docguide-build.html 0644 root root 15797 50481 1347419305 1 f none /usr/local/share/doc/postgresql/html/docguide-docbook.html 0644 root root 3851 31764 1347419305 1 f none /usr/local/share/doc/postgresql/html/docguide-style.html 0644 root root 7427 54569 1347419305 1 f none /usr/local/share/doc/postgresql/html/docguide-toolsets.html 0644 root root 20670 50370 1347419305 1 f none /usr/local/share/doc/postgresql/html/docguide.html 0644 root root 3622 3070 1347419305 1 f none /usr/local/share/doc/postgresql/html/dummy-seclabel.html 0644 root root 4356 62424 1347419305 1 f none /usr/local/share/doc/postgresql/html/dynamic-trace.html 0644 root root 27232 22052 1347419305 1 f none /usr/local/share/doc/postgresql/html/earthdistance.html 0644 root root 8808 20292 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-commands.html 0644 root root 9525 46434 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-concept.html 0644 root root 4977 51238 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-connect.html 0644 root root 10874 26161 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-cpp.html 0644 root root 9623 4026 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-descriptors.html 0644 root root 34904 61899 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-develop.html 0644 root root 7962 2461 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-dynamic.html 0644 root root 6513 22690 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-errors.html 0644 root root 25735 3805 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-informix-compat.html 0644 root root 52757 50983 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-library.html 0644 root root 5796 37521 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-lo.html 0644 root root 5525 6736 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-pgtypes.html 0644 root root 54455 61511 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-preproc.html 0644 root root 8983 59454 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-process.html 0644 root root 5384 15551 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-allocate-descriptor.html 0644 root root 3981 19073 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-commands.html 0644 root root 4696 28092 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-connect.html 0644 root root 9383 22336 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-deallocate-descriptor.html 0644 root root 3771 1260 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-declare.html 0644 root root 5395 56651 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-describe.html 0644 root root 4593 62165 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-disconnect.html 0644 root root 4731 2607 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-execute-immediate.html 0644 root root 3875 11383 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-get-descriptor.html 0644 root root 7707 36308 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-open.html 0644 root root 4640 506 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-prepare.html 0644 root root 4175 32331 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-set-autocommit.html 0644 root root 3331 42661 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-set-connection.html 0644 root root 3927 13044 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-set-descriptor.html 0644 root root 5503 64400 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-type.html 0644 root root 5024 23620 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-var.html 0644 root root 3496 45517 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-sql-whenever.html 0644 root root 4684 6135 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg-variables.html 0644 root root 40692 13486 1347419305 1 f none /usr/local/share/doc/postgresql/html/ecpg.html 0644 root root 10342 56555 1347419305 1 f none /usr/local/share/doc/postgresql/html/encryption-options.html 0644 root root 7493 14418 1347419305 1 f none /usr/local/share/doc/postgresql/html/errcodes-appendix.html 0644 root root 36962 54129 1347419305 1 f none /usr/local/share/doc/postgresql/html/error-message-reporting.html 0644 root root 14122 51893 1347419305 1 f none /usr/local/share/doc/postgresql/html/error-style-guide.html 0644 root root 16767 16343 1347419305 1 f none /usr/local/share/doc/postgresql/html/event-log-registration.html 0644 root root 4186 46312 1347419305 1 f none /usr/local/share/doc/postgresql/html/executor.html 0644 root root 6610 59293 1347419305 1 f none /usr/local/share/doc/postgresql/html/explicit-joins.html 0644 root root 11017 34463 1347419305 1 f none /usr/local/share/doc/postgresql/html/explicit-locking.html 0644 root root 25071 7541 1347419305 1 f none /usr/local/share/doc/postgresql/html/extend-extensions.html 0644 root root 30976 29531 1347419305 1 f none /usr/local/share/doc/postgresql/html/extend-how.html 0644 root root 4550 19370 1347419305 1 f none /usr/local/share/doc/postgresql/html/extend-pgxs.html 0644 root root 11759 16607 1347419305 1 f none /usr/local/share/doc/postgresql/html/extend-type-system.html 0644 root root 10091 8272 1347419305 1 f none /usr/local/share/doc/postgresql/html/extend.html 0644 root root 9962 9826 1347419305 1 f none /usr/local/share/doc/postgresql/html/external-admin-tools.html 0644 root root 2720 3004 1347419305 1 f none /usr/local/share/doc/postgresql/html/external-extensions.html 0644 root root 3265 48261 1347419305 1 f none /usr/local/share/doc/postgresql/html/external-interfaces.html 0644 root root 5034 49972 1347419305 1 f none /usr/local/share/doc/postgresql/html/external-pl.html 0644 root root 4684 27128 1347419305 1 f none /usr/local/share/doc/postgresql/html/external-projects.html 0644 root root 3002 23635 1347419305 1 f none /usr/local/share/doc/postgresql/html/fdw-callbacks.html 0644 root root 12903 27799 1347419305 1 f none /usr/local/share/doc/postgresql/html/fdw-functions.html 0644 root root 4494 19533 1347419305 1 f none /usr/local/share/doc/postgresql/html/fdw-helpers.html 0644 root root 5991 4452 1347419305 1 f none /usr/local/share/doc/postgresql/html/fdw-planning.html 0644 root root 9778 47332 1347419305 1 f none /usr/local/share/doc/postgresql/html/fdwhandler.html 0644 root root 3988 41385 1347419305 1 f none /usr/local/share/doc/postgresql/html/features-sql-standard.html 0644 root root 39103 14481 1347419305 1 f none /usr/local/share/doc/postgresql/html/features.html 0644 root root 7564 9625 1347419305 1 f none /usr/local/share/doc/postgresql/html/file-fdw.html 0644 root root 7712 58087 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-admin.html 0644 root root 49493 36162 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-aggregate.html 0644 root root 21859 13759 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-array.html 0644 root root 13519 45754 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-binarystring.html 0644 root root 12398 12560 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-bitstring.html 0644 root root 6784 22860 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-comparison.html 0644 root root 10613 57307 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-comparisons.html 0644 root root 13529 58586 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-conditional.html 0644 root root 10304 32310 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-datetime.html 0644 root root 47937 53236 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-enum.html 0644 root root 5489 20297 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-formatting.html 0644 root root 32857 32734 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-geometry.html 0644 root root 20333 63933 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-info.html 0644 root root 56697 53931 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-json.html 0644 root root 3812 13080 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-logical.html 0644 root root 4663 60054 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-matching.html 0644 root root 72431 51062 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-math.html 0644 root root 19762 13875 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-net.html 0644 root root 13500 9178 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-range.html 0644 root root 10855 35465 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-sequence.html 0644 root root 12974 6610 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-srf.html 0644 root root 8838 42184 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-string.html 0644 root root 58886 5516 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-subquery.html 0644 root root 16379 38152 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-textsearch.html 0644 root root 20486 54268 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-trigger.html 0644 root root 4546 26651 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-window.html 0644 root root 11863 2448 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions-xml.html 0644 root root 32167 12340 1347419305 1 f none /usr/local/share/doc/postgresql/html/functions.html 0644 root root 9937 28693 1347419305 1 f none /usr/local/share/doc/postgresql/html/fuzzystrmatch.html 0644 root root 8059 30085 1347419305 1 f none /usr/local/share/doc/postgresql/html/geqo-biblio.html 0644 root root 3457 56106 1347419305 1 f none /usr/local/share/doc/postgresql/html/geqo-intro.html 0644 root root 4413 13599 1347419305 1 f none /usr/local/share/doc/postgresql/html/geqo-intro2.html 0644 root root 5625 11761 1347419305 1 f none /usr/local/share/doc/postgresql/html/geqo-pg-intro.html 0644 root root 8783 33494 1347419305 1 f none /usr/local/share/doc/postgresql/html/geqo.html 0644 root root 3614 2769 1347419305 1 f none /usr/local/share/doc/postgresql/html/gin-examples.html 0644 root root 3320 44018 1347419305 1 f none /usr/local/share/doc/postgresql/html/gin-extensibility.html 0644 root root 14400 5995 1347419305 1 f none /usr/local/share/doc/postgresql/html/gin-implementation.html 0644 root root 6562 57976 1347419305 1 f none /usr/local/share/doc/postgresql/html/gin-intro.html 0644 root root 4660 30600 1347419305 1 f none /usr/local/share/doc/postgresql/html/gin-limit.html 0644 root root 2815 9420 1347419305 1 f none /usr/local/share/doc/postgresql/html/gin-tips.html 0644 root root 5711 46617 1347419305 1 f none /usr/local/share/doc/postgresql/html/gin.html 0644 root root 2927 13426 1347419305 1 f none /usr/local/share/doc/postgresql/html/gist-examples.html 0644 root root 3750 13009 1347419305 1 f none /usr/local/share/doc/postgresql/html/gist-extensibility.html 0644 root root 24352 48602 1347419305 1 f none /usr/local/share/doc/postgresql/html/gist-implementation.html 0644 root root 4099 56141 1347419305 1 f none /usr/local/share/doc/postgresql/html/gist-intro.html 0644 root root 3614 10519 1347419305 1 f none /usr/local/share/doc/postgresql/html/gist.html 0644 root root 2677 62929 1347419305 1 f none /usr/local/share/doc/postgresql/html/git.html 0644 root root 4560 16401 1347419305 1 f none /usr/local/share/doc/postgresql/html/high-availability.html 0644 root root 7805 41316 1347419305 1 f none /usr/local/share/doc/postgresql/html/history.html 0644 root root 11916 57230 1347419305 1 f none /usr/local/share/doc/postgresql/html/hot-standby.html 0644 root root 36067 40101 1347419305 1 f none /usr/local/share/doc/postgresql/html/hstore.html 0644 root root 22627 59773 1347419305 1 f none /usr/local/share/doc/postgresql/html/index-catalog.html 0644 root root 7994 50917 1347419305 1 f none /usr/local/share/doc/postgresql/html/index-cost-estimation.html 0644 root root 9989 3066 1347419305 1 f none /usr/local/share/doc/postgresql/html/index-functions.html 0644 root root 19112 24480 1347419305 1 f none /usr/local/share/doc/postgresql/html/index-locking.html 0644 root root 8047 59264 1347419305 1 f none /usr/local/share/doc/postgresql/html/index-scanning.html 0644 root root 10705 13228 1347419305 1 f none /usr/local/share/doc/postgresql/html/index-unique-checks.html 0644 root root 9190 19093 1347419305 1 f none /usr/local/share/doc/postgresql/html/index.html 0644 root root 8069 9966 1347419305 1 f none /usr/local/share/doc/postgresql/html/indexam.html 0644 root root 5245 18834 1347419305 1 f none /usr/local/share/doc/postgresql/html/indexes-bitmap-scans.html 0644 root root 6578 63228 1347419305 1 f none /usr/local/share/doc/postgresql/html/indexes-collations.html 0644 root root 3638 10565 1347419305 1 f none /usr/local/share/doc/postgresql/html/indexes-examine.html 0644 root root 7159 45831 1347419305 1 f none /usr/local/share/doc/postgresql/html/indexes-expressional.html 0644 root root 4811 45369 1347419305 1 f none /usr/local/share/doc/postgresql/html/indexes-intro.html 0644 root root 6311 36733 1347419305 1 f none /usr/local/share/doc/postgresql/html/indexes-multicolumn.html 0644 root root 6296 36601 1347419305 1 f none /usr/local/share/doc/postgresql/html/indexes-opclass.html 0644 root root 7334 45520 1347419305 1 f none /usr/local/share/doc/postgresql/html/indexes-ordering.html 0644 root root 6478 42167 1347419305 1 f none /usr/local/share/doc/postgresql/html/indexes-partial.html 0644 root root 11810 33444 1347419305 1 f none /usr/local/share/doc/postgresql/html/indexes-types.html 0644 root root 10075 41424 1347419305 1 f none /usr/local/share/doc/postgresql/html/indexes-unique.html 0644 root root 4000 42738 1347419305 1 f none /usr/local/share/doc/postgresql/html/indexes.html 0644 root root 3617 5642 1347419305 1 f none /usr/local/share/doc/postgresql/html/information-schema.html 0644 root root 11175 8620 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-administrable-role-authorizations.html 0644 root root 3749 15714 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-applicable-roles.html 0644 root root 3968 32621 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-attributes.html 0644 root root 12805 57623 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-character-sets.html 0644 root root 7048 12874 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-check-constraint-routine-usage.html 0644 root root 4347 62462 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-check-constraints.html 0644 root root 3874 26607 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-collation-character-set-applicab.html 0644 root root 4423 5684 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-collations.html 0644 root root 3883 24865 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-column-domain-usage.html 0644 root root 4320 59814 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-column-options.html 0644 root root 4107 42303 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-column-privileges.html 0644 root root 5027 42711 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-column-udt-usage.html 0644 root root 4581 10125 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-columns.html 0644 root root 17623 36921 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-constraint-column-usage.html 0644 root root 4871 39769 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-constraint-table-usage.html 0644 root root 4772 35319 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-data-type-privileges.html 0644 root root 5087 61687 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-datatypes.html 0644 root root 4227 55379 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-domain-constraints.html 0644 root root 4662 19431 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-domain-udt-usage.html 0644 root root 4169 45635 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-domains.html 0644 root root 11365 11653 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-element-types.html 0644 root root 11372 12813 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-enabled-roles.html 0644 root root 3778 20722 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-foreign-data-wrapper-options.html 0644 root root 3908 29633 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-foreign-data-wrappers.html 0644 root root 4225 58014 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-foreign-server-options.html 0644 root root 3851 24815 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-foreign-servers.html 0644 root root 4569 18820 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-foreign-table-options.html 0644 root root 4345 61703 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-foreign-tables.html 0644 root root 4070 41660 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-information-schema-catalog-name.html 0644 root root 3355 53876 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-key-column-usage.html 0644 root root 5183 60818 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-parameters.html 0644 root root 10797 30414 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-referential-constraints.html 0644 root root 5662 22898 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-role-column-grants.html 0644 root root 5015 45521 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-role-routine-grants.html 0644 root root 5358 8199 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-role-table-grants.html 0644 root root 5425 4616 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-role-udt-grants.html 0644 root root 4779 27252 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-role-usage-grants.html 0644 root root 5008 41909 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-routine-privileges.html 0644 root root 5030 45839 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-routines.html 0644 root root 23050 34943 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-schema.html 0644 root root 3178 44529 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-schemata.html 0644 root root 4246 47900 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-sequences.html 0644 root root 6109 60560 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-sql-features.html 0644 root root 4706 22139 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-sql-implementation-info.html 0644 root root 4501 11723 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-sql-languages.html 0644 root root 5092 47020 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-sql-packages.html 0644 root root 4176 43129 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-sql-parts.html 0644 root root 4078 34192 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-sql-sizing-profiles.html 0644 root root 4175 47302 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-sql-sizing.html 0644 root root 4099 43401 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-table-constraints.html 0644 root root 4912 33315 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-table-privileges.html 0644 root root 5095 41865 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-tables.html 0644 root root 5955 46037 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-triggered-update-columns.html 0644 root root 4552 10443 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-triggers.html 0644 root root 9445 58764 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-udt-privileges.html 0644 root root 4509 4659 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-usage-privileges.html 0644 root root 5510 16156 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-user-defined-types.html 0644 root root 9751 12358 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-user-mapping-options.html 0644 root root 4447 6842 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-user-mappings.html 0644 root root 3831 23756 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-view-column-usage.html 0644 root root 4726 22243 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-view-routine-usage.html 0644 root root 4366 61771 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-view-table-usage.html 0644 root root 4387 58862 1347419305 1 f none /usr/local/share/doc/postgresql/html/infoschema-views.html 0644 root root 5527 3259 1347419305 1 f none /usr/local/share/doc/postgresql/html/install-getsource.html 0644 root root 3473 64928 1347419305 1 f none /usr/local/share/doc/postgresql/html/install-post.html 0644 root root 8068 20979 1347419305 1 f none /usr/local/share/doc/postgresql/html/install-procedure.html 0644 root root 45024 63785 1347419305 1 f none /usr/local/share/doc/postgresql/html/install-requirements.html 0644 root root 14392 39522 1347419305 1 f none /usr/local/share/doc/postgresql/html/install-short.html 0644 root root 2868 18122 1347419305 1 f none /usr/local/share/doc/postgresql/html/install-windows-full.html 0644 root root 18981 34755 1347419305 1 f none /usr/local/share/doc/postgresql/html/install-windows-libpq.html 0644 root root 6281 13266 1347419305 1 f none /usr/local/share/doc/postgresql/html/install-windows.html 0644 root root 6620 46278 1347419305 1 f none /usr/local/share/doc/postgresql/html/installation-platform-notes.html 0644 root root 39366 53400 1347419305 1 f none /usr/local/share/doc/postgresql/html/installation.html 0644 root root 4158 46609 1347419305 1 f none /usr/local/share/doc/postgresql/html/intagg.html 0644 root root 6252 22527 1347419305 1 f none /usr/local/share/doc/postgresql/html/intarray.html 0644 root root 13751 34439 1347419305 1 f none /usr/local/share/doc/postgresql/html/internals.html 0644 root root 15544 34175 1347419305 1 f none /usr/local/share/doc/postgresql/html/intro-whatis.html 0644 root root 4009 32997 1347419305 1 f none /usr/local/share/doc/postgresql/html/isn.html 0644 root root 13354 22377 1347419305 1 f none /usr/local/share/doc/postgresql/html/kernel-resources.html 0644 root root 37936 61251 1347419305 1 f none /usr/local/share/doc/postgresql/html/largeobjects.html 0644 root root 4673 22851 1347419305 1 f none /usr/local/share/doc/postgresql/html/libpq-async.html 0644 root root 20513 50045 1347419305 1 f none /usr/local/share/doc/postgresql/html/libpq-build.html 0644 root root 6367 22860 1347419305 1 f none /usr/local/share/doc/postgresql/html/libpq-cancel.html 0644 root root 6775 44727 1347419305 1 f none /usr/local/share/doc/postgresql/html/libpq-connect.html 0644 root root 51022 1143 1347419305 1 f none /usr/local/share/doc/postgresql/html/libpq-control.html 0644 root root 6278 8328 1347419305 1 f none /usr/local/share/doc/postgresql/html/libpq-copy.html 0644 root root 22440 60308 1347419305 1 f none /usr/local/share/doc/postgresql/html/libpq-envars.html 0644 root root 10176 25815 1347419305 1 f none /usr/local/share/doc/postgresql/html/libpq-events.html 0644 root root 23091 39346 1347419305 1 f none /usr/local/share/doc/postgresql/html/libpq-example.html 0644 root root 16022 59905 1347419305 1 f none /usr/local/share/doc/postgresql/html/libpq-exec.html 0644 root root 64802 23972 1347419305 1 f none /usr/local/share/doc/postgresql/html/libpq-fastpath.html 0644 root root 5654 39060 1347419305 1 f none /usr/local/share/doc/postgresql/html/libpq-ldap.html 0644 root root 5504 28999 1347419305 1 f none /usr/local/share/doc/postgresql/html/libpq-misc.html 0644 root root 13813 3094 1347419305 1 f none /usr/local/share/doc/postgresql/html/libpq-notice-processing.html 0644 root root 6282 36285 1347419305 1 f none /usr/local/share/doc/postgresql/html/libpq-notify.html 0644 root root 6713 54290 1347419305 1 f none /usr/local/share/doc/postgresql/html/libpq-pgpass.html 0644 root root 4859 42499 1347419305 1 f none /usr/local/share/doc/postgresql/html/libpq-pgservice.html 0644 root root 3882 31953 1347419305 1 f none /usr/local/share/doc/postgresql/html/libpq-single-row-mode.html 0644 root root 6351 28724 1347419305 1 f none /usr/local/share/doc/postgresql/html/libpq-ssl.html 0644 root root 19969 48565 1347419305 1 f none /usr/local/share/doc/postgresql/html/libpq-status.html 0644 root root 17693 21816 1347419305 1 f none /usr/local/share/doc/postgresql/html/libpq-threading.html 0644 root root 5542 27026 1347419305 1 f none /usr/local/share/doc/postgresql/html/libpq.html 0644 root root 7916 4769 1347419305 1 f none /usr/local/share/doc/postgresql/html/lo-examplesect.html 0644 root root 8694 29565 1347419305 1 f none /usr/local/share/doc/postgresql/html/lo-funcs.html 0644 root root 4219 57571 1347419305 1 f none /usr/local/share/doc/postgresql/html/lo-implementation.html 0644 root root 3351 52804 1347419305 1 f none /usr/local/share/doc/postgresql/html/lo-interfaces.html 0644 root root 15153 27811 1347419305 1 f none /usr/local/share/doc/postgresql/html/lo-intro.html 0644 root root 3204 41975 1347419305 1 f none /usr/local/share/doc/postgresql/html/lo.html 0644 root root 6625 45931 1347419305 1 f none /usr/local/share/doc/postgresql/html/locale.html 0644 root root 13689 24185 1347419305 1 f none /usr/local/share/doc/postgresql/html/locking-indexes.html 0644 root root 4495 17132 1347419305 1 f none /usr/local/share/doc/postgresql/html/log-shipping-alternative.html 0644 root root 11055 39202 1347419305 1 f none /usr/local/share/doc/postgresql/html/logfile-maintenance.html 0644 root root 7144 36285 1347419305 1 f none /usr/local/share/doc/postgresql/html/ltree.html 0644 root root 27293 8462 1347419305 1 f none /usr/local/share/doc/postgresql/html/maintenance.html 0644 root root 5539 35988 1347419305 1 f none /usr/local/share/doc/postgresql/html/manage-ag-config.html 0644 root root 3744 20458 1347419305 1 f none /usr/local/share/doc/postgresql/html/manage-ag-createdb.html 0644 root root 6308 22091 1347419305 1 f none /usr/local/share/doc/postgresql/html/manage-ag-dropdb.html 0644 root root 3603 5981 1347419305 1 f none /usr/local/share/doc/postgresql/html/manage-ag-overview.html 0644 root root 5142 4927 1347419305 1 f none /usr/local/share/doc/postgresql/html/manage-ag-tablespaces.html 0644 root root 9156 14126 1347419305 1 f none /usr/local/share/doc/postgresql/html/manage-ag-templatedbs.html 0644 root root 8160 44006 1347419305 1 f none /usr/local/share/doc/postgresql/html/managing-databases.html 0644 root root 3271 44618 1347419305 1 f none /usr/local/share/doc/postgresql/html/monitoring-locks.html 0644 root root 3671 14216 1347419305 1 f none /usr/local/share/doc/postgresql/html/monitoring-ps.html 0644 root root 6780 61275 1347419305 1 f none /usr/local/share/doc/postgresql/html/monitoring-stats.html 0644 root root 58061 37060 1347419305 1 f none /usr/local/share/doc/postgresql/html/monitoring.html 0644 root root 4456 6630 1347419305 1 f none /usr/local/share/doc/postgresql/html/multibyte.html 0644 root root 32225 45488 1347419305 1 f none /usr/local/share/doc/postgresql/html/mvcc-intro.html 0644 root root 4550 26454 1347419305 1 f none /usr/local/share/doc/postgresql/html/mvcc.html 0644 root root 4242 55528 1347419305 1 f none /usr/local/share/doc/postgresql/html/nls-programmer.html 0644 root root 10076 47254 1347419305 1 f none /usr/local/share/doc/postgresql/html/nls-translator.html 0644 root root 14528 41982 1347419305 1 f none /usr/local/share/doc/postgresql/html/nls.html 0644 root root 3132 30388 1347419305 1 f none /usr/local/share/doc/postgresql/html/non-durability.html 0644 root root 4483 12023 1347419305 1 f none /usr/local/share/doc/postgresql/html/notation.html 0644 root root 4413 8982 1347419305 1 f none /usr/local/share/doc/postgresql/html/oid2name.html 0644 root root 11960 8478 1347419305 1 f none /usr/local/share/doc/postgresql/html/overview.html 0644 root root 4091 44521 1347419305 1 f none /usr/local/share/doc/postgresql/html/pageinspect.html 0644 root root 8046 59655 1347419305 1 f none /usr/local/share/doc/postgresql/html/parser-stage.html 0644 root root 8115 31206 1347419305 1 f none /usr/local/share/doc/postgresql/html/passwordcheck.html 0644 root root 4786 42384 1347419305 1 f none /usr/local/share/doc/postgresql/html/performance-tips.html 0644 root root 4499 64617 1347419305 1 f none /usr/local/share/doc/postgresql/html/perm-functions.html 0644 root root 3348 59492 1347419305 1 f none /usr/local/share/doc/postgresql/html/pgarchivecleanup.html 0644 root root 9153 32166 1347419305 1 f none /usr/local/share/doc/postgresql/html/pgbench.html 0644 root root 30830 20817 1347419305 1 f none /usr/local/share/doc/postgresql/html/pgbuffercache.html 0644 root root 7633 34911 1347419305 1 f none /usr/local/share/doc/postgresql/html/pgcrypto.html 0644 root root 38487 31742 1347419305 1 f none /usr/local/share/doc/postgresql/html/pgfreespacemap.html 0644 root root 5228 53380 1347419305 1 f none /usr/local/share/doc/postgresql/html/pgrowlocks.html 0644 root root 6076 49410 1347419305 1 f none /usr/local/share/doc/postgresql/html/pgstandby.html 0644 root root 15202 38310 1347419305 1 f none /usr/local/share/doc/postgresql/html/pgstatstatements.html 0644 root root 16066 48547 1347419305 1 f none /usr/local/share/doc/postgresql/html/pgstattuple.html 0644 root root 8654 40398 1347419305 1 f none /usr/local/share/doc/postgresql/html/pgtestfsync.html 0644 root root 5252 54958 1347419305 1 f none /usr/local/share/doc/postgresql/html/pgtesttiming.html 0644 root root 12474 62936 1347419305 1 f none /usr/local/share/doc/postgresql/html/pgtrgm.html 0644 root root 12331 22245 1347419305 1 f none /usr/local/share/doc/postgresql/html/pgupgrade.html 0644 root root 24293 33768 1347419305 1 f none /usr/local/share/doc/postgresql/html/planner-optimizer.html 0644 root root 9394 33298 1347419305 1 f none /usr/local/share/doc/postgresql/html/planner-stats-details.html 0644 root root 3024 31396 1347419305 1 f none /usr/local/share/doc/postgresql/html/planner-stats.html 0644 root root 9056 20122 1347419305 1 f none /usr/local/share/doc/postgresql/html/plhandler.html 0644 root root 12836 50845 1347419305 1 f none /usr/local/share/doc/postgresql/html/plperl-builtins.html 0644 root root 18274 40619 1347419305 1 f none /usr/local/share/doc/postgresql/html/plperl-data.html 0644 root root 2876 15594 1347419305 1 f none /usr/local/share/doc/postgresql/html/plperl-funcs.html 0644 root root 13367 58177 1347419305 1 f none /usr/local/share/doc/postgresql/html/plperl-global.html 0644 root root 5065 56645 1347419305 1 f none /usr/local/share/doc/postgresql/html/plperl-triggers.html 0644 root root 6444 64627 1347419305 1 f none /usr/local/share/doc/postgresql/html/plperl-trusted.html 0644 root root 6710 62670 1347419305 1 f none /usr/local/share/doc/postgresql/html/plperl-under-the-hood.html 0644 root root 8989 39328 1347419305 1 f none /usr/local/share/doc/postgresql/html/plperl.html 0644 root root 4928 43554 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpgsql-control-structures.html 0644 root root 46184 30959 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpgsql-cursors.html 0644 root root 25584 59790 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpgsql-declarations.html 0644 root root 21731 29608 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpgsql-development-tips.html 0644 root root 9509 7499 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpgsql-errors-and-messages.html 0644 root root 10092 23678 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpgsql-expressions.html 0644 root root 4660 18503 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpgsql-implementation.html 0644 root root 18041 49004 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpgsql-overview.html 0644 root root 9030 33993 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpgsql-porting.html 0644 root root 27092 22236 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpgsql-statements.html 0644 root root 32219 23055 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpgsql-structure.html 0644 root root 7372 31104 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpgsql-trigger.html 0644 root root 22320 60092 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpgsql.html 0644 root root 6963 61431 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpython-data.html 0644 root root 14646 63134 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpython-database.html 0644 root root 15347 4877 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpython-do.html 0644 root root 2769 6934 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpython-envar.html 0644 root root 3883 24959 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpython-funcs.html 0644 root root 5476 24342 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpython-python23.html 0644 root root 7205 40471 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpython-sharing.html 0644 root root 3030 26970 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpython-subtransaction.html 0644 root root 7886 32353 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpython-trigger.html 0644 root root 5067 30321 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpython-util.html 0644 root root 5102 54240 1347419305 1 f none /usr/local/share/doc/postgresql/html/plpython.html 0644 root root 6065 2245 1347419305 1 f none /usr/local/share/doc/postgresql/html/pltcl-data.html 0644 root root 2904 16638 1347419305 1 f none /usr/local/share/doc/postgresql/html/pltcl-dbaccess.html 0644 root root 13579 18915 1347419305 1 f none /usr/local/share/doc/postgresql/html/pltcl-functions.html 0644 root root 6175 4328 1347419305 1 f none /usr/local/share/doc/postgresql/html/pltcl-global.html 0644 root root 5064 63960 1347419305 1 f none /usr/local/share/doc/postgresql/html/pltcl-overview.html 0644 root root 5284 12177 1347419305 1 f none /usr/local/share/doc/postgresql/html/pltcl-procnames.html 0644 root root 3220 43397 1347419305 1 f none /usr/local/share/doc/postgresql/html/pltcl-trigger.html 0644 root root 8738 50578 1347419305 1 f none /usr/local/share/doc/postgresql/html/pltcl-unknown.html 0644 root root 5073 57673 1347419305 1 f none /usr/local/share/doc/postgresql/html/pltcl.html 0644 root root 3398 52290 1347419305 1 f none /usr/local/share/doc/postgresql/html/populate.html 0644 root root 17112 23059 1347419305 1 f none /usr/local/share/doc/postgresql/html/postgres-user.html 0644 root root 3312 52082 1347419305 1 f none /usr/local/share/doc/postgresql/html/preface.html 0644 root root 5065 53060 1347419305 1 f none /usr/local/share/doc/postgresql/html/preventing-server-spoofing.html 0644 root root 4598 32846 1347419305 1 f none /usr/local/share/doc/postgresql/html/protocol-changes.html 0644 root root 6648 20146 1347419305 1 f none /usr/local/share/doc/postgresql/html/protocol-error-fields.html 0644 root root 6129 5619 1347419305 1 f none /usr/local/share/doc/postgresql/html/protocol-flow.html 0644 root root 46200 36869 1347419305 1 f none /usr/local/share/doc/postgresql/html/protocol-message-formats.html 0644 root root 40842 51631 1347419305 1 f none /usr/local/share/doc/postgresql/html/protocol-message-types.html 0644 root root 4931 25761 1347419305 1 f none /usr/local/share/doc/postgresql/html/protocol-overview.html 0644 root root 9668 9077 1347419305 1 f none /usr/local/share/doc/postgresql/html/protocol-replication.html 0644 root root 14262 22077 1347419305 1 f none /usr/local/share/doc/postgresql/html/protocol.html 0644 root root 5650 38271 1347419305 1 f none /usr/local/share/doc/postgresql/html/queries-limit.html 0644 root root 5333 2072 1347419305 1 f none /usr/local/share/doc/postgresql/html/queries-order.html 0644 root root 7367 26762 1347419305 1 f none /usr/local/share/doc/postgresql/html/queries-overview.html 0644 root root 5066 56278 1347419305 1 f none /usr/local/share/doc/postgresql/html/queries-select-lists.html 0644 root root 9216 53254 1347419305 1 f none /usr/local/share/doc/postgresql/html/queries-table-expressions.html 0644 root root 36620 34313 1347419305 1 f none /usr/local/share/doc/postgresql/html/queries-union.html 0644 root root 5112 45989 1347419305 1 f none /usr/local/share/doc/postgresql/html/queries-values.html 0644 root root 4928 36021 1347419305 1 f none /usr/local/share/doc/postgresql/html/queries-with.html 0644 root root 20819 39895 1347419305 1 f none /usr/local/share/doc/postgresql/html/queries.html 0644 root root 4347 52593 1347419305 1 f none /usr/local/share/doc/postgresql/html/query-path.html 0644 root root 5468 20161 1347419305 1 f none /usr/local/share/doc/postgresql/html/querytree.html 0644 root root 11134 4033 1347419305 1 f none /usr/local/share/doc/postgresql/html/rangetypes.html 0644 root root 22687 25382 1347419305 1 f none /usr/local/share/doc/postgresql/html/recovery-config.html 0644 root root 3548 1950 1347419305 1 f none /usr/local/share/doc/postgresql/html/recovery-target-settings.html 0644 root root 7760 7853 1347419305 1 f none /usr/local/share/doc/postgresql/html/reference-client.html 0644 root root 6100 1481 1347419305 1 f none /usr/local/share/doc/postgresql/html/reference-server.html 0644 root root 3962 30986 1347419305 1 f none /usr/local/share/doc/postgresql/html/reference.html 0644 root root 23160 2318 1347419305 1 f none /usr/local/share/doc/postgresql/html/regress-coverage.html 0644 root root 3323 52205 1347419305 1 f none /usr/local/share/doc/postgresql/html/regress-evaluation.html 0644 root root 11604 11110 1347419305 1 f none /usr/local/share/doc/postgresql/html/regress-run.html 0644 root root 12226 188 1347419305 1 f none /usr/local/share/doc/postgresql/html/regress-variant.html 0644 root root 7175 41158 1347419305 1 f none /usr/local/share/doc/postgresql/html/regress.html 0644 root root 4100 38612 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-0-01.html 0644 root root 2587 51644 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-0-02.html 0644 root root 4323 61994 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-0-03.html 0644 root root 7830 33307 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-1-0.html 0644 root root 4261 60988 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-1-01.html 0644 root root 9378 20962 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-1-02.html 0644 root root 6521 40750 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-1-09.html 0644 root root 2557 48014 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-6-0.html 0644 root root 7952 2794 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-6-1-1.html 0644 root root 3751 21175 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-6-1.html 0644 root root 9059 27582 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-6-2-1.html 0644 root root 4437 7259 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-6-2.html 0644 root root 8915 5084 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-6-3-1.html 0644 root root 4476 14574 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-6-3-2.html 0644 root root 4189 54647 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-6-3.html 0644 root root 16344 40850 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-6-4-1.html 0644 root root 4093 46925 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-6-4-2.html 0644 root root 2940 8890 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-6-4.html 0644 root root 14765 5239 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-6-5-1.html 0644 root root 3874 25241 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-6-5-2.html 0644 root root 4134 48685 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-6-5-3.html 0644 root root 3085 18900 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-6-5.html 0644 root root 17419 56598 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-0-1.html 0644 root root 3952 31008 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-0-2.html 0644 root root 2919 5086 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-0-3.html 0644 root root 4688 30216 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-0.html 0644 root root 23136 25041 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-1-1.html 0644 root root 3294 37433 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-1-2.html 0644 root root 3007 13119 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-1-3.html 0644 root root 3171 27581 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-1.html 0644 root root 13049 27112 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-2-1.html 0644 root root 4043 31682 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-2-2.html 0644 root root 3825 11351 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-2-3.html 0644 root root 3396 44903 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-2-4.html 0644 root root 3619 64971 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-2-5.html 0644 root root 3778 13693 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-2-6.html 0644 root root 3656 6039 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-2-7.html 0644 root root 3758 13926 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-2-8.html 0644 root root 3980 30556 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-2.html 0644 root root 27130 38107 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-3-1.html 0644 root root 4200 44473 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-3-10.html 0644 root root 7525 63600 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-3-11.html 0644 root root 4122 38225 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-3-12.html 0644 root root 3538 57017 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-3-13.html 0644 root root 4629 18899 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-3-14.html 0644 root root 3942 25854 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-3-15.html 0644 root root 6326 25539 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-3-16.html 0644 root root 3435 47422 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-3-17.html 0644 root root 3561 51809 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-3-18.html 0644 root root 3658 963 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-3-19.html 0644 root root 3697 1312 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-3-2.html 0644 root root 5237 536 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-3-20.html 0644 root root 3535 51596 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-3-21.html 0644 root root 6227 4984 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-3-3.html 0644 root root 10322 3045 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-3-4.html 0644 root root 3534 56477 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-3-5.html 0644 root root 4525 9287 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-3-6.html 0644 root root 4460 9581 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-3-7.html 0644 root root 3384 48231 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-3-8.html 0644 root root 3603 1839 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-3-9.html 0644 root root 4111 44070 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-3.html 0644 root root 33085 20492 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-1.html 0644 root root 7148 19769 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-10.html 0644 root root 3817 14760 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-11.html 0644 root root 4868 38903 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-12.html 0644 root root 4232 48333 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-13.html 0644 root root 6972 12724 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-14.html 0644 root root 3684 739 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-15.html 0644 root root 4281 38908 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-16.html 0644 root root 3983 26575 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-17.html 0644 root root 4024 25423 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-18.html 0644 root root 3938 16700 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-19.html 0644 root root 7253 16511 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-2.html 0644 root root 8292 46338 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-20.html 0644 root root 6616 26933 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-21.html 0644 root root 3933 20065 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-22.html 0644 root root 4082 28479 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-23.html 0644 root root 4434 60084 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-24.html 0644 root root 4300 43570 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-25.html 0644 root root 4517 4669 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-26.html 0644 root root 5466 85 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-27.html 0644 root root 5175 53062 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-28.html 0644 root root 5640 22180 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-29.html 0644 root root 6971 383 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-3.html 0644 root root 4647 16143 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-30.html 0644 root root 6222 14189 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-4.html 0644 root root 4117 40254 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-5.html 0644 root root 3226 33531 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-6.html 0644 root root 4763 28567 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-7.html 0644 root root 4306 60111 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-8.html 0644 root root 10188 16285 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4-9.html 0644 root root 5129 52969 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-7-4.html 0644 root root 57409 5729 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-1.html 0644 root root 4776 31681 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-10.html 0644 root root 4762 9634 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-11.html 0644 root root 3980 25763 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-12.html 0644 root root 3145 23832 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-13.html 0644 root root 4129 33438 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-14.html 0644 root root 4529 62735 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-15.html 0644 root root 9112 29063 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-16.html 0644 root root 8957 5122 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-17.html 0644 root root 3931 20001 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-18.html 0644 root root 5590 13313 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-19.html 0644 root root 4987 36425 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-2.html 0644 root root 9598 15885 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-20.html 0644 root root 4323 46637 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-21.html 0644 root root 4515 4462 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-22.html 0644 root root 6451 6542 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-23.html 0644 root root 6034 54441 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-24.html 0644 root root 7013 63923 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-25.html 0644 root root 7438 36790 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-26.html 0644 root root 8037 21518 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-3.html 0644 root root 7457 55820 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-4.html 0644 root root 6691 43668 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-5.html 0644 root root 4827 33150 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-6.html 0644 root root 5705 46499 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-7.html 0644 root root 5920 47699 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-8.html 0644 root root 7236 34033 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0-9.html 0644 root root 4317 48486 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-0.html 0644 root root 66850 58259 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-1.html 0644 root root 5488 19717 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-10.html 0644 root root 4789 16921 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-11.html 0644 root root 9954 26297 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-12.html 0644 root root 9349 35284 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-13.html 0644 root root 4300 45828 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-14.html 0644 root root 6909 52277 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-15.html 0644 root root 6282 3536 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-16.html 0644 root root 5286 60129 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-17.html 0644 root root 6043 59072 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-18.html 0644 root root 6450 6594 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-19.html 0644 root root 6620 34498 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-2.html 0644 root root 6364 32977 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-20.html 0644 root root 7306 21622 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-21.html 0644 root root 7221 19219 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-22.html 0644 root root 8332 44893 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-23.html 0644 root root 7941 65292 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-3.html 0644 root root 7034 5858 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-4.html 0644 root root 8881 37956 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-5.html 0644 root root 5487 9479 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-6.html 0644 root root 5345 53556 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-7.html 0644 root root 4566 6310 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-8.html 0644 root root 3124 22933 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1-9.html 0644 root root 4396 54424 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-1.html 0644 root root 62145 26657 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-1.html 0644 root root 5093 34876 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-10.html 0644 root root 8187 19095 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-11.html 0644 root root 7154 3172 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-12.html 0644 root root 6755 41908 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-13.html 0644 root root 7355 26235 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-14.html 0644 root root 7883 51717 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-15.html 0644 root root 8162 25663 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-16.html 0644 root root 9300 43262 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-17.html 0644 root root 8221 29892 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-18.html 0644 root root 10284 892 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-19.html 0644 root root 8596 44938 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-2.html 0644 root root 5830 33832 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-20.html 0644 root root 6251 4157 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-21.html 0644 root root 5600 19524 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-22.html 0644 root root 9624 61231 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-23.html 0644 root root 9566 7862 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-3.html 0644 root root 3123 22178 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-4.html 0644 root root 5456 113 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-5.html 0644 root root 6023 41215 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-6.html 0644 root root 10579 1772 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-7.html 0644 root root 9339 44374 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-8.html 0644 root root 7528 25429 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2-9.html 0644 root root 4288 45331 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-2.html 0644 root root 69408 31634 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-3-1.html 0644 root root 10613 9735 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-3-10.html 0644 root root 10732 23609 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-3-11.html 0644 root root 8970 23302 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-3-12.html 0644 root root 12126 8914 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-3-13.html 0644 root root 9513 53023 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-3-14.html 0644 root root 6249 4075 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-3-15.html 0644 root root 6388 17750 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-3-16.html 0644 root root 11022 34364 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-3-17.html 0644 root root 10597 20734 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-3-18.html 0644 root root 11272 20494 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-3-19.html 0644 root root 8473 49605 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-3-2.html 0644 root root 12210 52383 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-3-20.html 0644 root root 9240 45065 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-3-3.html 0644 root root 4282 44983 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-3-4.html 0644 root root 11280 61259 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-3-5.html 0644 root root 8696 50558 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-3-6.html 0644 root root 9204 32920 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-3-7.html 0644 root root 9736 18658 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-3-8.html 0644 root root 9267 21877 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-3-9.html 0644 root root 10213 52510 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-3.html 0644 root root 69776 613 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-4-1.html 0644 root root 9607 43986 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-4-10.html 0644 root root 11944 64047 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-4-11.html 0644 root root 13799 30085 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-4-12.html 0644 root root 9999 36083 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-4-13.html 0644 root root 9708 6282 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-4-2.html 0644 root root 15729 4441 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-4-3.html 0644 root root 13940 5763 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-4-4.html 0644 root root 10748 27438 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-4-5.html 0644 root root 15945 39253 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-4-6.html 0644 root root 10442 60671 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-4-7.html 0644 root root 6232 3293 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-4-8.html 0644 root root 8876 15359 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-4-9.html 0644 root root 14540 42424 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-8-4.html 0644 root root 88008 12741 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-9-0-1.html 0644 root root 5978 57177 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-9-0-2.html 0644 root root 13668 48818 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-9-0-3.html 0644 root root 7288 19259 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-9-0-4.html 0644 root root 11391 12508 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-9-0-5.html 0644 root root 17927 40399 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-9-0-6.html 0644 root root 13438 49292 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-9-0-7.html 0644 root root 18103 41778 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-9-0-8.html 0644 root root 11002 48734 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-9-0-9.html 0644 root root 11734 33904 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-9-0.html 0644 root root 96159 47009 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-9-1-1.html 0644 root root 3698 428 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-9-1-2.html 0644 root root 21602 31917 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-9-1-3.html 0644 root root 21161 6996 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-9-1-4.html 0644 root root 16026 48826 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-9-1-5.html 0644 root root 14038 16693 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-9-1.html 0644 root root 79097 6835 1347419305 1 f none /usr/local/share/doc/postgresql/html/release-9-2.html 0644 root root 79601 61842 1347419305 1 f none /usr/local/share/doc/postgresql/html/release.html 0644 root root 18194 55284 1347419305 1 f none /usr/local/share/doc/postgresql/html/resources.html 0644 root root 4220 54030 1347419305 1 f none /usr/local/share/doc/postgresql/html/role-attributes.html 0644 root root 7860 2927 1347419305 1 f none /usr/local/share/doc/postgresql/html/role-membership.html 0644 root root 8616 8859 1347419305 1 f none /usr/local/share/doc/postgresql/html/routine-reindex.html 0644 root root 3626 18749 1347419305 1 f none /usr/local/share/doc/postgresql/html/routine-vacuuming.html 0644 root root 37670 11511 1347419305 1 f none /usr/local/share/doc/postgresql/html/row-estimation-examples.html 0644 root root 20657 59939 1347419305 1 f none /usr/local/share/doc/postgresql/html/rowtypes.html 0644 root root 14320 27824 1347419305 1 f none /usr/local/share/doc/postgresql/html/rule-system.html 0644 root root 4115 45741 1347419305 1 f none /usr/local/share/doc/postgresql/html/rules-privileges.html 0644 root root 11661 20801 1347419305 1 f none /usr/local/share/doc/postgresql/html/rules-status.html 0644 root root 4510 14587 1347419305 1 f none /usr/local/share/doc/postgresql/html/rules-triggers.html 0644 root root 9474 29156 1347419305 1 f none /usr/local/share/doc/postgresql/html/rules-update.html 0644 root root 32613 44373 1347419305 1 f none /usr/local/share/doc/postgresql/html/rules-views.html 0644 root root 26886 24545 1347419305 1 f none /usr/local/share/doc/postgresql/html/rules.html 0644 root root 4946 44594 1347419305 1 f none /usr/local/share/doc/postgresql/html/runtime-config-autovacuum.html 0644 root root 10972 55471 1347419305 1 f none /usr/local/share/doc/postgresql/html/runtime-config-client.html 0644 root root 32538 1553 1347419305 1 f none /usr/local/share/doc/postgresql/html/runtime-config-compatible.html 0644 root root 14087 10695 1347419305 1 f none /usr/local/share/doc/postgresql/html/runtime-config-connection.html 0644 root root 22109 40418 1347419305 1 f none /usr/local/share/doc/postgresql/html/runtime-config-custom.html 0644 root root 3546 9645 1347419305 1 f none /usr/local/share/doc/postgresql/html/runtime-config-developer.html 0644 root root 14068 9524 1347419305 1 f none /usr/local/share/doc/postgresql/html/runtime-config-error-handling.html 0644 root root 3568 2933 1347419305 1 f none /usr/local/share/doc/postgresql/html/runtime-config-file-locations.html 0644 root root 6965 4101 1347419305 1 f none /usr/local/share/doc/postgresql/html/runtime-config-locks.html 0644 root root 7632 7462 1347419305 1 f none /usr/local/share/doc/postgresql/html/runtime-config-logging.html 0644 root root 45385 54413 1347419305 1 f none /usr/local/share/doc/postgresql/html/runtime-config-preset.html 0644 root root 8708 56077 1347419305 1 f none /usr/local/share/doc/postgresql/html/runtime-config-query.html 0644 root root 24948 22344 1347419305 1 f none /usr/local/share/doc/postgresql/html/runtime-config-replication.html 0644 root root 18292 5594 1347419305 1 f none /usr/local/share/doc/postgresql/html/runtime-config-resource.html 0644 root root 27899 22680 1347419305 1 f none /usr/local/share/doc/postgresql/html/runtime-config-short.html 0644 root root 6679 4191 1347419305 1 f none /usr/local/share/doc/postgresql/html/runtime-config-statistics.html 0644 root root 8614 65351 1347419305 1 f none /usr/local/share/doc/postgresql/html/runtime-config-wal.html 0644 root root 27091 9949 1347419305 1 f none /usr/local/share/doc/postgresql/html/runtime-config.html 0644 root root 8247 34161 1347419305 1 f none /usr/local/share/doc/postgresql/html/runtime.html 0644 root root 4996 39962 1347419305 1 f none /usr/local/share/doc/postgresql/html/seg.html 0644 root root 15468 34859 1347419305 1 f none /usr/local/share/doc/postgresql/html/sepgsql.html 0644 root root 30825 34849 1347419305 1 f none /usr/local/share/doc/postgresql/html/server-programming.html 0644 root root 9616 2053 1347419305 1 f none /usr/local/share/doc/postgresql/html/server-shutdown.html 0644 root root 6467 39377 1347419305 1 f none /usr/local/share/doc/postgresql/html/server-start.html 0644 root root 14189 1159 1347419305 1 f none /usr/local/share/doc/postgresql/html/source-format.html 0644 root root 5131 65212 1347419305 1 f none /usr/local/share/doc/postgresql/html/source.html 0644 root root 4069 35153 1347419305 1 f none /usr/local/share/doc/postgresql/html/sourcerepo.html 0644 root root 3382 57222 1347419305 1 f none /usr/local/share/doc/postgresql/html/spgist-examples.html 0644 root root 2701 194 1347419305 1 f none /usr/local/share/doc/postgresql/html/spgist-extensibility.html 0644 root root 31280 30209 1347419305 1 f none /usr/local/share/doc/postgresql/html/spgist-implementation.html 0644 root root 8096 50414 1347419305 1 f none /usr/local/share/doc/postgresql/html/spgist-intro.html 0644 root root 4321 7328 1347419305 1 f none /usr/local/share/doc/postgresql/html/spgist.html 0644 root root 2964 17057 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-examples.html 0644 root root 6215 49607 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-interface-support.html 0644 root root 3768 25517 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-interface.html 0644 root root 5996 14865 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-memory.html 0644 root root 7087 35196 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-realloc.html 0644 root root 3625 63293 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-connect.html 0644 root root 4050 32314 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-copytuple.html 0644 root root 3451 50690 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-cursor-close.html 0644 root root 3334 46296 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-cursor-fetch.html 0644 root root 4108 32573 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-cursor-find.html 0644 root root 3462 55871 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-cursor-move.html 0644 root root 3888 18856 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-cursor-open-with-args.html 0644 root root 6176 57572 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-cursor-open-with-paramlist.html 0644 root root 5033 43677 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-cursor-open.html 0644 root root 5730 30345 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-exec.html 0644 root root 3548 55542 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-execp.html 0644 root root 4823 20623 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-execute-plan-with-paramlist.html 0644 root root 4850 24289 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-execute-plan.html 0644 root root 5858 29270 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-execute-with-args.html 0644 root root 6178 56255 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-execute.html 0644 root root 12172 43426 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-finish.html 0644 root root 3653 3806 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-fname.html 0644 root root 3765 8727 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-fnumber.html 0644 root root 3934 23517 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-freeplan.html 0644 root root 3503 53705 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-freetuple.html 0644 root root 3275 40622 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-freetupletable.html 0644 root root 3626 2540 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-getargcount.html 0644 root root 3696 4183 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-getargtypeid.html 0644 root root 4139 36765 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-getbinval.html 0644 root root 4285 46025 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-getnspname.html 0644 root root 3465 54323 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-getrelname.html 0644 root root 3349 44366 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-gettype.html 0644 root root 3712 4601 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-gettypeid.html 0644 root root 3716 3149 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-getvalue.html 0644 root root 4164 36889 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-is-cursor-plan.html 0644 root root 4558 4231 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-keepplan.html 0644 root root 3882 19275 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-modifytuple.html 0644 root root 5629 7378 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-palloc.html 0644 root root 3155 27314 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-pfree.html 0644 root root 3273 37308 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-pop.html 0644 root root 2741 64108 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-prepare-cursor.html 0644 root root 5053 34838 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-prepare-params.html 0644 root root 4410 57827 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-prepare.html 0644 root root 7659 61366 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-push.html 0644 root root 3735 14192 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-returntuple.html 0644 root root 4095 35687 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-saveplan.html 0644 root root 4574 6903 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-scroll-cursor-fetch.html 0644 root root 4807 15886 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-spi-scroll-cursor-move.html 0644 root root 4897 23019 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi-visibility.html 0644 root root 4150 50098 1347419305 1 f none /usr/local/share/doc/postgresql/html/spi.html 0644 root root 10841 25901 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-abort.html 0644 root root 4175 35015 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-alteraggregate.html 0644 root root 6109 45094 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-altercollation.html 0644 root root 5082 32720 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-alterconversion.html 0644 root root 5168 41251 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-alterdatabase.html 0644 root root 8776 58357 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-alterdefaultprivileges.html 0644 root root 9453 33643 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-alterdomain.html 0644 root root 11111 17312 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-alterextension.html 0644 root root 11743 54685 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-alterforeigndatawrapper.html 0644 root root 7376 7604 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-alterforeigntable.html 0644 root root 12705 61003 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-alterfunction.html 0644 root root 12778 9336 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-altergroup.html 0644 root root 5237 47553 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-alterindex.html 0644 root root 7647 23806 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-alterlanguage.html 0644 root root 4020 18788 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-alterlargeobject.html 0644 root root 3728 64999 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-alteropclass.html 0644 root root 5112 37000 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-alteroperator.html 0644 root root 5433 61164 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-alteropfamily.html 0644 root root 13562 30490 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-alterrole.html 0644 root root 13026 49987 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-alterschema.html 0644 root root 4312 41915 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-altersequence.html 0644 root root 13029 27214 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-alterserver.html 0644 root root 5926 28351 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-altertable.html 0644 root root 42806 52233 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-altertablespace.html 0644 root root 5864 27956 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-altertrigger.html 0644 root root 4645 1555 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-altertsconfig.html 0644 root root 8124 62109 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-altertsdictionary.html 0644 root root 6510 16092 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-altertsparser.html 0644 root root 4255 37715 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-altertstemplate.html 0644 root root 4221 35094 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-altertype.html 0644 root root 11191 27629 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-alteruser.html 0644 root root 4438 45841 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-alterusermapping.html 0644 root root 5720 15089 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-alterview.html 0644 root root 6966 35081 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-analyze.html 0644 root root 10672 49339 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-begin.html 0644 root root 6693 39832 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-checkpoint.html 0644 root root 3756 11075 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-close.html 0644 root root 4982 30530 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-cluster.html 0644 root root 9402 593 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-commands.html 0644 root root 18808 55687 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-comment.html 0644 root root 13797 32566 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-commit-prepared.html 0644 root root 4514 273 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-commit.html 0644 root root 3990 20489 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-copy.html 0644 root root 37443 11367 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createaggregate.html 0644 root root 13827 13816 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createcast.html 0644 root root 19630 46801 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createcollation.html 0644 root root 6737 31192 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createconversion.html 0644 root root 6536 16737 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createdatabase.html 0644 root root 12383 13042 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createdomain.html 0644 root root 8542 42518 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createextension.html 0644 root root 8823 9327 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createforeigndatawrapper.html 0644 root root 8057 10911 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createforeigntable.html 0644 root root 7716 38858 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createfunction.html 0644 root root 30952 17301 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-creategroup.html 0644 root root 4010 13119 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createindex.html 0644 root root 25738 52890 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createlanguage.html 0644 root root 14886 37135 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createopclass.html 0644 root root 12674 34466 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createoperator.html 0644 root root 10686 2015 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createopfamily.html 0644 root root 5624 27814 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createrole.html 0644 root root 19508 12286 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createrule.html 0644 root root 12654 25019 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createschema.html 0644 root root 8159 18288 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createsequence.html 0644 root root 14070 3745 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createserver.html 0644 root root 6249 58577 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createtable.html 0644 root root 58375 24680 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createtableas.html 0644 root root 12770 14235 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createtablespace.html 0644 root root 6102 47594 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createtrigger.html 0644 root root 23173 43336 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createtsconfig.html 0644 root root 5350 65388 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createtsdictionary.html 0644 root root 5531 11145 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createtsparser.html 0644 root root 5945 43537 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createtstemplate.html 0644 root root 5435 10386 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createtype.html 0644 root root 39458 38119 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createuser.html 0644 root root 4522 51543 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createusermapping.html 0644 root root 5501 4479 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-createview.html 0644 root root 10305 53050 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-deallocate.html 0644 root root 3783 3960 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-declare.html 0644 root root 15398 60627 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-delete.html 0644 root root 11792 15900 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-discard.html 0644 root root 4307 45870 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-do.html 0644 root root 5202 48974 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-drop-owned.html 0644 root root 4798 20348 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-dropaggregate.html 0644 root root 4559 59826 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-dropcast.html 0644 root root 4342 42855 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-dropcollation.html 0644 root root 4407 48169 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-dropconversion.html 0644 root root 4435 51890 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-dropdatabase.html 0644 root root 4342 48314 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-dropdomain.html 0644 root root 4255 36186 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-dropextension.html 0644 root root 4783 14378 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-dropforeigndatawrapper.html 0644 root root 4524 57528 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-dropforeigntable.html 0644 root root 4558 61588 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-dropfunction.html 0644 root root 5836 24799 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-dropgroup.html 0644 root root 3045 15469 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-dropindex.html 0644 root root 5255 52569 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-droplanguage.html 0644 root root 4839 15570 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-dropopclass.html 0644 root root 5676 17956 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-dropoperator.html 0644 root root 5220 41797 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-dropopfamily.html 0644 root root 5277 53921 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-droprole.html 0644 root root 5064 41173 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-droprule.html 0644 root root 4149 25961 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-dropschema.html 0644 root root 4527 59300 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-dropsequence.html 0644 root root 4365 45496 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-dropserver.html 0644 root root 4263 36348 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-droptable.html 0644 root root 5026 34551 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-droptablespace.html 0644 root root 4583 203 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-droptrigger.html 0644 root root 4709 5467 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-droptsconfig.html 0644 root root 4770 14824 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-droptsdictionary.html 0644 root root 4687 7501 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-droptsparser.html 0644 root root 4593 65445 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-droptstemplate.html 0644 root root 4565 63010 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-droptype.html 0644 root root 4461 53790 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-dropuser.html 0644 root root 3164 25310 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-dropusermapping.html 0644 root root 4677 2505 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-dropview.html 0644 root root 4260 37957 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-end.html 0644 root root 4155 32990 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-execute.html 0644 root root 5071 42620 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-explain.html 0644 root root 17092 20392 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-expressions.html 0644 root root 45028 16684 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-fetch.html 0644 root root 14249 30491 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-grant.html 0644 root root 28864 42335 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-insert.html 0644 root root 12858 29330 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-keywords-appendix.html 0644 root root 106531 8660 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-listen.html 0644 root root 5901 44835 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-load.html 0644 root root 4205 46333 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-lock.html 0644 root root 11689 28605 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-move.html 0644 root root 4982 20769 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-notify.html 0644 root root 10946 21048 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-prepare-transaction.html 0644 root root 8599 3617 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-prepare.html 0644 root root 9179 55879 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-reassign-owned.html 0644 root root 5240 52956 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-reindex.html 0644 root root 11098 63798 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-release-savepoint.html 0644 root root 5003 37567 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-reset.html 0644 root root 4991 36825 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-revoke.html 0644 root root 14877 51654 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-rollback-prepared.html 0644 root root 4625 8579 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-rollback-to.html 0644 root root 6399 14505 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-rollback.html 0644 root root 3994 19367 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-savepoint.html 0644 root root 5603 18892 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-security-label.html 0644 root root 8877 57783 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-select.html 0644 root root 78892 29071 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-selectinto.html 0644 root root 7632 16069 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-set-constraints.html 0644 root root 7066 9502 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-set-role.html 0644 root root 6913 58164 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-set-session-authorization.html 0644 root root 6060 58988 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-set-transaction.html 0644 root root 12694 51704 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-set.html 0644 root root 12055 30128 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-show.html 0644 root root 6849 31804 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-start-transaction.html 0644 root root 4981 34758 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-syntax-calling-funcs.html 0644 root root 7802 11227 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-syntax-lexical.html 0644 root root 43368 15565 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-syntax.html 0644 root root 5428 13261 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-truncate.html 0644 root root 9996 42434 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-unlisten.html 0644 root root 4921 24680 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-update.html 0644 root root 15483 52503 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-vacuum.html 0644 root root 11932 63998 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql-values.html 0644 root root 10638 53825 1347419305 1 f none /usr/local/share/doc/postgresql/html/sql.html 0644 root root 13425 38646 1347419305 1 f none /usr/local/share/doc/postgresql/html/ssh-tunnels.html 0644 root root 6261 26784 1347419305 1 f none /usr/local/share/doc/postgresql/html/ssl-tcp.html 0644 root root 13475 18397 1347419305 1 f none /usr/local/share/doc/postgresql/html/sslinfo.html 0644 root root 7592 90 1347419305 1 f none /usr/local/share/doc/postgresql/html/standby-settings.html 0644 root root 5425 10388 1347419305 1 f none /usr/local/share/doc/postgresql/html/storage-file-layout.html 0644 root root 12899 40984 1347419305 1 f none /usr/local/share/doc/postgresql/html/storage-fsm.html 0644 root root 3819 28976 1347419305 1 f none /usr/local/share/doc/postgresql/html/storage-init.html 0644 root root 2758 8936 1347419305 1 f none /usr/local/share/doc/postgresql/html/storage-page-layout.html 0644 root root 13889 48106 1347419305 1 f none /usr/local/share/doc/postgresql/html/storage-toast.html 0644 root root 11476 14635 1347419305 1 f none /usr/local/share/doc/postgresql/html/storage-vm.html 0644 root root 3538 10557 1347419305 1 f none /usr/local/share/doc/postgresql/html/storage.html 0644 root root 2950 17901 1347419305 1 f none /usr/local/share/doc/postgresql/html/stylesheet.css 0644 root root 1538 52916 1347419305 1 f none /usr/local/share/doc/postgresql/html/supported-platforms.html 0644 root root 5039 2500 1347419305 1 f none /usr/local/share/doc/postgresql/html/tablefunc.html 0644 root root 32191 53466 1347419305 1 f none /usr/local/share/doc/postgresql/html/tcn.html 0644 root root 4972 51087 1347419305 1 f none /usr/local/share/doc/postgresql/html/test-parser.html 0644 root root 4528 3833 1347419305 1 f none /usr/local/share/doc/postgresql/html/textsearch-configuration.html 0644 root root 6255 22329 1347419305 1 f none /usr/local/share/doc/postgresql/html/textsearch-controls.html 0644 root root 26963 34711 1347419305 1 f none /usr/local/share/doc/postgresql/html/textsearch-debugging.html 0644 root root 17225 21468 1347419305 1 f none /usr/local/share/doc/postgresql/html/textsearch-dictionaries.html 0644 root root 31265 48482 1347419305 1 f none /usr/local/share/doc/postgresql/html/textsearch-features.html 0644 root root 21308 49075 1347419305 1 f none /usr/local/share/doc/postgresql/html/textsearch-indexes.html 0644 root root 7385 51309 1347419305 1 f none /usr/local/share/doc/postgresql/html/textsearch-intro.html 0644 root root 18451 30569 1347419305 1 f none /usr/local/share/doc/postgresql/html/textsearch-limitations.html 0644 root root 3857 23462 1347419305 1 f none /usr/local/share/doc/postgresql/html/textsearch-migration.html 0644 root root 5032 57480 1347419305 1 f none /usr/local/share/doc/postgresql/html/textsearch-parsers.html 0644 root root 9208 25293 1347419305 1 f none /usr/local/share/doc/postgresql/html/textsearch-psql.html 0644 root root 9343 43987 1347419305 1 f none /usr/local/share/doc/postgresql/html/textsearch-tables.html 0644 root root 9748 47182 1347419305 1 f none /usr/local/share/doc/postgresql/html/textsearch.html 0644 root root 5876 43941 1347419305 1 f none /usr/local/share/doc/postgresql/html/transaction-iso.html 0644 root root 26729 4486 1347419305 1 f none /usr/local/share/doc/postgresql/html/trigger-datachanges.html 0644 root root 5070 58495 1347419305 1 f none /usr/local/share/doc/postgresql/html/trigger-definition.html 0644 root root 15505 48285 1347419305 1 f none /usr/local/share/doc/postgresql/html/trigger-example.html 0644 root root 7747 40969 1347419305 1 f none /usr/local/share/doc/postgresql/html/trigger-interface.html 0644 root root 10717 3827 1347419305 1 f none /usr/local/share/doc/postgresql/html/triggers.html 0644 root root 3796 25110 1347419305 1 f none /usr/local/share/doc/postgresql/html/tsearch2.html 0644 root root 9948 55577 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-accessdb.html 0644 root root 7023 57950 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-advanced-intro.html 0644 root root 3339 52498 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-advanced.html 0644 root root 2854 10995 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-agg.html 0644 root root 7592 44928 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-arch.html 0644 root root 4850 47198 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-concepts.html 0644 root root 3837 24614 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-conclusion.html 0644 root root 2846 12072 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-createdb.html 0644 root root 9198 65487 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-delete.html 0644 root root 3515 56740 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-fk.html 0644 root root 4420 4627 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-inheritance.html 0644 root root 6135 61093 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-install.html 0644 root root 4520 24421 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-join.html 0644 root root 9683 9202 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-populate.html 0644 root root 4837 37213 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-select.html 0644 root root 8031 52292 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-sql-intro.html 0644 root root 4902 33168 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-sql.html 0644 root root 3058 25615 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-start.html 0644 root root 2627 58222 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-table.html 0644 root root 5702 30762 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-transactions.html 0644 root root 9946 13892 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-update.html 0644 root root 3157 26920 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-views.html 0644 root root 3373 56776 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial-window.html 0644 root root 12479 23583 1347419305 1 f none /usr/local/share/doc/postgresql/html/tutorial.html 0644 root root 5207 64909 1347419305 1 f none /usr/local/share/doc/postgresql/html/typeconv-func.html 0644 root root 11995 55805 1347419305 1 f none /usr/local/share/doc/postgresql/html/typeconv-oper.html 0644 root root 12013 55871 1347419305 1 f none /usr/local/share/doc/postgresql/html/typeconv-overview.html 0644 root root 8288 14912 1347419305 1 f none /usr/local/share/doc/postgresql/html/typeconv-query.html 0644 root root 5448 29685 1347419305 1 f none /usr/local/share/doc/postgresql/html/typeconv-union-case.html 0644 root root 5785 37862 1347419305 1 f none /usr/local/share/doc/postgresql/html/typeconv.html 0644 root root 3719 18586 1347419305 1 f none /usr/local/share/doc/postgresql/html/unaccent.html 0644 root root 6740 43397 1347419305 1 f none /usr/local/share/doc/postgresql/html/unsupported-features-sql-standard.html 0644 root root 35113 18896 1347419305 1 f none /usr/local/share/doc/postgresql/html/upgrading.html 0644 root root 12792 25885 1347419305 1 f none /usr/local/share/doc/postgresql/html/user-manag.html 0644 root root 3902 34660 1347419305 1 f none /usr/local/share/doc/postgresql/html/using-explain.html 0644 root root 41822 50889 1347419305 1 f none /usr/local/share/doc/postgresql/html/uuid-ossp.html 0644 root root 7226 2960 1347419305 1 f none /usr/local/share/doc/postgresql/html/vacuumlo.html 0644 root root 7546 34525 1347419305 1 f none /usr/local/share/doc/postgresql/html/view-pg-available-extension-versions.html 0644 root root 4640 14380 1347419305 1 f none /usr/local/share/doc/postgresql/html/view-pg-available-extensions.html 0644 root root 3942 27963 1347419305 1 f none /usr/local/share/doc/postgresql/html/view-pg-cursors.html 0644 root root 5667 23723 1347419305 1 f none /usr/local/share/doc/postgresql/html/view-pg-group.html 0644 root root 3895 18031 1347419305 1 f none /usr/local/share/doc/postgresql/html/view-pg-indexes.html 0644 root root 4153 34180 1347419305 1 f none /usr/local/share/doc/postgresql/html/view-pg-locks.html 0644 root root 14020 50330 1347419305 1 f none /usr/local/share/doc/postgresql/html/view-pg-prepared-statements.html 0644 root root 5058 47011 1347419305 1 f none /usr/local/share/doc/postgresql/html/view-pg-prepared-xacts.html 0644 root root 4910 37739 1347419305 1 f none /usr/local/share/doc/postgresql/html/view-pg-roles.html 0644 root root 6071 48813 1347419305 1 f none /usr/local/share/doc/postgresql/html/view-pg-rules.html 0644 root root 3997 23567 1347419305 1 f none /usr/local/share/doc/postgresql/html/view-pg-seclabels.html 0644 root root 5121 40126 1347419305 1 f none /usr/local/share/doc/postgresql/html/view-pg-settings.html 0644 root root 10598 14750 1347419305 1 f none /usr/local/share/doc/postgresql/html/view-pg-shadow.html 0644 root root 5379 62827 1347419305 1 f none /usr/local/share/doc/postgresql/html/view-pg-stats.html 0644 root root 8885 17377 1347419305 1 f none /usr/local/share/doc/postgresql/html/view-pg-tables.html 0644 root root 4834 20823 1347419305 1 f none /usr/local/share/doc/postgresql/html/view-pg-timezone-abbrevs.html 0644 root root 3574 64443 1347419305 1 f none /usr/local/share/doc/postgresql/html/view-pg-timezone-names.html 0644 root root 4175 45632 1347419305 1 f none /usr/local/share/doc/postgresql/html/view-pg-user-mappings.html 0644 root root 4691 10406 1347419305 1 f none /usr/local/share/doc/postgresql/html/view-pg-user.html 0644 root root 4515 64021 1347419305 1 f none /usr/local/share/doc/postgresql/html/view-pg-views.html 0644 root root 3851 13982 1347419305 1 f none /usr/local/share/doc/postgresql/html/views-overview.html 0644 root root 6540 37642 1347419305 1 f none /usr/local/share/doc/postgresql/html/wal-async-commit.html 0644 root root 9014 15912 1347419305 1 f none /usr/local/share/doc/postgresql/html/wal-configuration.html 0644 root root 14958 61441 1347419305 1 f none /usr/local/share/doc/postgresql/html/wal-internals.html 0644 root root 6149 26113 1347419305 1 f none /usr/local/share/doc/postgresql/html/wal-intro.html 0644 root root 5532 41896 1347419305 1 f none /usr/local/share/doc/postgresql/html/wal-reliability.html 0644 root root 11477 1053 1347419305 1 f none /usr/local/share/doc/postgresql/html/wal.html 0644 root root 2926 14956 1347419305 1 f none /usr/local/share/doc/postgresql/html/warm-standby-failover.html 0644 root root 6100 37261 1347419305 1 f none /usr/local/share/doc/postgresql/html/warm-standby.html 0644 root root 34549 2904 1347419305 1 f none /usr/local/share/doc/postgresql/html/xaggr.html 0644 root root 9900 1755 1347419305 1 f none /usr/local/share/doc/postgresql/html/xfunc-c.html 0644 root root 78710 28145 1347419305 1 f none /usr/local/share/doc/postgresql/html/xfunc-internal.html 0644 root root 4002 35905 1347419305 1 f none /usr/local/share/doc/postgresql/html/xfunc-overload.html 0644 root root 5909 3036 1347419305 1 f none /usr/local/share/doc/postgresql/html/xfunc-pl.html 0644 root root 2989 23841 1347419305 1 f none /usr/local/share/doc/postgresql/html/xfunc-sql.html 0644 root root 38566 3138 1347419305 1 f none /usr/local/share/doc/postgresql/html/xfunc-volatility.html 0644 root root 9837 50930 1347419305 1 f none /usr/local/share/doc/postgresql/html/xfunc.html 0644 root root 4516 9504 1347419305 1 f none /usr/local/share/doc/postgresql/html/xindex.html 0644 root root 44591 17481 1347419305 1 f none /usr/local/share/doc/postgresql/html/xml2.html 0644 root root 16794 15041 1347419305 1 f none /usr/local/share/doc/postgresql/html/xoper-optimization.html 0644 root root 23141 21241 1347419305 1 f none /usr/local/share/doc/postgresql/html/xoper.html 0644 root root 4833 41866 1347419305 1 f none /usr/local/share/doc/postgresql/html/xplang-install.html 0644 root root 11125 59353 1347419305 1 f none /usr/local/share/doc/postgresql/html/xplang.html 0644 root root 4233 62375 1347419305 1 f none /usr/local/share/doc/postgresql/html/xtypes.html 0644 root root 12112 39397 1347419305 1 d none /usr/local/share/man 0755 root root 1 d none /usr/local/share/man/man1 0755 root root 1 f none /usr/local/share/man/man1/clusterdb.1 0644 root root 5811 26853 1347419306 1 f none /usr/local/share/man/man1/createdb.1 0644 root root 7419 32174 1347419306 1 f none /usr/local/share/man/man1/createlang.1 0644 root root 5419 55483 1347419306 1 f none /usr/local/share/man/man1/createuser.1 0644 root root 9329 64941 1347419306 1 f none /usr/local/share/man/man1/dropdb.1 0644 root root 5369 51493 1347419306 1 f none /usr/local/share/man/man1/droplang.1 0644 root root 5211 36534 1347419306 1 f none /usr/local/share/man/man1/dropuser.1 0644 root root 5347 51714 1347419306 1 f none /usr/local/share/man/man1/ecpg.1 0644 root root 5326 48861 1347419306 1 f none /usr/local/share/man/man1/initdb.1 0644 root root 9340 23215 1347419306 1 f none /usr/local/share/man/man1/oid2name.1 0644 root root 8874 33070 1347419306 1 f none /usr/local/share/man/man1/pg_archivecleanup.1 0644 root root 5749 22088 1347419306 1 f none /usr/local/share/man/man1/pg_basebackup.1 0644 root root 13194 36714 1347419306 1 f none /usr/local/share/man/man1/pg_config.1 0644 root root 6800 49813 1347419306 1 f none /usr/local/share/man/man1/pg_controldata.1 0644 root root 2293 51640 1347419306 1 f none /usr/local/share/man/man1/pg_ctl.1 0644 root root 12877 64039 1347419306 1 f none /usr/local/share/man/man1/pg_dump.1 0644 root root 28996 61703 1347419306 1 f none /usr/local/share/man/man1/pg_dumpall.1 0644 root root 12881 5591 1347419306 1 f none /usr/local/share/man/man1/pg_receivexlog.1 0644 root root 6776 58497 1347419306 1 f none /usr/local/share/man/man1/pg_resetxlog.1 0644 root root 8233 49916 1347419306 1 f none /usr/local/share/man/man1/pg_restore.1 0644 root root 19578 58308 1347419306 1 f none /usr/local/share/man/man1/pg_standby.1 0644 root root 10596 47700 1347419306 1 f none /usr/local/share/man/man1/pg_test_fsync.1 0644 root root 2807 29256 1347419306 1 f none /usr/local/share/man/man1/pg_test_timing.1 0644 root root 9816 39715 1347419306 1 f none /usr/local/share/man/man1/pg_upgrade.1 0644 root root 17916 17702 1347419306 1 f none /usr/local/share/man/man1/pgbench.1 0644 root root 21411 43673 1347419306 1 f none /usr/local/share/man/man1/postgres.1 0644 root root 20851 8000 1347419306 1 f none /usr/local/share/man/man1/postmaster.1 0644 root root 1535 47114 1347419306 1 f none /usr/local/share/man/man1/psql.1 0644 root root 87146 36253 1347419306 1 f none /usr/local/share/man/man1/reindexdb.1 0644 root root 6128 52103 1347419306 1 f none /usr/local/share/man/man1/vacuumdb.1 0644 root root 7090 2079 1347419306 1 f none /usr/local/share/man/man1/vacuumlo.1 0644 root root 4314 31093 1347419306 1 d none /usr/local/share/man/man3 0755 root root 1 f none /usr/local/share/man/man3/SPI_connect.3 0644 root root 2261 45257 1347419306 1 f none /usr/local/share/man/man3/SPI_copytuple.3 0644 root root 1834 7398 1347419306 1 f none /usr/local/share/man/man3/SPI_cursor_close.3 0644 root root 1784 4490 1347419306 1 f none /usr/local/share/man/man3/SPI_cursor_fetch.3 0644 root root 2137 33539 1347419306 1 f none /usr/local/share/man/man3/SPI_cursor_find.3 0644 root root 1779 2587 1347419306 1 f none /usr/local/share/man/man3/SPI_cursor_move.3 0644 root root 2003 22323 1347419306 1 f none /usr/local/share/man/man3/SPI_cursor_open.3 0644 root root 3353 9921 1347419306 1 f none /usr/local/share/man/man3/SPI_cursor_open_with_args.3 0644 root root 3426 11406 1347419306 1 f none /usr/local/share/man/man3/SPI_cursor_open_with_paramlist.3 0644 root root 2890 32520 1347419306 1 f none /usr/local/share/man/man3/SPI_exec.3 0644 root root 1778 1451 1347419306 1 f none /usr/local/share/man/man3/SPI_execp.3 0644 root root 2474 62739 1347419306 1 f none /usr/local/share/man/man3/SPI_execute.3 0644 root root 7476 32494 1347419306 1 f none /usr/local/share/man/man3/SPI_execute_plan.3 0644 root root 2985 41007 1347419306 1 f none /usr/local/share/man/man3/SPI_execute_plan_with_paramlist.3 0644 root root 2733 18601 1347419306 1 f none /usr/local/share/man/man3/SPI_execute_with_args.3 0644 root root 3516 22953 1347419306 1 f none /usr/local/share/man/man3/SPI_finish.3 0644 root root 2128 33446 1347419306 1 f none /usr/local/share/man/man3/SPI_fname.3 0644 root root 1934 14950 1347419306 1 f none /usr/local/share/man/man3/SPI_fnumber.3 0644 root root 2176 37587 1347419306 1 f none /usr/local/share/man/man3/SPI_freeplan.3 0644 root root 1766 869 1347419306 1 f none /usr/local/share/man/man3/SPI_freetuple.3 0644 root root 1752 1128 1347419306 1 f none /usr/local/share/man/man3/SPI_freetuptable.3 0644 root root 2053 28399 1347419306 1 f none /usr/local/share/man/man3/SPI_getargcount.3 0644 root root 1909 13940 1347419306 1 f none /usr/local/share/man/man3/SPI_getargtypeid.3 0644 root root 2176 37262 1347419306 1 f none /usr/local/share/man/man3/SPI_getbinval.3 0644 root root 2321 48094 1347419306 1 f none /usr/local/share/man/man3/SPI_getnspname.3 0644 root root 1853 9394 1347419306 1 f none /usr/local/share/man/man3/SPI_getrelname.3 0644 root root 1757 95 1347419306 1 f none /usr/local/share/man/man3/SPI_gettype.3 0644 root root 1948 16448 1347419306 1 f none /usr/local/share/man/man3/SPI_gettypeid.3 0644 root root 1868 9322 1347419306 1 f none /usr/local/share/man/man3/SPI_getvalue.3 0644 root root 2192 38190 1347419306 1 f none /usr/local/share/man/man3/SPI_is_cursor_plan.3 0644 root root 2424 60306 1347419306 1 f none /usr/local/share/man/man3/SPI_keepplan.3 0644 root root 2101 31120 1347419306 1 f none /usr/local/share/man/man3/SPI_modifytuple.3 0644 root root 2938 34893 1347419306 1 f none /usr/local/share/man/man3/SPI_palloc.3 0644 root root 1664 57738 1347419306 1 f none /usr/local/share/man/man3/SPI_pfree.3 0644 root root 1752 658 1347419306 1 f none /usr/local/share/man/man3/SPI_pop.3 0644 root root 1508 44478 1347419306 1 f none /usr/local/share/man/man3/SPI_prepare.3 0644 root root 4742 8009 1347419306 1 f none /usr/local/share/man/man3/SPI_prepare_cursor.3 0644 root root 2626 8929 1347419306 1 f none /usr/local/share/man/man3/SPI_prepare_params.3 0644 root root 2432 57597 1347419306 1 f none /usr/local/share/man/man3/SPI_push.3 0644 root root 2274 49164 1347419306 1 f none /usr/local/share/man/man3/SPI_repalloc.3 0644 root root 1987 21471 1347419306 1 f none /usr/local/share/man/man3/SPI_returntuple.3 0644 root root 2209 41611 1347419306 1 f none /usr/local/share/man/man3/SPI_saveplan.3 0644 root root 2498 1103 1347419306 1 f none /usr/local/share/man/man3/SPI_scroll_cursor_fetch.3 0644 root root 2462 58627 1347419306 1 f none /usr/local/share/man/man3/SPI_scroll_cursor_move.3 0644 root root 2510 63003 1347419306 1 f none /usr/local/share/man/man3/dblink.3 0644 root root 6485 11858 1347419306 1 f none /usr/local/share/man/man3/dblink_build_sql_delete.3 0644 root root 3351 2690 1347419306 1 f none /usr/local/share/man/man3/dblink_build_sql_insert.3 0644 root root 3955 55290 1347419306 1 f none /usr/local/share/man/man3/dblink_build_sql_update.3 0644 root root 4208 11649 1347419306 1 f none /usr/local/share/man/man3/dblink_cancel_query.3 0644 root root 2162 36823 1347419306 1 f none /usr/local/share/man/man3/dblink_close.3 0644 root root 2756 19156 1347419306 1 f none /usr/local/share/man/man3/dblink_connect.3 0644 root root 5597 57568 1347419306 1 f none /usr/local/share/man/man3/dblink_connect_u.3 0644 root root 2810 35901 1347419306 1 f none /usr/local/share/man/man3/dblink_disconnect.3 0644 root root 2155 33368 1347419306 1 f none /usr/local/share/man/man3/dblink_error_message.3 0644 root root 1877 10710 1347419306 1 f none /usr/local/share/man/man3/dblink_exec.3 0644 root root 3831 41899 1347419306 1 f none /usr/local/share/man/man3/dblink_fetch.3 0644 root root 4238 14975 1347419306 1 f none /usr/local/share/man/man3/dblink_get_connections.3 0644 root root 1756 509 1347419306 1 f none /usr/local/share/man/man3/dblink_get_notify.3 0644 root root 2547 64712 1347419306 1 f none /usr/local/share/man/man3/dblink_get_pkey.3 0644 root root 2711 13092 1347419306 1 f none /usr/local/share/man/man3/dblink_get_result.3 0644 root root 4993 8095 1347419306 1 f none /usr/local/share/man/man3/dblink_is_busy.3 0644 root root 1871 9466 1347419306 1 f none /usr/local/share/man/man3/dblink_open.3 0644 root root 3270 1427 1347419306 1 f none /usr/local/share/man/man3/dblink_send_query.3 0644 root root 2389 56536 1347419306 1 d none /usr/local/share/man/man5 0755 root root 1 f none /usr/local/share/man/man5/ABORT.5sql 0644 root root 2249 38840 1347419306 1 f none /usr/local/share/man/man5/ALTER_AGGREGATE.5sql 0644 root root 3614 21849 1347419306 1 f none /usr/local/share/man/man5/ALTER_COLLATION.5sql 0644 root root 2867 22957 1347419306 1 f none /usr/local/share/man/man5/ALTER_CONVERSION.5sql 0644 root root 2965 32729 1347419306 1 f none /usr/local/share/man/man5/ALTER_DATABASE.5sql 0644 root root 5407 52474 1347419306 1 f none /usr/local/share/man/man5/ALTER_DEFAULT_PRIVILEGES.5sql 0644 root root 6528 51584 1347419306 1 f none /usr/local/share/man/man5/ALTER_DOMAIN.5sql 0644 root root 6949 33855 1347419306 1 f none /usr/local/share/man/man5/ALTER_EXTENSION.5sql 0644 root root 6703 26197 1347419306 1 f none /usr/local/share/man/man5/ALTER_FOREIGN_DATA_WRAPPER.5sql 0644 root root 4479 27521 1347419306 1 f none /usr/local/share/man/man5/ALTER_FOREIGN_TABLE.5sql 0644 root root 7785 36653 1347419306 1 f none /usr/local/share/man/man5/ALTER_FUNCTION.5sql 0644 root root 7774 42956 1347419306 1 f none /usr/local/share/man/man5/ALTER_GROUP.5sql 0644 root root 3077 42258 1347419306 1 f none /usr/local/share/man/man5/ALTER_INDEX.5sql 0644 root root 4623 38935 1347419306 1 f none /usr/local/share/man/man5/ALTER_LANGUAGE.5sql 0644 root root 2148 28538 1347419306 1 f none /usr/local/share/man/man5/ALTER_LARGE_OBJECT.5sql 0644 root root 2020 19525 1347419306 1 f none /usr/local/share/man/man5/ALTER_OPERATOR.5sql 0644 root root 3082 44361 1347419306 1 f none /usr/local/share/man/man5/ALTER_OPERATOR_CLASS.5sql 0644 root root 2917 29823 1347419306 1 f none /usr/local/share/man/man5/ALTER_OPERATOR_FAMILY.5sql 0644 root root 9305 50336 1347419306 1 f none /usr/local/share/man/man5/ALTER_ROLE.5sql 0644 root root 8431 36513 1347419306 1 f none /usr/local/share/man/man5/ALTER_SCHEMA.5sql 0644 root root 2368 48567 1347419306 1 f none /usr/local/share/man/man5/ALTER_SEQUENCE.5sql 0644 root root 7703 50439 1347419306 1 f none /usr/local/share/man/man5/ALTER_SERVER.5sql 0644 root root 3487 9196 1347419306 1 f none /usr/local/share/man/man5/ALTER_TABLE.5sql 0644 root root 30596 55413 1347419306 1 f none /usr/local/share/man/man5/ALTER_TABLESPACE.5sql 0644 root root 3349 940 1347419306 1 f none /usr/local/share/man/man5/ALTER_TEXT_SEARCH_CONFIGURATION.5sql 0644 root root 4919 65482 1347419306 1 f none /usr/local/share/man/man5/ALTER_TEXT_SEARCH_DICTIONARY.5sql 0644 root root 4131 875 1347419306 1 f none /usr/local/share/man/man5/ALTER_TEXT_SEARCH_PARSER.5sql 0644 root root 2325 42773 1347419306 1 f none /usr/local/share/man/man5/ALTER_TEXT_SEARCH_TEMPLATE.5sql 0644 root root 2363 45874 1347419306 1 f none /usr/local/share/man/man5/ALTER_TRIGGER.5sql 0644 root root 2567 65013 1347419306 1 f none /usr/local/share/man/man5/ALTER_TYPE.5sql 0644 root root 7035 49202 1347419306 1 f none /usr/local/share/man/man5/ALTER_USER.5sql 0644 root root 2410 46578 1347419306 1 f none /usr/local/share/man/man5/ALTER_USER_MAPPING.5sql 0644 root root 3378 65480 1347419306 1 f none /usr/local/share/man/man5/ALTER_VIEW.5sql 0644 root root 3987 51260 1347419306 1 f none /usr/local/share/man/man5/ANALYZE.5sql 0644 root root 7700 7433 1347419306 1 f none /usr/local/share/man/man5/BEGIN.5sql 0644 root root 4184 9843 1347419306 1 f none /usr/local/share/man/man5/CHECKPOINT.5sql 0644 root root 2372 54926 1347419306 1 f none /usr/local/share/man/man5/CLOSE.5sql 0644 root root 2827 24655 1347419306 1 f none /usr/local/share/man/man5/CLUSTER.5sql 0644 root root 6414 19024 1347419306 1 f none /usr/local/share/man/man5/COMMENT.5sql 0644 root root 9213 39363 1347419306 1 f none /usr/local/share/man/man5/COMMIT.5sql 0644 root root 2173 32141 1347419306 1 f none /usr/local/share/man/man5/COMMIT_PREPARED.5sql 0644 root root 2677 12751 1347419306 1 f none /usr/local/share/man/man5/COPY.5sql 0644 root root 26759 31964 1347419306 1 f none /usr/local/share/man/man5/CREATE_AGGREGATE.5sql 0644 root root 9672 46164 1347419306 1 f none /usr/local/share/man/man5/CREATE_CAST.5sql 0644 root root 14412 12550 1347419306 1 f none /usr/local/share/man/man5/CREATE_COLLATION.5sql 0644 root root 4102 65406 1347419306 1 f none /usr/local/share/man/man5/CREATE_CONVERSION.5sql 0644 root root 3914 48756 1347419306 1 f none /usr/local/share/man/man5/CREATE_DATABASE.5sql 0644 root root 8246 35212 1347419306 1 f none /usr/local/share/man/man5/CREATE_DOMAIN.5sql 0644 root root 5501 59781 1347419306 1 f none /usr/local/share/man/man5/CREATE_EXTENSION.5sql 0644 root root 5594 11144 1347419306 1 f none /usr/local/share/man/man5/CREATE_FOREIGN_DATA_WRAPPER.5sql 0644 root root 5205 32783 1347419306 1 f none /usr/local/share/man/man5/CREATE_FOREIGN_TABLE.5sql 0644 root root 4818 55354 1347419306 1 f none /usr/local/share/man/man5/CREATE_FUNCTION.5sql 0644 root root 22095 64284 1347419306 1 f none /usr/local/share/man/man5/CREATE_GROUP.5sql 0644 root root 2222 27733 1347419306 1 f none /usr/local/share/man/man5/CREATE_INDEX.5sql 0644 root root 18915 8517 1347419306 1 f none /usr/local/share/man/man5/CREATE_LANGUAGE.5sql 0644 root root 10100 18650 1347419306 1 f none /usr/local/share/man/man5/CREATE_OPERATOR.5sql 0644 root root 7086 50814 1347419306 1 f none /usr/local/share/man/man5/CREATE_OPERATOR_CLASS.5sql 0644 root root 8748 5282 1347419306 1 f none /usr/local/share/man/man5/CREATE_OPERATOR_FAMILY.5sql 0644 root root 3727 40122 1347419306 1 f none /usr/local/share/man/man5/CREATE_ROLE.5sql 0644 root root 12625 12988 1347419306 1 f none /usr/local/share/man/man5/CREATE_RULE.5sql 0644 root root 8102 19993 1347419306 1 f none /usr/local/share/man/man5/CREATE_SCHEMA.5sql 0644 root root 5428 50496 1347419306 1 f none /usr/local/share/man/man5/CREATE_SEQUENCE.5sql 0644 root root 9505 10557 1347419306 1 f none /usr/local/share/man/man5/CREATE_SERVER.5sql 0644 root root 3771 34572 1347419306 1 f none /usr/local/share/man/man5/CREATE_TABLE.5sql 0644 root root 40334 13745 1347419306 1 f none /usr/local/share/man/man5/CREATE_TABLESPACE.5sql 0644 root root 3604 21823 1347419306 1 f none /usr/local/share/man/man5/CREATE_TABLE_AS.5sql 0644 root root 8135 63490 1347419306 1 f none /usr/local/share/man/man5/CREATE_TEXT_SEARCH_CONFIGURATION.5sql 0644 root root 3323 1958 1347419306 1 f none /usr/local/share/man/man5/CREATE_TEXT_SEARCH_DICTIONARY.5sql 0644 root root 3473 12442 1347419306 1 f none /usr/local/share/man/man5/CREATE_TEXT_SEARCH_PARSER.5sql 0644 root root 3696 34425 1347419306 1 f none /usr/local/share/man/man5/CREATE_TEXT_SEARCH_TEMPLATE.5sql 0644 root root 3512 20464 1347419306 1 f none /usr/local/share/man/man5/CREATE_TRIGGER.5sql 0644 root root 15476 61047 1347419306 1 f none /usr/local/share/man/man5/CREATE_TYPE.5sql 0644 root root 29012 7556 1347419306 1 f none /usr/local/share/man/man5/CREATE_USER.5sql 0644 root root 2539 54653 1347419306 1 f none /usr/local/share/man/man5/CREATE_USER_MAPPING.5sql 0644 root root 3387 1899 1347419306 1 f none /usr/local/share/man/man5/CREATE_VIEW.5sql 0644 root root 7109 64218 1347419306 1 f none /usr/local/share/man/man5/DEALLOCATE.5sql 0644 root root 2096 26204 1347419306 1 f none /usr/local/share/man/man5/DECLARE.5sql 0644 root root 10504 43117 1347419306 1 f none /usr/local/share/man/man5/DELETE.5sql 0644 root root 7576 35293 1347419306 1 f none /usr/local/share/man/man5/DISCARD.5sql 0644 root root 2591 3176 1347419306 1 f none /usr/local/share/man/man5/DO.5sql 0644 root root 3200 54407 1347419306 1 f none /usr/local/share/man/man5/DROP_AGGREGATE.5sql 0644 root root 2639 4243 1347419306 1 f none /usr/local/share/man/man5/DROP_CAST.5sql 0644 root root 2340 44264 1347419306 1 f none /usr/local/share/man/man5/DROP_COLLATION.5sql 0644 root root 2393 47845 1347419306 1 f none /usr/local/share/man/man5/DROP_CONVERSION.5sql 0644 root root 2454 53663 1347419306 1 f none /usr/local/share/man/man5/DROP_DATABASE.5sql 0644 root root 2468 57872 1347419306 1 f none /usr/local/share/man/man5/DROP_DOMAIN.5sql 0644 root root 2302 39464 1347419306 1 f none /usr/local/share/man/man5/DROP_EXTENSION.5sql 0644 root root 2705 10644 1347419306 1 f none /usr/local/share/man/man5/DROP_FOREIGN_DATA_WRAPPER.5sql 0644 root root 2577 61275 1347419306 1 f none /usr/local/share/man/man5/DROP_FOREIGN_TABLE.5sql 0644 root root 2564 61586 1347419306 1 f none /usr/local/share/man/man5/DROP_FUNCTION.5sql 0644 root root 3344 339 1347419306 1 f none /usr/local/share/man/man5/DROP_GROUP.5sql 0644 root root 1638 51591 1347419306 1 f none /usr/local/share/man/man5/DROP_INDEX.5sql 0644 root root 3177 53363 1347419306 1 f none /usr/local/share/man/man5/DROP_LANGUAGE.5sql 0644 root root 2835 18953 1347419306 1 f none /usr/local/share/man/man5/DROP_OPERATOR.5sql 0644 root root 2968 30322 1347419306 1 f none /usr/local/share/man/man5/DROP_OPERATOR_CLASS.5sql 0644 root root 3461 9115 1347419306 1 f none /usr/local/share/man/man5/DROP_OPERATOR_FAMILY.5sql 0644 root root 3235 54559 1347419306 1 f none /usr/local/share/man/man5/DROP_OWNED.5sql 0644 root root 2854 26469 1347419306 1 f none /usr/local/share/man/man5/DROP_ROLE.5sql 0644 root root 3055 42553 1347419306 1 f none /usr/local/share/man/man5/DROP_RULE.5sql 0644 root root 2248 35865 1347419306 1 f none /usr/local/share/man/man5/DROP_SCHEMA.5sql 0644 root root 2612 1707 1347419306 1 f none /usr/local/share/man/man5/DROP_SEQUENCE.5sql 0644 root root 2433 51499 1347419306 1 f none /usr/local/share/man/man5/DROP_SERVER.5sql 0644 root root 2353 44067 1347419306 1 f none /usr/local/share/man/man5/DROP_TABLE.5sql 0644 root root 2945 31785 1347419306 1 f none /usr/local/share/man/man5/DROP_TABLESPACE.5sql 0644 root root 2576 78 1347419306 1 f none /usr/local/share/man/man5/DROP_TEXT_SEARCH_CONFIGURATION.5sql 0644 root root 2830 20437 1347419306 1 f none /usr/local/share/man/man5/DROP_TEXT_SEARCH_DICTIONARY.5sql 0644 root root 2739 12229 1347419306 1 f none /usr/local/share/man/man5/DROP_TEXT_SEARCH_PARSER.5sql 0644 root root 2639 3401 1347419306 1 f none /usr/local/share/man/man5/DROP_TEXT_SEARCH_TEMPLATE.5sql 0644 root root 2677 6542 1347419306 1 f none /usr/local/share/man/man5/DROP_TRIGGER.5sql 0644 root root 2576 65449 1347419306 1 f none /usr/local/share/man/man5/DROP_TYPE.5sql 0644 root root 2490 57187 1347419306 1 f none /usr/local/share/man/man5/DROP_USER.5sql 0644 root root 1702 57707 1347419306 1 f none /usr/local/share/man/man5/DROP_USER_MAPPING.5sql 0644 root root 2657 4306 1347419306 1 f none /usr/local/share/man/man5/DROP_VIEW.5sql 0644 root root 2394 48866 1347419306 1 f none /usr/local/share/man/man5/END.5sql 0644 root root 2265 40199 1347419306 1 f none /usr/local/share/man/man5/EXECUTE.5sql 0644 root root 3034 46233 1347419306 1 f none /usr/local/share/man/man5/EXPLAIN.5sql 0644 root root 13203 13114 1347419306 1 f none /usr/local/share/man/man5/FETCH.5sql 0644 root root 8727 47513 1347419306 1 f none /usr/local/share/man/man5/GRANT.5sql 0644 root root 21607 44659 1347419306 1 f none /usr/local/share/man/man5/INSERT.5sql 0644 root root 8951 8641 1347419306 1 f none /usr/local/share/man/man5/LISTEN.5sql 0644 root root 3621 35096 1347419306 1 f none /usr/local/share/man/man5/LOAD.5sql 0644 root root 2645 13315 1347419306 1 f none /usr/local/share/man/man5/LOCK.5sql 0644 root root 7972 8098 1347419306 1 f none /usr/local/share/man/man5/MOVE.5sql 0644 root root 3034 30914 1347419306 1 f none /usr/local/share/man/man5/NOTIFY.5sql 0644 root root 8154 56763 1347419306 1 f none /usr/local/share/man/man5/PREPARE.5sql 0644 root root 6352 15495 1347419306 1 f none /usr/local/share/man/man5/PREPARE_TRANSACTION.5sql 0644 root root 5900 37134 1347419306 1 f none /usr/local/share/man/man5/REASSIGN_OWNED.5sql 0644 root root 3134 49730 1347419306 1 f none /usr/local/share/man/man5/REINDEX.5sql 0644 root root 8039 21596 1347419306 1 f none /usr/local/share/man/man5/RELEASE_SAVEPOINT.5sql 0644 root root 3139 49779 1347419306 1 f none /usr/local/share/man/man5/RESET.5sql 0644 root root 3029 44847 1347419306 1 f none /usr/local/share/man/man5/REVOKE.5sql 0644 root root 10714 6386 1347419306 1 f none /usr/local/share/man/man5/ROLLBACK.5sql 0644 root root 2172 30471 1347419306 1 f none /usr/local/share/man/man5/ROLLBACK_PREPARED.5sql 0644 root root 2702 14383 1347419306 1 f none /usr/local/share/man/man5/ROLLBACK_TO_SAVEPOINT.5sql 0644 root root 4102 64973 1347419306 1 f none /usr/local/share/man/man5/SAVEPOINT.5sql 0644 root root 3639 23106 1347419306 1 f none /usr/local/share/man/man5/SECURITY_LABEL.5sql 0644 root root 5421 52744 1347419306 1 f none /usr/local/share/man/man5/SELECT.5sql 0644 root root 53674 35360 1347419306 1 f none /usr/local/share/man/man5/SELECT_INTO.5sql 0644 root root 4635 30826 1347419306 1 f none /usr/local/share/man/man5/SET.5sql 0644 root root 7642 44585 1347419306 1 f none /usr/local/share/man/man5/SET_CONSTRAINTS.5sql 0644 root root 4669 59825 1347419306 1 f none /usr/local/share/man/man5/SET_ROLE.5sql 0644 root root 4486 35384 1347419306 1 f none /usr/local/share/man/man5/SET_SESSION_AUTHORIZATION.5sql 0644 root root 4013 61308 1347419306 1 f none /usr/local/share/man/man5/SET_TRANSACTION.5sql 0644 root root 8646 13385 1347419306 1 f none /usr/local/share/man/man5/SHOW.5sql 0644 root root 4347 14736 1347419306 1 f none /usr/local/share/man/man5/START_TRANSACTION.5sql 0644 root root 3004 36805 1347419306 1 f none /usr/local/share/man/man5/TABLE.5sql 0644 root root 21 1613 1347419306 1 f none /usr/local/share/man/man5/TRUNCATE.5sql 0644 root root 6924 58938 1347419306 1 f none /usr/local/share/man/man5/UNLISTEN.5sql 0644 root root 2842 24918 1347419306 1 f none /usr/local/share/man/man5/UPDATE.5sql 0644 root root 10747 48240 1347419306 1 f none /usr/local/share/man/man5/VACUUM.5sql 0644 root root 8613 4580 1347419306 1 f none /usr/local/share/man/man5/VALUES.5sql 0644 root root 7140 46198 1347419306 1 f none /usr/local/share/man/man5/WITH.5sql 0644 root root 21 1613 1347419306 1 d none /usr/local/share/postgresql 0755 root root 1 f none /usr/local/share/postgresql/conversion_create.sql 0644 root root 74932 16952 1347419308 1 d none /usr/local/share/postgresql/extension 0755 root root 1 f none /usr/local/share/postgresql/extension/adminpack--1.0.sql 0644 root root 1535 55172 1347419310 1 f none /usr/local/share/postgresql/extension/adminpack.control 0644 root root 176 15922 1347419310 1 f none /usr/local/share/postgresql/extension/autoinc--1.0.sql 0644 root root 249 19868 1347419312 1 f none /usr/local/share/postgresql/extension/autoinc--unpackaged--1.0.sql 0644 root root 234 19493 1347419312 1 f none /usr/local/share/postgresql/extension/autoinc.control 0644 root root 149 13551 1347419312 1 f none /usr/local/share/postgresql/extension/btree_gin--1.0.sql 0644 root root 24818 50641 1347419311 1 f none /usr/local/share/postgresql/extension/btree_gin--unpackaged--1.0.sql 0644 root root 10091 1722 1347419311 1 f none /usr/local/share/postgresql/extension/btree_gin.control 0644 root root 160 14395 1347419311 1 f none /usr/local/share/postgresql/extension/btree_gist--1.0.sql 0644 root root 37814 841 1347419311 1 f none /usr/local/share/postgresql/extension/btree_gist--unpackaged--1.0.sql 0644 root root 21463 53290 1347419311 1 f none /usr/local/share/postgresql/extension/btree_gist.control 0644 root root 163 14758 1347419311 1 f none /usr/local/share/postgresql/extension/chkpass--1.0.sql 0644 root root 1154 22673 1347419311 1 f none /usr/local/share/postgresql/extension/chkpass--unpackaged--1.0.sql 0644 root root 619 52275 1347419311 1 f none /usr/local/share/postgresql/extension/chkpass.control 0644 root root 150 13549 1347419311 1 f none /usr/local/share/postgresql/extension/citext--1.0.sql 0644 root root 12337 52626 1347419311 1 f none /usr/local/share/postgresql/extension/citext--unpackaged--1.0.sql 0644 root root 8694 17079 1347419311 1 f none /usr/local/share/postgresql/extension/citext.control 0644 root root 158 14316 1347419311 1 f none /usr/local/share/postgresql/extension/cube--1.0.sql 0644 root root 7831 54747 1347419311 1 f none /usr/local/share/postgresql/extension/cube--unpackaged--1.0.sql 0644 root root 3179 6767 1347419311 1 f none /usr/local/share/postgresql/extension/cube.control 0644 root root 142 12679 1347419311 1 f none /usr/local/share/postgresql/extension/dblink--1.0.sql 0644 root root 5569 50377 1347419311 1 f none /usr/local/share/postgresql/extension/dblink--unpackaged--1.0.sql 0644 root root 2847 52141 1347419311 1 f none /usr/local/share/postgresql/extension/dblink.control 0644 root root 170 15238 1347419311 1 f none /usr/local/share/postgresql/extension/dict_int--1.0.sql 0644 root root 711 54377 1347419311 1 f none /usr/local/share/postgresql/extension/dict_int--unpackaged--1.0.sql 0644 root root 477 41646 1347419311 1 f none /usr/local/share/postgresql/extension/dict_int.control 0644 root root 158 14343 1347419311 1 f none /usr/local/share/postgresql/extension/dict_xsyn--1.0.sql 0644 root root 694 52924 1347419311 1 f none /usr/local/share/postgresql/extension/dict_xsyn--unpackaged--1.0.sql 0644 root root 472 41451 1347419311 1 f none /usr/local/share/postgresql/extension/dict_xsyn.control 0644 root root 179 16543 1347419311 1 f none /usr/local/share/postgresql/extension/earthdistance--1.0.sql 0644 root root 3096 46938 1347419311 1 f none /usr/local/share/postgresql/extension/earthdistance--unpackaged--1.0.sql 0644 root root 943 17025 1347419311 1 f none /usr/local/share/postgresql/extension/earthdistance.control 0644 root root 202 18215 1347419311 1 f none /usr/local/share/postgresql/extension/file_fdw--1.0.sql 0644 root root 475 37941 1347419311 1 f none /usr/local/share/postgresql/extension/file_fdw.control 0644 root root 155 13864 1347419311 1 f none /usr/local/share/postgresql/extension/fuzzystrmatch--1.0.sql 0644 root root 1436 48605 1347419311 1 f none /usr/local/share/postgresql/extension/fuzzystrmatch--unpackaged--1.0.sql 0644 root root 1092 29830 1347419311 1 f none /usr/local/share/postgresql/extension/fuzzystrmatch.control 0644 root root 175 16272 1347419311 1 f none /usr/local/share/postgresql/extension/hstore--1.0--1.1.sql 0644 root root 280 22033 1347419311 1 f none /usr/local/share/postgresql/extension/hstore--1.1.sql 0644 root root 12322 63009 1347419311 1 f none /usr/local/share/postgresql/extension/hstore--unpackaged--1.0.sql 0644 root root 5493 19041 1347419311 1 f none /usr/local/share/postgresql/extension/hstore.control 0644 root root 158 14016 1347419311 1 f none /usr/local/share/postgresql/extension/insert_username--1.0.sql 0644 root root 273 22463 1347419312 1 f none /usr/local/share/postgresql/extension/insert_username--unpackaged--1.0.sql 0644 root root 266 22953 1347419312 1 f none /usr/local/share/postgresql/extension/insert_username.control 0644 root root 170 15538 1347419312 1 f none /usr/local/share/postgresql/extension/intagg--1.0.sql 0644 root root 1041 22141 1347419311 1 f none /usr/local/share/postgresql/extension/intagg--unpackaged--1.0.sql 0644 root root 452 39006 1347419311 1 f none /usr/local/share/postgresql/extension/intagg.control 0644 root root 119 10675 1347419311 1 f none /usr/local/share/postgresql/extension/intarray--1.0.sql 0644 root root 10473 62938 1347419311 1 f none /usr/local/share/postgresql/extension/intarray--unpackaged--1.0.sql 0644 root root 6755 4808 1347419311 1 f none /usr/local/share/postgresql/extension/intarray.control 0644 root root 176 15795 1347419311 1 f none /usr/local/share/postgresql/extension/isn--1.0.sql 0644 root root 66205 43539 1347419311 1 f none /usr/local/share/postgresql/extension/isn--unpackaged--1.0.sql 0644 root root 23689 63473 1347419311 1 f none /usr/local/share/postgresql/extension/isn.control 0644 root root 160 14532 1347419311 1 f none /usr/local/share/postgresql/extension/lo--1.0.sql 0644 root root 708 57927 1347419311 1 f none /usr/local/share/postgresql/extension/lo--unpackaged--1.0.sql 0644 root root 298 24051 1347419311 1 f none /usr/local/share/postgresql/extension/lo.control 0644 root root 126 11025 1347419311 1 f none /usr/local/share/postgresql/extension/ltree--1.0.sql 0644 root root 18297 17636 1347419312 1 f none /usr/local/share/postgresql/extension/ltree--unpackaged--1.0.sql 0644 root root 7982 33494 1347419312 1 f none /usr/local/share/postgresql/extension/ltree.control 0644 root root 155 13974 1347419311 1 f none /usr/local/share/postgresql/extension/moddatetime--1.0.sql 0644 root root 261 21098 1347419312 1 f none /usr/local/share/postgresql/extension/moddatetime--unpackaged--1.0.sql 0644 root root 250 21133 1347419312 1 f none /usr/local/share/postgresql/extension/moddatetime.control 0644 root root 165 15068 1347419312 1 f none /usr/local/share/postgresql/extension/pageinspect--1.0.sql 0644 root root 2339 49575 1347419312 1 f none /usr/local/share/postgresql/extension/pageinspect--unpackaged--1.0.sql 0644 root root 1100 28168 1347419312 1 f none /usr/local/share/postgresql/extension/pageinspect.control 0644 root root 173 15611 1347419312 1 f none /usr/local/share/postgresql/extension/pg_buffercache--1.0.sql 0644 root root 755 63160 1347419312 1 f none /usr/local/share/postgresql/extension/pg_buffercache--unpackaged--1.0.sql 0644 root root 335 28822 1347419312 1 f none /usr/local/share/postgresql/extension/pg_buffercache.control 0644 root root 157 14123 1347419312 1 f none /usr/local/share/postgresql/extension/pg_freespacemap--1.0.sql 0644 root root 871 6061 1347419312 1 f none /usr/local/share/postgresql/extension/pg_freespacemap--unpackaged--1.0.sql 0644 root root 359 31338 1347419312 1 f none /usr/local/share/postgresql/extension/pg_freespacemap.control 0644 root root 160 14213 1347419312 1 f none /usr/local/share/postgresql/extension/pg_stat_statements--1.0--1.1.sql 0644 root root 1237 36608 1347419312 1 f none /usr/local/share/postgresql/extension/pg_stat_statements--1.1.sql 0644 root root 1205 33384 1347419312 1 f none /usr/local/share/postgresql/extension/pg_stat_statements--unpackaged--1.0.sql 0644 root root 433 38696 1347419312 1 f none /usr/local/share/postgresql/extension/pg_stat_statements.control 0644 root root 191 17722 1347419312 1 f none /usr/local/share/postgresql/extension/pg_trgm--1.0.sql 0644 root root 4977 46103 1347419312 1 f none /usr/local/share/postgresql/extension/pg_trgm--unpackaged--1.0.sql 0644 root root 4230 23225 1347419312 1 f none /usr/local/share/postgresql/extension/pg_trgm.control 0644 root root 177 16172 1347419312 1 f none /usr/local/share/postgresql/extension/pgcrypto--1.0.sql 0644 root root 4812 52313 1347419312 1 f none /usr/local/share/postgresql/extension/pgcrypto--unpackaged--1.0.sql 0644 root root 2433 19577 1347419312 1 f none /usr/local/share/postgresql/extension/pgcrypto.control 0644 root root 137 12478 1347419312 1 f none /usr/local/share/postgresql/extension/pgrowlocks--1.0.sql 0644 root root 534 41617 1347419312 1 f none /usr/local/share/postgresql/extension/pgrowlocks--unpackaged--1.0.sql 0644 root root 257 22089 1347419312 1 f none /usr/local/share/postgresql/extension/pgrowlocks.control 0644 root root 152 13879 1347419312 1 f none /usr/local/share/postgresql/extension/pgstattuple--1.0.sql 0644 root root 1910 20325 1347419312 1 f none /usr/local/share/postgresql/extension/pgstattuple--unpackaged--1.0.sql 0644 root root 441 38463 1347419312 1 f none /usr/local/share/postgresql/extension/pgstattuple.control 0644 root root 147 13451 1347419312 1 f none /usr/local/share/postgresql/extension/plpgsql--1.0.sql 0644 root root 332 27082 1347419310 1 f none /usr/local/share/postgresql/extension/plpgsql--unpackaged--1.0.sql 0644 root root 381 31702 1347419310 1 f none /usr/local/share/postgresql/extension/plpgsql.control 0644 root root 179 15991 1347419310 1 f none /usr/local/share/postgresql/extension/pltcl--1.0.sql 0644 root root 316 25411 1347419310 1 f none /usr/local/share/postgresql/extension/pltcl--unpackaged--1.0.sql 0644 root root 231 18450 1347419310 1 f none /usr/local/share/postgresql/extension/pltcl.control 0644 root root 173 15371 1347419310 1 f none /usr/local/share/postgresql/extension/pltclu--1.0.sql 0644 root root 330 26885 1347419310 1 f none /usr/local/share/postgresql/extension/pltclu--unpackaged--1.0.sql 0644 root root 236 19035 1347419310 1 f none /usr/local/share/postgresql/extension/pltclu.control 0644 root root 184 16536 1347419310 1 f none /usr/local/share/postgresql/extension/refint--1.0.sql 0644 root root 343 27206 1347419312 1 f none /usr/local/share/postgresql/extension/refint--unpackaged--1.0.sql 0644 root root 298 25099 1347419312 1 f none /usr/local/share/postgresql/extension/refint.control 0644 root root 169 15437 1347419312 1 f none /usr/local/share/postgresql/extension/seg--1.0.sql 0644 root root 7726 37487 1347419312 1 f none /usr/local/share/postgresql/extension/seg--unpackaged--1.0.sql 0644 root root 2766 32953 1347419312 1 f none /usr/local/share/postgresql/extension/seg.control 0644 root root 172 15615 1347419312 1 f none /usr/local/share/postgresql/extension/sslinfo--1.0.sql 0644 root root 1153 25468 1347419313 1 f none /usr/local/share/postgresql/extension/sslinfo--unpackaged--1.0.sql 0644 root root 830 3606 1347419313 1 f none /usr/local/share/postgresql/extension/sslinfo.control 0644 root root 146 13147 1347419313 1 f none /usr/local/share/postgresql/extension/tablefunc--1.0.sql 0644 root root 2153 42550 1347419312 1 f none /usr/local/share/postgresql/extension/tablefunc--unpackaged--1.0.sql 0644 root root 1144 34768 1347419312 1 f none /usr/local/share/postgresql/extension/tablefunc.control 0644 root root 174 15900 1347419312 1 f none /usr/local/share/postgresql/extension/tcn--1.0.sql 0644 root root 274 22381 1347419313 1 f none /usr/local/share/postgresql/extension/tcn.control 0644 root root 134 11933 1347419313 1 f none /usr/local/share/postgresql/extension/test_parser--1.0.sql 0644 root root 814 64847 1347419313 1 f none /usr/local/share/postgresql/extension/test_parser--unpackaged--1.0.sql 0644 root root 559 49683 1347419313 1 f none /usr/local/share/postgresql/extension/test_parser.control 0644 root root 167 15162 1347419313 1 f none /usr/local/share/postgresql/extension/timetravel--1.0.sql 0644 root root 486 37699 1347419312 1 f none /usr/local/share/postgresql/extension/timetravel--unpackaged--1.0.sql 0644 root root 378 32539 1347419312 1 f none /usr/local/share/postgresql/extension/timetravel.control 0644 root root 156 14262 1347419312 1 f none /usr/local/share/postgresql/extension/tsearch2--1.0.sql 0644 root root 15712 61127 1347419313 1 f none /usr/local/share/postgresql/extension/tsearch2--unpackaged--1.0.sql 0644 root root 9090 13125 1347419313 1 f none /usr/local/share/postgresql/extension/tsearch2.control 0644 root root 313 28094 1347419313 1 f none /usr/local/share/postgresql/extension/unaccent--1.0.sql 0644 root root 854 1374 1347419313 1 f none /usr/local/share/postgresql/extension/unaccent--unpackaged--1.0.sql 0644 root root 750 64613 1347419313 1 f none /usr/local/share/postgresql/extension/unaccent.control 0644 root root 157 14236 1347419313 1 f none /usr/local/share/postgresql/extension/xml2--1.0.sql 0644 root root 1867 15364 1347419313 1 f none /usr/local/share/postgresql/extension/xml2--unpackaged--1.0.sql 0644 root root 1325 48085 1347419313 1 f none /usr/local/share/postgresql/extension/xml2.control 0644 root root 208 18230 1347419313 1 f none /usr/local/share/postgresql/information_schema.sql 0644 root root 106299 41008 1347419307 1 f none /usr/local/share/postgresql/pg_hba.conf.sample 0644 root root 4420 35114 1347419307 1 f none /usr/local/share/postgresql/pg_ident.conf.sample 0644 root root 1636 5990 1347419307 1 f none /usr/local/share/postgresql/pg_service.conf.sample 0644 root root 604 53878 1347419309 1 f none /usr/local/share/postgresql/postgres.bki 0644 root root 519298 5463 1347419307 1 f none /usr/local/share/postgresql/postgres.description 0644 root root 98573 8879 1347419307 1 f none /usr/local/share/postgresql/postgres.shdescription 0644 root root 49 4530 1347419307 1 f none /usr/local/share/postgresql/postgresql.conf.sample 0644 root root 19579 64258 1347419307 1 f none /usr/local/share/postgresql/psqlrc.sample 0644 root root 211 18203 1347419310 1 f none /usr/local/share/postgresql/recovery.conf.sample 0644 root root 4704 50755 1347419307 1 f none /usr/local/share/postgresql/snowball_create.sql 0644 root root 13337 37703 1347419308 1 f none /usr/local/share/postgresql/sql_features.txt 0644 root root 33035 51692 1347419307 1 f none /usr/local/share/postgresql/system_views.sql 0644 root root 27302 25797 1347419307 1 d none /usr/local/share/postgresql/timezone 0755 root root 1 d none /usr/local/share/postgresql/timezone/Africa 0755 root root 1 f none /usr/local/share/postgresql/timezone/Africa/Abidjan 0644 root root 156 5984 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Accra 0644 root root 378 37100 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Addis_Ababa 0644 root root 180 7157 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Algiers 0644 root root 734 62353 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Asmara 0644 root root 201 9012 1347419306 1 l none /usr/local/share/postgresql/timezone/Africa/Asmera=/usr/local/share/postgresql/timezone/Africa/Asmara 1 f none /usr/local/share/postgresql/timezone/Africa/Bamako 0644 root root 208 12622 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Bangui 0644 root root 157 4570 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Banjul 0644 root root 232 14560 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Bissau 0644 root root 194 8834 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Blantyre 0644 root root 157 4901 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Brazzaville 0644 root root 157 4570 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Bujumbura 0644 root root 140 3870 1347419306 1 l none /usr/local/share/postgresql/timezone/Africa/Cairo=/usr/local/share/postgresql/timezone/Egypt 1 f none /usr/local/share/postgresql/timezone/Africa/Casablanca 0644 root root 1346 27095 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Ceuta 0644 root root 2049 1023 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Conakry 0644 root root 208 12712 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Dakar 0644 root root 194 10846 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Dar_es_Salaam 0644 root root 213 11094 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Djibouti 0644 root root 157 4878 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Douala 0644 root root 157 4570 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/El_Aaiun 0644 root root 194 10028 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Freetown 0644 root root 665 11978 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Gaborone 0644 root root 194 8500 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Harare 0644 root root 157 4391 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Johannesburg 0644 root root 245 14912 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Juba 0644 root root 669 33364 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Kampala 0644 root root 253 13934 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Khartoum 0644 root root 669 32854 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Kigali 0644 root root 157 4481 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Kinshasa 0644 root root 140 3539 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Lagos 0644 root root 157 4510 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Libreville 0644 root root 157 5080 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Lome 0644 root root 139 3391 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Luanda 0644 root root 178 6113 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Lubumbashi 0644 root root 140 3540 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Lusaka 0644 root root 157 4901 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Malabo 0644 root root 195 7532 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Maputo 0644 root root 157 4901 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Maseru 0644 root root 204 9670 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Mbabane 0644 root root 160 4690 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Mogadishu 0644 root root 194 9300 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Monrovia 0644 root root 215 12455 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Nairobi 0644 root root 253 14654 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Ndjamena 0644 root root 211 6812 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Niamey 0644 root root 225 11818 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Nouakchott 0644 root root 208 13432 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Ouagadougou 0644 root root 156 6494 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Porto-Novo 0644 root root 195 7382 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Sao_Tome 0644 root root 173 7551 1347419306 1 l none /usr/local/share/postgresql/timezone/Africa/Timbuktu=/usr/local/share/postgresql/timezone/Africa/Bamako 1 l none /usr/local/share/postgresql/timezone/Africa/Tripoli=/usr/local/share/postgresql/timezone/Libya 1 f none /usr/local/share/postgresql/timezone/Africa/Tunis 0644 root root 684 51500 1347419306 1 f none /usr/local/share/postgresql/timezone/Africa/Windhoek 0644 root root 1556 23610 1347419306 1 d none /usr/local/share/postgresql/timezone/America 0755 root root 1 l none /usr/local/share/postgresql/timezone/America/Adak=/usr/local/share/postgresql/timezone/America/Atka 1 f none /usr/local/share/postgresql/timezone/America/Anchorage 0644 root root 2358 26983 1347419306 1 f none /usr/local/share/postgresql/timezone/America/Anguilla 0644 root root 156 7400 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Antigua 0644 root root 194 11842 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Araguaina 0644 root root 854 15298 1347419307 1 d none /usr/local/share/postgresql/timezone/America/Argentina 0755 root root 1 l none /usr/local/share/postgresql/timezone/America/Argentina/Buenos_Aires=/usr/local/share/postgresql/timezone/America/Buenos_Aires 1 l none /usr/local/share/postgresql/timezone/America/Argentina/Catamarca=/usr/local/share/postgresql/timezone/America/Catamarca 1 l none /usr/local/share/postgresql/timezone/America/Argentina/ComodRivadavia=/usr/local/share/postgresql/timezone/America/Catamarca 1 l none /usr/local/share/postgresql/timezone/America/Argentina/Cordoba=/usr/local/share/postgresql/timezone/America/Rosario 1 l none /usr/local/share/postgresql/timezone/America/Argentina/Jujuy=/usr/local/share/postgresql/timezone/America/Jujuy 1 f none /usr/local/share/postgresql/timezone/America/Argentina/La_Rioja 0644 root root 1101 60325 1347419307 1 l none /usr/local/share/postgresql/timezone/America/Argentina/Mendoza=/usr/local/share/postgresql/timezone/America/Mendoza 1 f none /usr/local/share/postgresql/timezone/America/Argentina/Rio_Gallegos 0644 root root 1087 59772 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Argentina/Salta 0644 root root 1059 58025 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Argentina/San_Juan 0644 root root 1101 60070 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Argentina/San_Luis 0644 root root 1125 64168 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Argentina/Tucuman 0644 root root 1115 62329 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Argentina/Ushuaia 0644 root root 1087 59697 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Aruba 0644 root root 194 11764 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Asuncion 0644 root root 2020 2515 1347419307 1 l none /usr/local/share/postgresql/timezone/America/Atikokan=/usr/local/share/postgresql/timezone/America/Coral_Harbour 1 f none /usr/local/share/postgresql/timezone/America/Atka 0644 root root 2353 31091 1347419306 1 f none /usr/local/share/postgresql/timezone/America/Bahia 0644 root root 1777 8238 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Bahia_Banderas 0644 root root 1558 44889 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Barbados 0644 root root 330 21178 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Belem 0644 root root 574 63873 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Belize 0644 root root 962 59845 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Blanc-Sablon 0644 root root 281 24420 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Boa_Vista 0644 root root 630 2799 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Bogota 0644 root root 231 13834 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Boise 0644 root root 2377 27205 1347419306 1 f none /usr/local/share/postgresql/timezone/America/Buenos_Aires 0644 root root 1061 57344 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Cambridge_Bay 0644 root root 2052 714 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Campo_Grande 0644 root root 2001 26193 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Cancun 0644 root root 1450 32355 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Caracas 0644 root root 224 14676 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Catamarca 0644 root root 1087 59834 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Cayenne 0644 root root 186 12292 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Cayman 0644 root root 177 9618 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Chicago 0644 root root 3543 26898 1347419306 1 f none /usr/local/share/postgresql/timezone/America/Chihuahua 0644 root root 1492 29758 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Coral_Harbour 0644 root root 319 28726 1347419307 1 l none /usr/local/share/postgresql/timezone/America/Cordoba=/usr/local/share/postgresql/timezone/America/Rosario 1 f none /usr/local/share/postgresql/timezone/America/Costa_Rica 0644 root root 315 18724 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Creston 0644 root root 191 12056 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Cuiaba 0644 root root 1973 24593 1347419307 1 l none /usr/local/share/postgresql/timezone/America/Curacao=/usr/local/share/postgresql/timezone/America/Lower_Princes 1 f none /usr/local/share/postgresql/timezone/America/Danmarkshavn 0644 root root 700 40484 1347419306 1 f none /usr/local/share/postgresql/timezone/America/Dawson 0644 root root 2067 10138 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Dawson_Creek 0644 root root 1033 62916 1347419307 1 l none /usr/local/share/postgresql/timezone/America/Denver=/usr/local/share/postgresql/timezone/America/Shiprock 1 f none /usr/local/share/postgresql/timezone/America/Detroit 0644 root root 2202 32128 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Dominica 0644 root root 156 7640 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Edmonton 0644 root root 2388 36832 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Eirunepe 0644 root root 640 4331 1347419307 1 f none /usr/local/share/postgresql/timezone/America/El_Salvador 0644 root root 236 13512 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Ensenada 0644 root root 2342 44117 1347419307 1 l none /usr/local/share/postgresql/timezone/America/Fort_Wayne=/usr/local/share/postgresql/timezone/America/Indiana/Indianapolis 1 f none /usr/local/share/postgresql/timezone/America/Fortaleza 0644 root root 714 7958 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Glace_Bay 0644 root root 2192 25601 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Godthab 0644 root root 8296 56379 1347419306 1 f none /usr/local/share/postgresql/timezone/America/Goose_Bay 0644 root root 3177 44944 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Grand_Turk 0644 root root 1871 63699 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Grenada 0644 root root 156 7520 1347419307 1 l none /usr/local/share/postgresql/timezone/America/Guadeloupe=/usr/local/share/postgresql/timezone/America/Marigot 1 f none /usr/local/share/postgresql/timezone/America/Guatemala 0644 root root 292 17312 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Guayaquil 0644 root root 177 9717 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Guyana 0644 root root 256 17404 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Halifax 0644 root root 3424 16864 1347419307 1 l none /usr/local/share/postgresql/timezone/America/Havana=/usr/local/share/postgresql/timezone/Cuba 1 f none /usr/local/share/postgresql/timezone/America/Hermosillo 0644 root root 424 34895 1347419307 1 d none /usr/local/share/postgresql/timezone/America/Indiana 0755 root root 1 f none /usr/local/share/postgresql/timezone/America/Indiana/Indianapolis 0644 root root 1649 27497 1347419306 1 f none /usr/local/share/postgresql/timezone/America/Indiana/Knox 0644 root root 2395 16709 1347419306 1 f none /usr/local/share/postgresql/timezone/America/Indiana/Marengo 0644 root root 1705 23078 1347419306 1 f none /usr/local/share/postgresql/timezone/America/Indiana/Petersburg 0644 root root 1887 44898 1347419306 1 f none /usr/local/share/postgresql/timezone/America/Indiana/Tell_City 0644 root root 1677 27456 1347419306 1 f none /usr/local/share/postgresql/timezone/America/Indiana/Vevay 0644 root root 1397 48217 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Indiana/Vincennes 0644 root root 1677 32576 1347419306 1 f none /usr/local/share/postgresql/timezone/America/Indiana/Winamac 0644 root root 1761 46389 1347419307 1 l none /usr/local/share/postgresql/timezone/America/Indianapolis=/usr/local/share/postgresql/timezone/America/Indiana/Indianapolis 1 f none /usr/local/share/postgresql/timezone/America/Inuvik 0644 root root 1914 49021 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Iqaluit 0644 root root 2000 13720 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Jamaica 0644 root root 481 28533 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Jujuy 0644 root root 1087 61777 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Juneau 0644 root root 2336 21616 1347419306 1 d none /usr/local/share/postgresql/timezone/America/Kentucky 0755 root root 1 f none /usr/local/share/postgresql/timezone/America/Kentucky/Louisville 0644 root root 2755 47219 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Kentucky/Monticello 0644 root root 2335 38401 1347419307 1 l none /usr/local/share/postgresql/timezone/America/Knox_IN=/usr/local/share/postgresql/timezone/America/Indiana/Knox 1 l none /usr/local/share/postgresql/timezone/America/Kralendijk=/usr/local/share/postgresql/timezone/America/Lower_Princes 1 f none /usr/local/share/postgresql/timezone/America/La_Paz 0644 root root 217 14860 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Lima 0644 root root 395 32150 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Los_Angeles 0644 root root 2819 38311 1347419306 1 l none /usr/local/share/postgresql/timezone/America/Louisville=/usr/local/share/postgresql/timezone/America/Kentucky/Louisville 1 f none /usr/local/share/postgresql/timezone/America/Lower_Princes 0644 root root 194 11764 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Maceio 0644 root root 742 9288 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Managua 0644 root root 421 25986 1347419307 1 l none /usr/local/share/postgresql/timezone/America/Manaus=/usr/local/share/postgresql/timezone/Brazil/West 1 f none /usr/local/share/postgresql/timezone/America/Marigot 0644 root root 156 8060 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Martinique 0644 root root 231 14095 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Matamoros 0644 root root 1402 25394 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Mazatlan 0644 root root 1534 35102 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Mendoza 0644 root root 1115 63114 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Menominee 0644 root root 2241 28442 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Merida 0644 root root 1426 28217 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Metlakatla 0644 root root 717 44064 1347419306 1 f none /usr/local/share/postgresql/timezone/America/Mexico_City 0644 root root 1604 58057 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Miquelon 0644 root root 1670 44401 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Moncton 0644 root root 3137 47231 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Monterrey 0644 root root 1402 26265 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Montevideo 0644 root root 2118 63039 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Montreal 0644 root root 3477 38312 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Montserrat 0644 root root 156 7640 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Nassau 0644 root root 2270 40966 1347419307 1 f none /usr/local/share/postgresql/timezone/America/New_York 0644 root root 3519 46774 1347419306 1 f none /usr/local/share/postgresql/timezone/America/Nipigon 0644 root root 2105 22275 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Nome 0644 root root 2350 28432 1347419306 1 l none /usr/local/share/postgresql/timezone/America/Noronha=/usr/local/share/postgresql/timezone/Brazil/DeNoronha 1 d none /usr/local/share/postgresql/timezone/America/North_Dakota 0755 root root 1 f none /usr/local/share/postgresql/timezone/America/North_Dakota/Beulah 0644 root root 2363 27674 1347419306 1 f none /usr/local/share/postgresql/timezone/America/North_Dakota/Center 0644 root root 2363 30762 1347419306 1 f none /usr/local/share/postgresql/timezone/America/North_Dakota/New_Salem 0644 root root 2363 28564 1347419306 1 f none /usr/local/share/postgresql/timezone/America/Ojinaga 0644 root root 1492 33615 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Panama 0644 root root 177 10127 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Pangnirtung 0644 root root 2062 22092 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Paramaribo 0644 root root 294 21242 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Phoenix 0644 root root 327 31330 1347419306 1 f none /usr/local/share/postgresql/timezone/America/Port-au-Prince 0644 root root 739 47005 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Port_of_Spain 0644 root root 156 7400 1347419307 1 l none /usr/local/share/postgresql/timezone/America/Porto_Acre=/usr/local/share/postgresql/timezone/Brazil/Acre 1 f none /usr/local/share/postgresql/timezone/America/Porto_Velho 0644 root root 574 63874 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Puerto_Rico 0644 root root 229 17996 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Rainy_River 0644 root root 2105 12146 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Rankin_Inlet 0644 root root 1900 58156 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Recife 0644 root root 714 8078 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Regina 0644 root root 980 62715 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Resolute 0644 root root 1900 58640 1347419307 1 l none /usr/local/share/postgresql/timezone/America/Rio_Branco=/usr/local/share/postgresql/timezone/Brazil/Acre 1 f none /usr/local/share/postgresql/timezone/America/Rosario 0644 root root 1087 60145 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Santa_Isabel 0644 root root 2342 40052 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Santarem 0644 root root 612 1408 1347419307 1 l none /usr/local/share/postgresql/timezone/America/Santiago=/usr/local/share/postgresql/timezone/Chile/Continental 1 f none /usr/local/share/postgresql/timezone/America/Santo_Domingo 0644 root root 463 34891 1347419307 1 l none /usr/local/share/postgresql/timezone/America/Sao_Paulo=/usr/local/share/postgresql/timezone/Brazil/East 1 f none /usr/local/share/postgresql/timezone/America/Scoresbysund 0644 root root 1911 49060 1347419306 1 f none /usr/local/share/postgresql/timezone/America/Shiprock 0644 root root 2427 36179 1347419306 1 f none /usr/local/share/postgresql/timezone/America/Sitka 0644 root root 2324 20130 1347419306 1 l none /usr/local/share/postgresql/timezone/America/St_Barthelemy=/usr/local/share/postgresql/timezone/America/Marigot 1 f none /usr/local/share/postgresql/timezone/America/St_Johns 0644 root root 3622 48012 1347419307 1 f none /usr/local/share/postgresql/timezone/America/St_Kitts 0644 root root 156 7400 1347419307 1 f none /usr/local/share/postgresql/timezone/America/St_Lucia 0644 root root 177 10909 1347419307 1 l none /usr/local/share/postgresql/timezone/America/St_Thomas=/usr/local/share/postgresql/timezone/America/Virgin 1 f none /usr/local/share/postgresql/timezone/America/St_Vincent 0644 root root 177 10925 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Swift_Current 0644 root root 560 60208 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Tegucigalpa 0644 root root 264 15502 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Thule 0644 root root 1514 37722 1347419306 1 f none /usr/local/share/postgresql/timezone/America/Thunder_Bay 0644 root root 2185 26584 1347419307 1 l none /usr/local/share/postgresql/timezone/America/Tijuana=/usr/local/share/postgresql/timezone/America/Ensenada 1 f none /usr/local/share/postgresql/timezone/America/Toronto 0644 root root 3477 35777 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Tortola 0644 root root 156 7520 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Vancouver 0644 root root 2875 45893 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Virgin 0644 root root 156 7520 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Whitehorse 0644 root root 2067 11400 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Winnipeg 0644 root root 2865 43735 1347419307 1 f none /usr/local/share/postgresql/timezone/America/Yakutat 0644 root root 2288 18405 1347419306 1 f none /usr/local/share/postgresql/timezone/America/Yellowknife 0644 root root 1966 56841 1347419307 1 d none /usr/local/share/postgresql/timezone/Antarctica 0755 root root 1 f none /usr/local/share/postgresql/timezone/Antarctica/Casey 0644 root root 255 10901 1347419306 1 f none /usr/local/share/postgresql/timezone/Antarctica/Davis 0644 root root 276 13837 1347419306 1 f none /usr/local/share/postgresql/timezone/Antarctica/DumontDUrville 0644 root root 213 10559 1347419306 1 f none /usr/local/share/postgresql/timezone/Antarctica/Macquarie 0644 root root 1549 28221 1347419306 1 f none /usr/local/share/postgresql/timezone/Antarctica/Mawson 0644 root root 190 6045 1347419306 1 l none /usr/local/share/postgresql/timezone/Antarctica/McMurdo=/usr/local/share/postgresql/timezone/Antarctica/South_Pole 1 f none /usr/local/share/postgresql/timezone/Antarctica/Palmer 0644 root root 8780 8000 1347419306 1 f none /usr/local/share/postgresql/timezone/Antarctica/Rothera 0644 root root 159 4676 1347419306 1 f none /usr/local/share/postgresql/timezone/Antarctica/South_Pole 0644 root root 2001 440 1347419306 1 f none /usr/local/share/postgresql/timezone/Antarctica/Syowa 0644 root root 160 4949 1347419306 1 f none /usr/local/share/postgresql/timezone/Antarctica/Vostok 0644 root root 160 5303 1347419306 1 d none /usr/local/share/postgresql/timezone/Arctic 0755 root root 1 l none /usr/local/share/postgresql/timezone/Arctic/Longyearbyen=/usr/local/share/postgresql/timezone/Atlantic/Jan_Mayen 1 d none /usr/local/share/postgresql/timezone/Asia 0755 root root 1 f none /usr/local/share/postgresql/timezone/Asia/Aden 0644 root root 157 4470 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Almaty 0644 root root 922 51675 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Amman 0644 root root 8504 1317 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Anadyr 0644 root root 1167 3739 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Aqtau 0644 root root 1112 60574 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Aqtobe 0644 root root 1038 55520 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Ashgabat 0644 root root 657 32693 1347419306 1 l none /usr/local/share/postgresql/timezone/Asia/Ashkhabad=/usr/local/share/postgresql/timezone/Asia/Ashgabat 1 f none /usr/local/share/postgresql/timezone/Asia/Baghdad 0644 root root 962 49998 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Bahrain 0644 root root 195 6572 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Baku 0644 root root 1942 41162 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Bangkok 0644 root root 178 7056 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Beirut 0644 root root 2149 31718 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Bishkek 0644 root root 1047 56925 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Brunei 0644 root root 187 7515 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Calcutta 0644 root root 265 15172 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Choibalsan 0644 root root 890 48551 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Chongqing 0644 root root 389 16521 1347419306 1 l none /usr/local/share/postgresql/timezone/Asia/Chungking=/usr/local/share/postgresql/timezone/Asia/Chongqing 1 f none /usr/local/share/postgresql/timezone/Asia/Colombo 0644 root root 347 17779 1347419306 1 l none /usr/local/share/postgresql/timezone/Asia/Dacca=/usr/local/share/postgresql/timezone/Asia/Dhaka 1 f none /usr/local/share/postgresql/timezone/Asia/Damascus 0644 root root 2306 42956 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Dhaka 0644 root root 364 20219 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Dili 0644 root root 277 14380 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Dubai 0644 root root 157 5449 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Dushanbe 0644 root root 597 30470 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Gaza 0644 root root 1562 8330 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Harbin 0644 root root 447 24821 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Hebron 0644 root root 1590 9332 1347419306 1 l none /usr/local/share/postgresql/timezone/Asia/Ho_Chi_Minh=/usr/local/share/postgresql/timezone/Asia/Saigon 1 f none /usr/local/share/postgresql/timezone/Asia/Hong_Kong 0644 root root 1159 3228 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Hovd 0644 root root 834 42789 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Irkutsk 0644 root root 1187 1658 1347419306 1 l none /usr/local/share/postgresql/timezone/Asia/Istanbul=/usr/local/share/postgresql/timezone/Turkey 1 f none /usr/local/share/postgresql/timezone/Asia/Jakarta 0644 root root 344 23265 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Jayapura 0644 root root 209 11510 1347419306 1 l none /usr/local/share/postgresql/timezone/Asia/Jerusalem=/usr/local/share/postgresql/timezone/Asia/Tel_Aviv 1 f none /usr/local/share/postgresql/timezone/Asia/Kabul 0644 root root 173 6935 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Kamchatka 0644 root root 1151 3578 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Karachi 0644 root root 389 21593 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Kashgar 0644 root root 419 18469 1347419306 1 l none /usr/local/share/postgresql/timezone/Asia/Kathmandu=/usr/local/share/postgresql/timezone/Asia/Katmandu 1 f none /usr/local/share/postgresql/timezone/Asia/Katmandu 0644 root root 198 7371 1347419306 1 l none /usr/local/share/postgresql/timezone/Asia/Kolkata=/usr/local/share/postgresql/timezone/Asia/Calcutta 1 f none /usr/local/share/postgresql/timezone/Asia/Krasnoyarsk 0644 root root 1166 64951 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Kuala_Lumpur 0644 root root 372 22800 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Kuching 0644 root root 505 46305 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Kuwait 0644 root root 157 4980 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Macao 0644 root root 781 62419 1347419306 1 l none /usr/local/share/postgresql/timezone/Asia/Macau=/usr/local/share/postgresql/timezone/Asia/Macao 1 f none /usr/local/share/postgresql/timezone/Asia/Magadan 0644 root root 1167 4334 1347419306 1 l none /usr/local/share/postgresql/timezone/Asia/Makassar=/usr/local/share/postgresql/timezone/Asia/Ujung_Pandang 1 f none /usr/local/share/postgresql/timezone/Asia/Manila 0644 root root 319 23444 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Muscat 0644 root root 157 5449 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Nicosia 0644 root root 2002 52702 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Novokuznetsk 0644 root root 1220 1920 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Novosibirsk 0644 root root 1180 2412 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Omsk 0644 root root 1166 1960 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Oral 0644 root root 1086 58276 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Phnom_Penh 0644 root root 239 12906 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Pontianak 0644 root root 359 22984 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Pyongyang 0644 root root 242 16670 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Qatar 0644 root root 195 6572 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Qyzylorda 0644 root root 1068 57571 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Rangoon 0644 root root 259 14324 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Riyadh 0644 root root 157 4980 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Riyadh87 0644 root root 8669 45903 1347419307 1 f none /usr/local/share/postgresql/timezone/Asia/Riyadh88 0644 root root 8523 42059 1347419307 1 f none /usr/local/share/postgresql/timezone/Asia/Riyadh89 0644 root root 8523 41415 1347419307 1 f none /usr/local/share/postgresql/timezone/Asia/Saigon 0644 root root 239 12906 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Sakhalin 0644 root root 1197 3067 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Samarkand 0644 root root 677 34551 1347419306 1 l none /usr/local/share/postgresql/timezone/Asia/Seoul=/usr/local/share/postgresql/timezone/ROK 1 l none /usr/local/share/postgresql/timezone/Asia/Shanghai=/usr/local/share/postgresql/timezone/PRC 1 f none /usr/local/share/postgresql/timezone/Asia/Singapore 0644 root root 402 25591 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Taipei 0644 root root 724 21200 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Tashkent 0644 root root 667 33929 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Tbilisi 0644 root root 1100 58787 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Tehran 0644 root root 1622 35051 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Tel_Aviv 0644 root root 2197 52191 1347419306 1 l none /usr/local/share/postgresql/timezone/Asia/Thimbu=/usr/local/share/postgresql/timezone/Asia/Thimphu 1 f none /usr/local/share/postgresql/timezone/Asia/Thimphu 0644 root root 195 6525 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Tokyo 0644 root root 331 28605 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Ujung_Pandang 0644 root root 247 14413 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Ulaanbaatar 0644 root root 834 44805 1347419306 1 l none /usr/local/share/postgresql/timezone/Asia/Ulan_Bator=/usr/local/share/postgresql/timezone/Asia/Ulaanbaatar 1 f none /usr/local/share/postgresql/timezone/Asia/Urumqi 0644 root root 389 16049 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Vientiane 0644 root root 239 12906 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Vladivostok 0644 root root 1181 62618 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Yakutsk 0644 root root 1167 63467 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Yekaterinburg 0644 root root 1252 5653 1347419306 1 f none /usr/local/share/postgresql/timezone/Asia/Yerevan 0644 root root 1263 5768 1347419306 1 d none /usr/local/share/postgresql/timezone/Atlantic 0755 root root 1 f none /usr/local/share/postgresql/timezone/Atlantic/Azores 0644 root root 3462 11487 1347419306 1 f none /usr/local/share/postgresql/timezone/Atlantic/Bermuda 0644 root root 1990 1965 1347419307 1 f none /usr/local/share/postgresql/timezone/Atlantic/Canary 0644 root root 1899 45340 1347419306 1 f none /usr/local/share/postgresql/timezone/Atlantic/Cape_Verde 0644 root root 240 17456 1347419306 1 f none /usr/local/share/postgresql/timezone/Atlantic/Faeroe 0644 root root 1815 38838 1347419306 1 l none /usr/local/share/postgresql/timezone/Atlantic/Faroe=/usr/local/share/postgresql/timezone/Atlantic/Faeroe 1 f none /usr/local/share/postgresql/timezone/Atlantic/Jan_Mayen 0644 root root 2225 22171 1347419306 1 f none /usr/local/share/postgresql/timezone/Atlantic/Madeira 0644 root root 3452 1316 1347419306 1 f none /usr/local/share/postgresql/timezone/Atlantic/Reykjavik 0644 root root 1141 18180 1347419306 1 f none /usr/local/share/postgresql/timezone/Atlantic/South_Georgia 0644 root root 139 6459 1347419307 1 f none /usr/local/share/postgresql/timezone/Atlantic/St_Helena 0644 root root 177 8952 1347419306 1 f none /usr/local/share/postgresql/timezone/Atlantic/Stanley 0644 root root 1204 27019 1347419307 1 d none /usr/local/share/postgresql/timezone/Australia 0755 root root 1 f none /usr/local/share/postgresql/timezone/Australia/ACT 0644 root root 2183 64415 1347419306 1 l none /usr/local/share/postgresql/timezone/Australia/Adelaide=/usr/local/share/postgresql/timezone/Australia/South 1 f none /usr/local/share/postgresql/timezone/Australia/Brisbane 0644 root root 413 28218 1347419306 1 f none /usr/local/share/postgresql/timezone/Australia/Broken_Hill 0644 root root 2237 5034 1347419306 1 l none /usr/local/share/postgresql/timezone/Australia/Canberra=/usr/local/share/postgresql/timezone/Australia/ACT 1 f none /usr/local/share/postgresql/timezone/Australia/Currie 0644 root root 2183 62119 1347419306 1 l none /usr/local/share/postgresql/timezone/Australia/Darwin=/usr/local/share/postgresql/timezone/Australia/North 1 f none /usr/local/share/postgresql/timezone/Australia/Eucla 0644 root root 446 25452 1347419306 1 f none /usr/local/share/postgresql/timezone/Australia/Hobart 0644 root root 2295 8958 1347419306 1 f none /usr/local/share/postgresql/timezone/Australia/LHI 0644 root root 1821 59909 1347419306 1 f none /usr/local/share/postgresql/timezone/Australia/Lindeman 0644 root root 483 33220 1347419306 1 l none /usr/local/share/postgresql/timezone/Australia/Lord_Howe=/usr/local/share/postgresql/timezone/Australia/LHI 1 l none /usr/local/share/postgresql/timezone/Australia/Melbourne=/usr/local/share/postgresql/timezone/Australia/Victoria 1 l none /usr/local/share/postgresql/timezone/Australia/NSW=/usr/local/share/postgresql/timezone/Australia/ACT 1 f none /usr/local/share/postgresql/timezone/Australia/North 0644 root root 288 23683 1347419306 1 l none /usr/local/share/postgresql/timezone/Australia/Perth=/usr/local/share/postgresql/timezone/Australia/West 1 l none /usr/local/share/postgresql/timezone/Australia/Queensland=/usr/local/share/postgresql/timezone/Australia/Brisbane 1 f none /usr/local/share/postgresql/timezone/Australia/South 0644 root root 2202 956 1347419306 1 l none /usr/local/share/postgresql/timezone/Australia/Sydney=/usr/local/share/postgresql/timezone/Australia/ACT 1 l none /usr/local/share/postgresql/timezone/Australia/Tasmania=/usr/local/share/postgresql/timezone/Australia/Hobart 1 f none /usr/local/share/postgresql/timezone/Australia/Victoria 0644 root root 2183 63395 1347419306 1 f none /usr/local/share/postgresql/timezone/Australia/West 0644 root root 440 28776 1347419306 1 l none /usr/local/share/postgresql/timezone/Australia/Yancowinna=/usr/local/share/postgresql/timezone/Australia/Broken_Hill 1 d none /usr/local/share/postgresql/timezone/Brazil 0755 root root 1 f none /usr/local/share/postgresql/timezone/Brazil/Acre 0644 root root 612 2401 1347419307 1 f none /usr/local/share/postgresql/timezone/Brazil/DeNoronha 0644 root root 714 6427 1347419307 1 f none /usr/local/share/postgresql/timezone/Brazil/East 0644 root root 2001 22898 1347419307 1 f none /usr/local/share/postgresql/timezone/Brazil/West 0644 root root 602 149 1347419307 1 f none /usr/local/share/postgresql/timezone/CET 0644 root root 2102 3261 1347419306 1 f none /usr/local/share/postgresql/timezone/CST6CDT 0644 root root 2294 30587 1347419306 1 d none /usr/local/share/postgresql/timezone/Canada 0755 root root 1 l none /usr/local/share/postgresql/timezone/Canada/Atlantic=/usr/local/share/postgresql/timezone/America/Halifax 1 l none /usr/local/share/postgresql/timezone/Canada/Central=/usr/local/share/postgresql/timezone/America/Winnipeg 1 l none /usr/local/share/postgresql/timezone/Canada/East-Saskatchewan=/usr/local/share/postgresql/timezone/America/Regina 1 l none /usr/local/share/postgresql/timezone/Canada/Eastern=/usr/local/share/postgresql/timezone/America/Toronto 1 l none /usr/local/share/postgresql/timezone/Canada/Mountain=/usr/local/share/postgresql/timezone/America/Edmonton 1 l none /usr/local/share/postgresql/timezone/Canada/Newfoundland=/usr/local/share/postgresql/timezone/America/St_Johns 1 l none /usr/local/share/postgresql/timezone/Canada/Pacific=/usr/local/share/postgresql/timezone/America/Vancouver 1 l none /usr/local/share/postgresql/timezone/Canada/Saskatchewan=/usr/local/share/postgresql/timezone/America/Regina 1 l none /usr/local/share/postgresql/timezone/Canada/Yukon=/usr/local/share/postgresql/timezone/America/Whitehorse 1 d none /usr/local/share/postgresql/timezone/Chile 0755 root root 1 f none /usr/local/share/postgresql/timezone/Chile/Continental 0644 root root 9245 52728 1347419307 1 f none /usr/local/share/postgresql/timezone/Chile/EasterIsland 0644 root root 9007 15424 1347419307 1 f none /usr/local/share/postgresql/timezone/Cuba 0644 root root 2411 62017 1347419307 1 f none /usr/local/share/postgresql/timezone/EET 0644 root root 1876 39332 1347419306 1 f none /usr/local/share/postgresql/timezone/EST 0644 root root 118 3399 1347419306 1 f none /usr/local/share/postgresql/timezone/EST5EDT 0644 root root 2294 44916 1347419306 1 f none /usr/local/share/postgresql/timezone/Egypt 0644 root root 1906 36864 1347419306 1 f none /usr/local/share/postgresql/timezone/Eire 0644 root root 3533 62255 1347419306 1 d none /usr/local/share/postgresql/timezone/Etc 0755 root root 1 l none /usr/local/share/postgresql/timezone/Etc/GMT=/usr/local/share/postgresql/timezone/GMT 1 l none /usr/local/share/postgresql/timezone/Etc/GMT+0=/usr/local/share/postgresql/timezone/GMT 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+1 0644 root root 126 4025 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+10 0644 root root 130 3679 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+11 0644 root root 130 3623 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+12 0644 root root 130 3567 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+2 0644 root root 126 3969 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+3 0644 root root 126 3913 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+4 0644 root root 126 3857 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+5 0644 root root 126 3801 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+6 0644 root root 126 3745 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+7 0644 root root 126 3689 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+8 0644 root root 126 3633 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT+9 0644 root root 126 3577 1347419307 1 l none /usr/local/share/postgresql/timezone/Etc/GMT-0=/usr/local/share/postgresql/timezone/GMT 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-1 0644 root root 127 2154 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-10 0644 root root 131 2888 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-11 0644 root root 131 2952 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-12 0644 root root 131 3016 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-13 0644 root root 131 3080 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-14 0644 root root 131 3144 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-2 0644 root root 127 2218 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-3 0644 root root 127 2282 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-4 0644 root root 127 2346 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-5 0644 root root 127 2410 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-6 0644 root root 127 2474 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-7 0644 root root 127 2538 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-8 0644 root root 127 2602 1347419307 1 f none /usr/local/share/postgresql/timezone/Etc/GMT-9 0644 root root 127 2666 1347419307 1 l none /usr/local/share/postgresql/timezone/Etc/GMT0=/usr/local/share/postgresql/timezone/GMT 1 l none /usr/local/share/postgresql/timezone/Etc/Greenwich=/usr/local/share/postgresql/timezone/GMT 1 l none /usr/local/share/postgresql/timezone/Etc/UCT=/usr/local/share/postgresql/timezone/UCT 1 l none /usr/local/share/postgresql/timezone/Etc/UTC=/usr/local/share/postgresql/timezone/UTC 1 l none /usr/local/share/postgresql/timezone/Etc/Universal=/usr/local/share/postgresql/timezone/UTC 1 l none /usr/local/share/postgresql/timezone/Etc/Zulu=/usr/local/share/postgresql/timezone/UTC 1 d none /usr/local/share/postgresql/timezone/Europe 0755 root root 1 f none /usr/local/share/postgresql/timezone/Europe/Amsterdam 0644 root root 2917 37182 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Andorra 0644 root root 1725 31329 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Athens 0644 root root 2245 8903 1347419306 1 l none /usr/local/share/postgresql/timezone/Europe/Belfast=/usr/local/share/postgresql/timezone/GB-Eire 1 l none /usr/local/share/postgresql/timezone/Europe/Belgrade=/usr/local/share/postgresql/timezone/Europe/Sarajevo 1 f none /usr/local/share/postgresql/timezone/Europe/Berlin 0644 root root 2309 31972 1347419306 1 l none /usr/local/share/postgresql/timezone/Europe/Bratislava=/usr/local/share/postgresql/timezone/Europe/Prague 1 f none /usr/local/share/postgresql/timezone/Europe/Brussels 0644 root root 2944 49652 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Bucharest 0644 root root 2195 15951 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Budapest 0644 root root 2407 54508 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Chisinau 0644 root root 2407 39520 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Copenhagen 0644 root root 2134 9516 1347419306 1 l none /usr/local/share/postgresql/timezone/Europe/Dublin=/usr/local/share/postgresql/timezone/Eire 1 f none /usr/local/share/postgresql/timezone/Europe/Gibraltar 0644 root root 3035 21375 1347419306 1 l none /usr/local/share/postgresql/timezone/Europe/Guernsey=/usr/local/share/postgresql/timezone/GB-Eire 1 l none /usr/local/share/postgresql/timezone/Europe/Helsinki=/usr/local/share/postgresql/timezone/Europe/Mariehamn 1 l none /usr/local/share/postgresql/timezone/Europe/Isle_of_Man=/usr/local/share/postgresql/timezone/GB-Eire 1 l none /usr/local/share/postgresql/timezone/Europe/Istanbul=/usr/local/share/postgresql/timezone/Turkey 1 l none /usr/local/share/postgresql/timezone/Europe/Jersey=/usr/local/share/postgresql/timezone/GB-Eire 1 f none /usr/local/share/postgresql/timezone/Europe/Kaliningrad 0644 root root 1494 30053 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Kiev 0644 root root 2057 60272 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Lisbon 0644 root root 3439 3130 1347419306 1 l none /usr/local/share/postgresql/timezone/Europe/Ljubljana=/usr/local/share/postgresql/timezone/Europe/Sarajevo 1 l none /usr/local/share/postgresql/timezone/Europe/London=/usr/local/share/postgresql/timezone/GB-Eire 1 f none /usr/local/share/postgresql/timezone/Europe/Luxembourg 0644 root root 2960 43302 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Madrid 0644 root root 2593 362 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Malta 0644 root root 2603 61829 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Mariehamn 0644 root root 1883 44323 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Minsk 0644 root root 1328 11431 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Monaco 0644 root root 2927 49386 1347419306 1 l none /usr/local/share/postgresql/timezone/Europe/Moscow=/usr/local/share/postgresql/timezone/W-SU 1 l none /usr/local/share/postgresql/timezone/Europe/Nicosia=/usr/local/share/postgresql/timezone/Asia/Nicosia 1 l none /usr/local/share/postgresql/timezone/Europe/Oslo=/usr/local/share/postgresql/timezone/Atlantic/Jan_Mayen 1 f none /usr/local/share/postgresql/timezone/Europe/Paris 0644 root root 2945 47644 1347419306 1 l none /usr/local/share/postgresql/timezone/Europe/Podgorica=/usr/local/share/postgresql/timezone/Europe/Sarajevo 1 f none /usr/local/share/postgresql/timezone/Europe/Prague 0644 root root 2246 22587 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Riga 0644 root root 2209 9765 1347419306 1 l none /usr/local/share/postgresql/timezone/Europe/Rome=/usr/local/share/postgresql/timezone/Europe/San_Marino 1 f none /usr/local/share/postgresql/timezone/Europe/Samara 0644 root root 1314 6977 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/San_Marino 0644 root root 2652 3498 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Sarajevo 0644 root root 1931 52265 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Simferopol 0644 root root 2113 64622 1347419306 1 l none /usr/local/share/postgresql/timezone/Europe/Skopje=/usr/local/share/postgresql/timezone/Europe/Sarajevo 1 f none /usr/local/share/postgresql/timezone/Europe/Sofia 0644 root root 2104 59048 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Stockholm 0644 root root 1892 44662 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Tallinn 0644 root root 2175 4402 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Tirane 0644 root root 2084 58136 1347419306 1 l none /usr/local/share/postgresql/timezone/Europe/Tiraspol=/usr/local/share/postgresql/timezone/Europe/Chisinau 1 f none /usr/local/share/postgresql/timezone/Europe/Uzhgorod 0644 root root 2077 63323 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Vaduz 0644 root root 1799 36441 1347419306 1 l none /usr/local/share/postgresql/timezone/Europe/Vatican=/usr/local/share/postgresql/timezone/Europe/San_Marino 1 f none /usr/local/share/postgresql/timezone/Europe/Vienna 0644 root root 2211 22045 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Vilnius 0644 root root 2173 2489 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Volgograd 0644 root root 1218 8567 1347419306 1 l none /usr/local/share/postgresql/timezone/Europe/Warsaw=/usr/local/share/postgresql/timezone/Poland 1 l none /usr/local/share/postgresql/timezone/Europe/Zagreb=/usr/local/share/postgresql/timezone/Europe/Sarajevo 1 f none /usr/local/share/postgresql/timezone/Europe/Zaporozhye 0644 root root 2085 62452 1347419306 1 f none /usr/local/share/postgresql/timezone/Europe/Zurich 0644 root root 1892 46454 1347419306 1 f none /usr/local/share/postgresql/timezone/Factory 0644 root root 255 14338 1347419307 1 l none /usr/local/share/postgresql/timezone/GB=/usr/local/share/postgresql/timezone/GB-Eire 1 f none /usr/local/share/postgresql/timezone/GB-Eire 0644 root root 3661 21636 1347419306 1 f none /usr/local/share/postgresql/timezone/GMT 0644 root root 118 1640 1347419307 1 l none /usr/local/share/postgresql/timezone/GMT+0=/usr/local/share/postgresql/timezone/GMT 1 l none /usr/local/share/postgresql/timezone/GMT-0=/usr/local/share/postgresql/timezone/GMT 1 l none /usr/local/share/postgresql/timezone/GMT0=/usr/local/share/postgresql/timezone/GMT 1 l none /usr/local/share/postgresql/timezone/Greenwich=/usr/local/share/postgresql/timezone/GMT 1 f none /usr/local/share/postgresql/timezone/HST 0644 root root 119 3152 1347419306 1 l none /usr/local/share/postgresql/timezone/Hongkong=/usr/local/share/postgresql/timezone/Asia/Hong_Kong 1 l none /usr/local/share/postgresql/timezone/Iceland=/usr/local/share/postgresql/timezone/Atlantic/Reykjavik 1 d none /usr/local/share/postgresql/timezone/Indian 0755 root root 1 f none /usr/local/share/postgresql/timezone/Indian/Antananarivo 0644 root root 227 11130 1347419306 1 f none /usr/local/share/postgresql/timezone/Indian/Chagos 0644 root root 187 7175 1347419306 1 f none /usr/local/share/postgresql/timezone/Indian/Christmas 0644 root root 140 4064 1347419306 1 f none /usr/local/share/postgresql/timezone/Indian/Cocos 0644 root root 143 4187 1347419306 1 f none /usr/local/share/postgresql/timezone/Indian/Comoro 0644 root root 157 5388 1347419306 1 f none /usr/local/share/postgresql/timezone/Indian/Kerguelen 0644 root root 157 4868 1347419306 1 f none /usr/local/share/postgresql/timezone/Indian/Mahe 0644 root root 157 5257 1347419306 1 f none /usr/local/share/postgresql/timezone/Indian/Maldives 0644 root root 178 7445 1347419306 1 f none /usr/local/share/postgresql/timezone/Indian/Mauritius 0644 root root 239 9549 1347419306 1 f none /usr/local/share/postgresql/timezone/Indian/Mayotte 0644 root root 157 4878 1347419306 1 f none /usr/local/share/postgresql/timezone/Indian/Reunion 0644 root root 157 4630 1347419306 1 l none /usr/local/share/postgresql/timezone/Iran=/usr/local/share/postgresql/timezone/Asia/Tehran 1 l none /usr/local/share/postgresql/timezone/Israel=/usr/local/share/postgresql/timezone/Asia/Tel_Aviv 1 l none /usr/local/share/postgresql/timezone/Jamaica=/usr/local/share/postgresql/timezone/America/Jamaica 1 l none /usr/local/share/postgresql/timezone/Japan=/usr/local/share/postgresql/timezone/Asia/Tokyo 1 f none /usr/local/share/postgresql/timezone/Kwajalein 0644 root root 211 10091 1347419306 1 f none /usr/local/share/postgresql/timezone/Libya 0644 root root 599 40497 1347419306 1 f none /usr/local/share/postgresql/timezone/MET 0644 root root 2102 3321 1347419306 1 f none /usr/local/share/postgresql/timezone/MST 0644 root root 118 3305 1347419306 1 f none /usr/local/share/postgresql/timezone/MST7MDT 0644 root root 2294 17398 1347419306 1 d none /usr/local/share/postgresql/timezone/Mexico 0755 root root 1 l none /usr/local/share/postgresql/timezone/Mexico/BajaNorte=/usr/local/share/postgresql/timezone/America/Ensenada 1 l none /usr/local/share/postgresql/timezone/Mexico/BajaSur=/usr/local/share/postgresql/timezone/America/Mazatlan 1 l none /usr/local/share/postgresql/timezone/Mexico/General=/usr/local/share/postgresql/timezone/America/Mexico_City 1 d none /usr/local/share/postgresql/timezone/Mideast 0755 root root 1 l none /usr/local/share/postgresql/timezone/Mideast/Riyadh87=/usr/local/share/postgresql/timezone/Asia/Riyadh87 1 l none /usr/local/share/postgresql/timezone/Mideast/Riyadh88=/usr/local/share/postgresql/timezone/Asia/Riyadh88 1 l none /usr/local/share/postgresql/timezone/Mideast/Riyadh89=/usr/local/share/postgresql/timezone/Asia/Riyadh89 1 f none /usr/local/share/postgresql/timezone/NZ 0644 root root 2434 2200 1347419306 1 f none /usr/local/share/postgresql/timezone/NZ-CHAT 0644 root root 2018 1082 1347419306 1 l none /usr/local/share/postgresql/timezone/Navajo=/usr/local/share/postgresql/timezone/America/Shiprock 1 f none /usr/local/share/postgresql/timezone/PRC 0644 root root 405 23461 1347419306 1 f none /usr/local/share/postgresql/timezone/PST8PDT 0644 root root 2294 21479 1347419306 1 d none /usr/local/share/postgresql/timezone/Pacific 0755 root root 1 f none /usr/local/share/postgresql/timezone/Pacific/Apia 0644 root root 343 21401 1347419306 1 l none /usr/local/share/postgresql/timezone/Pacific/Auckland=/usr/local/share/postgresql/timezone/NZ 1 l none /usr/local/share/postgresql/timezone/Pacific/Chatham=/usr/local/share/postgresql/timezone/NZ-CHAT 1 f none /usr/local/share/postgresql/timezone/Pacific/Chuuk 0644 root root 144 4450 1347419306 1 l none /usr/local/share/postgresql/timezone/Pacific/Easter=/usr/local/share/postgresql/timezone/Chile/EasterIsland 1 f none /usr/local/share/postgresql/timezone/Pacific/Efate 0644 root root 464 25170 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Enderbury 0644 root root 204 8981 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Fakaofo 0644 root root 171 7664 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Fiji 0644 root root 324 16016 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Funafuti 0644 root root 141 4408 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Galapagos 0644 root root 197 10384 1347419307 1 f none /usr/local/share/postgresql/timezone/Pacific/Gambier 0644 root root 159 7002 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Guadalcanal 0644 root root 158 5540 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Guam 0644 root root 199 8566 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Honolulu 0644 root root 250 18837 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Johnston 0644 root root 119 3152 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Kiritimati 0644 root root 204 9030 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Kosrae 0644 root root 188 8020 1347419306 1 l none /usr/local/share/postgresql/timezone/Pacific/Kwajalein=/usr/local/share/postgresql/timezone/Kwajalein 1 f none /usr/local/share/postgresql/timezone/Pacific/Majuro 0644 root root 171 7032 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Marquesas 0644 root root 162 7162 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Midway 0644 root root 268 18659 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Nauru 0644 root root 240 12212 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Niue 0644 root root 200 11102 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Norfolk 0644 root root 182 7889 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Noumea 0644 root root 300 13682 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Pago_Pago 0644 root root 290 19545 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Palau 0644 root root 140 4177 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Pitcairn 0644 root root 177 8089 1347419306 1 l none /usr/local/share/postgresql/timezone/Pacific/Pohnpei=/usr/local/share/postgresql/timezone/Pacific/Ponape 1 f none /usr/local/share/postgresql/timezone/Pacific/Ponape 0644 root root 144 4550 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Port_Moresby 0644 root root 163 6758 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Rarotonga 0644 root root 548 28554 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Saipan 0644 root root 229 11262 1347419306 1 l none /usr/local/share/postgresql/timezone/Pacific/Samoa=/usr/local/share/postgresql/timezone/Pacific/Pago_Pago 1 f none /usr/local/share/postgresql/timezone/Pacific/Tahiti 0644 root root 160 7516 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Tarawa 0644 root root 144 4560 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Tongatapu 0644 root root 313 15767 1347419306 1 l none /usr/local/share/postgresql/timezone/Pacific/Truk=/usr/local/share/postgresql/timezone/Pacific/Chuuk 1 f none /usr/local/share/postgresql/timezone/Pacific/Wake 0644 root root 144 4581 1347419306 1 f none /usr/local/share/postgresql/timezone/Pacific/Wallis 0644 root root 141 4369 1347419306 1 l none /usr/local/share/postgresql/timezone/Pacific/Yap=/usr/local/share/postgresql/timezone/Pacific/Chuuk 1 f none /usr/local/share/postgresql/timezone/Poland 0644 root root 2679 6024 1347419306 1 l none /usr/local/share/postgresql/timezone/Portugal=/usr/local/share/postgresql/timezone/Europe/Lisbon 1 l none /usr/local/share/postgresql/timezone/ROC=/usr/local/share/postgresql/timezone/Asia/Taipei 1 f none /usr/local/share/postgresql/timezone/ROK 0644 root root 380 27686 1347419306 1 l none /usr/local/share/postgresql/timezone/Singapore=/usr/local/share/postgresql/timezone/Asia/Singapore 1 f none /usr/local/share/postgresql/timezone/Turkey 0644 root root 2721 11692 1347419306 1 f none /usr/local/share/postgresql/timezone/UCT 0644 root root 118 1652 1347419307 1 d none /usr/local/share/postgresql/timezone/US 0755 root root 1 l none /usr/local/share/postgresql/timezone/US/Alaska=/usr/local/share/postgresql/timezone/America/Anchorage 1 l none /usr/local/share/postgresql/timezone/US/Aleutian=/usr/local/share/postgresql/timezone/America/Atka 1 l none /usr/local/share/postgresql/timezone/US/Arizona=/usr/local/share/postgresql/timezone/America/Phoenix 1 l none /usr/local/share/postgresql/timezone/US/Central=/usr/local/share/postgresql/timezone/America/Chicago 1 l none /usr/local/share/postgresql/timezone/US/East-Indiana=/usr/local/share/postgresql/timezone/America/Indiana/Indianapolis 1 l none /usr/local/share/postgresql/timezone/US/Eastern=/usr/local/share/postgresql/timezone/America/New_York 1 l none /usr/local/share/postgresql/timezone/US/Hawaii=/usr/local/share/postgresql/timezone/Pacific/Honolulu 1 l none /usr/local/share/postgresql/timezone/US/Indiana-Starke=/usr/local/share/postgresql/timezone/America/Indiana/Knox 1 l none /usr/local/share/postgresql/timezone/US/Michigan=/usr/local/share/postgresql/timezone/America/Detroit 1 l none /usr/local/share/postgresql/timezone/US/Mountain=/usr/local/share/postgresql/timezone/America/Shiprock 1 l none /usr/local/share/postgresql/timezone/US/Pacific=/usr/local/share/postgresql/timezone/America/Los_Angeles 1 l none /usr/local/share/postgresql/timezone/US/Pacific-New=/usr/local/share/postgresql/timezone/America/Los_Angeles 1 l none /usr/local/share/postgresql/timezone/US/Samoa=/usr/local/share/postgresql/timezone/Pacific/Pago_Pago 1 f none /usr/local/share/postgresql/timezone/UTC 0644 root root 118 1652 1347419307 1 l none /usr/local/share/postgresql/timezone/Universal=/usr/local/share/postgresql/timezone/UTC 1 f none /usr/local/share/postgresql/timezone/W-SU 0644 root root 1448 32492 1347419306 1 f none /usr/local/share/postgresql/timezone/WET 0644 root root 1873 39052 1347419306 1 l none /usr/local/share/postgresql/timezone/Zulu=/usr/local/share/postgresql/timezone/UTC 1 l none /usr/local/share/postgresql/timezone/posixrules=/usr/local/share/postgresql/timezone/America/New_York 1 d none /usr/local/share/postgresql/timezonesets 0755 root root 1 f none /usr/local/share/postgresql/timezonesets/Africa.txt 0644 root root 6973 6439 1347419307 1 f none /usr/local/share/postgresql/timezonesets/America.txt 0644 root root 12717 22411 1347419307 1 f none /usr/local/share/postgresql/timezonesets/Antarctica.txt 0644 root root 1478 34571 1347419307 1 f none /usr/local/share/postgresql/timezonesets/Asia.txt 0644 root root 9509 5304 1347419307 1 f none /usr/local/share/postgresql/timezonesets/Atlantic.txt 0644 root root 3774 43117 1347419307 1 f none /usr/local/share/postgresql/timezonesets/Australia 0644 root root 1404 38525 1347419307 1 f none /usr/local/share/postgresql/timezonesets/Australia.txt 0644 root root 2782 9096 1347419307 1 f none /usr/local/share/postgresql/timezonesets/Default 0644 root root 29620 49534 1347419307 1 f none /usr/local/share/postgresql/timezonesets/Etc.txt 0644 root root 1241 12088 1347419307 1 f none /usr/local/share/postgresql/timezonesets/Europe.txt 0644 root root 8301 24059 1347419307 1 f none /usr/local/share/postgresql/timezonesets/India 0644 root root 593 50003 1347419307 1 f none /usr/local/share/postgresql/timezonesets/Indian.txt 0644 root root 1566 37344 1347419307 1 f none /usr/local/share/postgresql/timezonesets/Pacific.txt 0644 root root 4150 8407 1347419307 1 d none /usr/local/share/postgresql/tsearch_data 0755 root root 1 f none /usr/local/share/postgresql/tsearch_data/danish.stop 0644 root root 424 37100 1347419308 1 f none /usr/local/share/postgresql/tsearch_data/dutch.stop 0644 root root 453 38763 1347419308 1 f none /usr/local/share/postgresql/tsearch_data/english.stop 0644 root root 622 54931 1347419308 1 f none /usr/local/share/postgresql/tsearch_data/finnish.stop 0644 root root 1579 33237 1347419308 1 f none /usr/local/share/postgresql/tsearch_data/french.stop 0644 root root 805 10912 1347419308 1 f none /usr/local/share/postgresql/tsearch_data/german.stop 0644 root root 1349 57331 1347419308 1 f none /usr/local/share/postgresql/tsearch_data/hungarian.stop 0644 root root 1227 57949 1347419309 1 f none /usr/local/share/postgresql/tsearch_data/hunspell_sample.affix 0644 root root 244 13989 1347419307 1 f none /usr/local/share/postgresql/tsearch_data/ispell_sample.affix 0644 root root 465 31429 1347419307 1 f none /usr/local/share/postgresql/tsearch_data/ispell_sample.dict 0644 root root 81 7108 1347419307 1 f none /usr/local/share/postgresql/tsearch_data/italian.stop 0644 root root 1654 20806 1347419309 1 f none /usr/local/share/postgresql/tsearch_data/norwegian.stop 0644 root root 851 11364 1347419309 1 f none /usr/local/share/postgresql/tsearch_data/portuguese.stop 0644 root root 1267 57350 1347419309 1 f none /usr/local/share/postgresql/tsearch_data/russian.stop 0644 root root 1235 9585 1347419309 1 f none /usr/local/share/postgresql/tsearch_data/spanish.stop 0644 root root 2178 21152 1347419309 1 f none /usr/local/share/postgresql/tsearch_data/swedish.stop 0644 root root 559 52354 1347419309 1 f none /usr/local/share/postgresql/tsearch_data/synonym_sample.syn 0644 root root 73 6890 1347419307 1 f none /usr/local/share/postgresql/tsearch_data/thesaurus_sample.ths 0644 root root 473 41646 1347419307 1 f none /usr/local/share/postgresql/tsearch_data/turkish.stop 0644 root root 260 25287 1347419309 1 f none /usr/local/share/postgresql/tsearch_data/unaccent.rules 0644 root root 937 22169 1347419313 1 f none /usr/local/share/postgresql/tsearch_data/xsyn_sample.rules 0644 root root 139 12006 1347419311 1 f none /usr/local/share/postgresql/unknown.pltcl 0644 root root 2406 25686 1347419310 1 i checkinstall 790 2505 1347428601 1 i pkginfo 301 24276 1347428448 07070100020103000041ed0000000000000000000000025050206000000000000000b600010002ffffffffffffffff0000000800000000install07070100020104000081ed000000000000000000000001505020f900000316000000b600010002ffffffffffffffff0000001500000000install/checkinstall#!/bin/sh # expected_bits="64" expected_release="5.11" expected_platform="i386" # release=`uname -r` platform=`uname -p` bits=`isainfo -b` # if [ ${platform} != ${expected_platform} ]; then echo "\n\n\n\tThis package must be installed on a ${expected_platform} architecture\n" echo "\tAborting installation.\n\n\n" exit 1 fi if [ ${release} != ${expected_release} ]; then echo "\n\n\n\tThis package must be installed on a ${expected_release} machine\n" echo "\tAborting installation.\n\n\n" exit 1 fi #if [ ${bits} != ${expected_bits} ]; then # echo "\n\n\n\tThis package must be installed on a ${expected_bits} bit machine\n" # echo "\tYour machine is running a ${bits} bit O.S. currently\n" # echo "\tAborting installation.\n\n\n" # exit 1 #fi exit 0 0707010001f5cc000041ed0000000000000000000000035050206000000000000000b600010002ffffffffffffffff0000000500000000root0707010001f5cd000041ed0000000000000000000000035050206000000000000000b600010002ffffffffffffffff0000000900000000root/usr0707010001f5ce000041ed0000000000000000000000065050206000000000000000b600010002ffffffffffffffff0000000f00000000root/usr/local0707010001f5cf000041ed0000000000000000000000025050206000000000000000b600010002ffffffffffffffff0000001300000000root/usr/local/bin0707010001f5dc000081ed000000000000000000000001504ffcae000086a8000000b600010002ffffffffffffffff0000001d00000000root/usr/local/bin/pg_configELFp44 (! 44o"K"K$K$K KK/usr/lib/ld.so.1a\ !"#$%)*./0235689:;<>ADEGJLMNOPQRUVWX[  &'(+,-147=?@BCFHIKSTYZ  &2>| Ks WX cPX pX X XX X  X ` X X !X h!X !q 4"0 d"0 "0 -"0 9"0 H$#0 UT#0 e#0 u#0 #) $ % %3 ' *) . 86 h8s 5e h5 "+2$- BJ04( i9) t{M 6 0 T$% 1 t"K+M2MDX8 Y9_"Kfl3 V0  . D/ p97p t D0  .H7 >EMT7 aMioT"$Kp 7 $ V490  6 !{ '/66 CM7 [b@Rhov}h7 0 0 |M!4V T4$7 @90 D,( 4 (7 dc@R 6 /X4N Fdpg_configcrti.scrt1.ocrt1.sfsr.svalues-Xa.cpg_config.ccleanup_pathshow_bindirshow_docdirshow_htmldirshow_includedirshow_pkgincludedirshow_includedir_servershow_libdirshow_pkglibdirshow_localedirshow_mandirshow_sharedirshow_sysconfdirshow_pgxsshow_configureshow_ccshow_cppflagsshow_cflagsshow_cflags_slshow_ldflagsshow_ldflags_exshow_ldflags_slshow_libsshow_versionhelpadviceshow_allexec.cvalidate_execresolve_symlinkspipe_read_linepath.ctrim_trailing_separatortrim_directorydir_strcmpmake_relative_paththread.ccrtn.sfind_other_execstrncmppath_is_relative_and_below_cwdpqStrerroratexit_environgetenv__1cG__CrunMdo_exit_code6F_v__exitget_include_pathgetcwdjoin_path_componentsstrrchrabortstrlcpygeteuidmaincanonicalize_pathfprintfstrerror_DYNAMIC_edata__longdouble_usedget_parent_directory_fini_etextchdirpath_contains_parent_reference_endstrdupfirst_path_var_separatorpclose_check__posix_getpwuid_rsetlocaleset_pglocale_pgservice_initget_home_pathfgetssnprintfstrcatlast_dir_separatorget_pkglib_pathaccess__environ_lockget_man_path___Argvfputc_get_exit_frame_monitor_GLOBAL_OFFSET_TABLE__startget_includeserver_pathlstat64_PROCEDURE_LINKAGE_TABLE_errnoreadlink_lib_versionfirst_dir_separatorget_pkginclude_path__fsrstrncpypcloseget_etc_path__fpstartget_html_pathperror__iobputenvstrstrstrlenget_locale_pathhas_drive_prefixmake_native_pathget_prognamefflushstrerror_r__fsr_init_valueget_doc_pathpqGetpwuidstrcpyfind_my_execget_lib_pathstrlcatget_share_pathpath_is_prefix_of_pathpopenlibc.so.1SUNW_1.22SUNW_1.19SUNW_1.1SUNW_0.7SYSVABI_1.3SUNWprivate_1.1libxslt.so.1libxml2.so.2libpam.so.1libssl.so.0.9.8libcrypto.so.0.9.8libkrb5.so.3libcom_err.so.3libgss.so.1libz.solibreadline.so.6libtermcap.so.1libnsl.so.1libsocket.so.1libm.so.2/usr/local/lib:/usr/local/libLyVy`'= j(= s7|qN daj  !"?$%/&NRwhMXx:@J1z*+m8ibYvo\TF)(2SGg`Cy[]EreKM@RDV70K@4K 8KKCK#KKEKK)KKFKKKNK!K15(K%,K%0Kh%4Kh%8Kh%8h\>+h>h=h|=h,=h<h<h@<h;h;h;hX;h(;ÐU 5Nh;h`RÐUS3399t jݴ9C<ݰ9u[ÐUSVW$h:] 3 3NEp~Dh:3<h:3"G;~ăhN] 3}~q9Eu3}tC}ܿ973tF<9uߋ}}܃ j9<9tkG;}~3_^[ j85Nh:h`R'j3d j(35Nh:h`R jedUShSu|SC%=tBjE0jE0ut3 Ĕ[ÐUSVhPln u.E8/tPQu nhPu (E ƀ u u u E 0%E 0hpI`RSSj  hhIk8bu M Dž3ۉt C SDu SvÉ+ÍP+H#…v+PSQD8/t,PPV VVPV VfVqu'VhLIh`R"h`Rj s tt8 Vo)uh(I`RSSj %^[à 5V5 PhI`RSSj USVWXhPu V؅t VtoCރXPSp%=hWS|P=sIƄWVkVhIh`Rh`Rj ShH`RSsSj SPh]uxtpPPP34XPt3-XPhI`RSSj 4Ĝ_^[à 5VC PhI`RSSj 뾃 5V PhI`RShSj 뇐USVxuuu} 6t 6,66vhHu hH+QS6tZ6hGhPv EjdPQ9t!EuPu3 p^[ÐUSVWhPR%`RV3=VhHu ؅=VSuu t SruE 33/C t,E0hHV S3 _^[à hH؃ hH3ҐUSuytVv.u'Ph$H`RS/Sj LPhG`RS Sj `(PhPH`RSSj 63[à hxHߐU hGu thGjPu'|t hGu`PQrPhGhPP/P@PGÐU3ÐUEt/t @u3UEt:t @u3UU 3t/uB uUÐUSVW ]ME ;thPQ.u{/u.u{/ttJE 8uKK uuSWh K+QuV ] _^[USVW(u7]˅t,3/u t C/t;t/CAuuu3ۃ u}hJE0ou`hK>PRhJE05|EhIPt\hJE0tCE8tl PKE8,hJPt E0C E0mEK~gÅ3|AE0IWVWVWVWV}ͅ~uhIVmKhJuU_^[ÐUSuIhJut4jhIE0thJE0t(}3hIEDPe[UE8/u3 PQUSu Su u|uE /t 3[ÐUSV utXE St^[ÃShJh`RݐUSVW}M t2t;:t /u. With no arguments, all known items are shown. -?, --help show this help, then exit --version show the PostgreSQL version --libs show LIBS value used when PostgreSQL was built --ldflags_sl show LDFLAGS_SL value used when PostgreSQL was built --ldflags_ex show LDFLAGS_EX value used when PostgreSQL was built --ldflags show LDFLAGS value used when PostgreSQL was built --cflags_sl show CFLAGS_SL value used when PostgreSQL was built --cflags show CFLAGS value used when PostgreSQL was built --cppflags show CPPFLAGS value used when PostgreSQL was built --cc show CC value used when PostgreSQL was built --configure show options given to "configure" script when PostgreSQL was built --pgxs show location of extension makefile --sysconfdir show location of system-wide configuration files --sharedir show location of architecture-independent support files --mandir show location of manual pages --localedir show location of locale support files --pkglibdir show location of dynamically loadable modules --libdir show location of object code libraries --includedir-server show location of C header files for the server --pkgincludedir show location of other C header files --includedir show location of C header files of the client interfaces --htmldir show location of HTML documentation files --docdir show location of documentation files --bindir show location of user executables Options: %s [OPTION]... %s provides information about the installed version of PostgreSQL. --version--libs--ldflags_sl--ldflags_ex--ldflags--cflags_sl--cflags--cppflags--cc--configure--pgxs--sysconfdir--sharedir--mandir--localedir--pkglibdir--libdir--includedir-server--includedir--htmldir--docdir--bindirPostgreSQL 9.2.0 VERSION = -lpgport -L/usr/local/lib -lxslt -lxml2 -lpam -lssl -lcrypto -lkrb5 -lcom_err -lssl -lcrypto -lgss -lz -lreadline -ltermcap -lnsl -lsocket -lm LDFLAGS_SL = LDFLAGS_EX = -L/usr/local/lib -L/usr/local/lib -L/usr/local/lib -L/usr/local/lib -Wl,-R'/usr/local/lib:/usr/local/lib'LDFLAGS = -KPICCFLAGS_SL = -v -OCFLAGS = -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/includeCPPFLAGS = cc -XaCC = '--prefix=/usr/local' '--with-tcl' '--with-tclconfig=/usr/local/lib' '--with-perl' '--with-python' '--with-gssapi' '--with-krb5' '--with-pam' '--with-ldap' '--with-openssl' '--with-libxml' '--with-libxslt' 'CC=cc' 'LDFLAGS=-L/usr/local/lib' 'CPPFLAGS=-I/usr/local/include'CONFIGURE = /pgxs/src/makefiles/pgxs.mkSYSCONFDIR = SHAREDIR = MANDIR = LOCALEDIR = PKGLIBDIR = LIBDIR = INCLUDEDIR-SERVER = PKGINCLUDEDIR = INCLUDEDIR = HTMLDIR = DOCDIR = BINDIR = "%s" -VPGSYSCONFDIR=%sPGSYSCONFDIRpostgres-9.2child process exited with unrecognized status %dchild process was terminated by signal %dchild process exited with exit code %dpclose failedfgets failureno data was returned by command "%s" popen failurer/%s%scould not read symbolic link "%s"could not change directory to "%s"could not find a "%s" to executecould not read binary "%s"PATHinvalid binary "%s"could not identify current directory: %s..//../usr/local/share/man/usr/local/share/doc//postgresql/usr/local/share/locale/usr/local/lib/postgresql/usr/local/lib/usr/local/include/postgresql/server/usr/local/include/postgresql/usr/local/include/usr/local/etc/postgresql/usr/local/bin/usr/local/share/postgresql%s: out of memory /../..././%s%sUnknown errorK *:JZjz *:JZjz *:JZ #3?NL p9 9XX  v  ````T`@oo,o8P`o``>$KT ,T    p p999p:$KKMMMMN V  M=MPVM amMxN9| s X PX X X XX X  X #` X 2 X >!X Lh!X \!q f4"0 ud"0 }"0 "0 "0 $#0 T#0 #0 #0 #) $ % %3 9 MN!NmMxN9*M4;' I*) Z. MmMxN9*Mip86 h8s 5e h5 MmMxN9*M MmMxN9*M$- 04( 9) M%, KP6 ah0 }T$% 1 tKMMX8 9"K 3 ,V180  Q. ^Dq{/ p97p tD0  H7 M7 M T"($K>p E7 \$d ~V490  6 { 6 7 ]@R h7 .0 ?0 M!4V PTW4J$bs7 @90 D,( 4(7 d@R6 X4N dpg_configcrti.scrt1.ocrt1.s__get_exit_frame_monitor_ptr__do_exit_code_ptrfsr.strap_tablevalues-Xa.cDdata.dataBbss.bssDrodata.rodatapg_config.ccleanup_pathshow_bindirshow_docdirshow_htmldirshow_includedirshow_pkgincludedirshow_includedir_servershow_libdirshow_pkglibdirshow_localedirshow_mandirshow_sharedirshow_sysconfdirshow_pgxsshow_configureshow_ccshow_cppflagsshow_cflagsshow_cflags_slshow_ldflagsshow_ldflags_exshow_ldflags_slshow_libsshow_versionhelpadviceshow_allinfo_itemsTtdata.datamypathget_prognameTtbss.bssexec.cvalidate_execresolve_symlinkspipe_read_linepath.ctrim_trailing_separatortrim_directorydir_strcmpmake_relative_paththread.ccrtn.s_END__START_find_other_execstrncmppath_is_relative_and_below_cwdpqStrerroratexit_environgetenv__1cG__CrunMdo_exit_code6F_v__exitget_include_pathgetcwdjoin_path_componentsstrrchrabortstrlcpygeteuidmaincanonicalize_pathfprintfstrerror_DYNAMIC_edata__longdouble_usedget_parent_directory_fini_etextchdirpath_contains_parent_reference_endstrdupfirst_path_var_separatorpclose_check__posix_getpwuid_rsetlocaleset_pglocale_pgservice_initget_home_pathfgetssnprintfstrcatlast_dir_separatorget_pkglib_pathaccess__environ_lockget_man_path___Argvfputc_get_exit_frame_monitor_GLOBAL_OFFSET_TABLE__startget_includeserver_pathlstat64_PROCEDURE_LINKAGE_TABLE_errnoreadlink_lib_versionfirst_dir_separatorget_pkginclude_path__fsrstrncpypcloseget_etc_path__fpstartget_html_pathperror__iobputenvstrstrstrlenget_locale_pathhas_drive_prefixmake_native_pathfflushstrerror_r__fsr_init_valueget_doc_pathpqGetpwuidstrcpyfind_my_execget_lib_pathstrlcatget_share_pathpath_is_prefix_of_pathpopenanotate anotate0 ,(xK9 MManotatet|+ P|sXPXXXXXX X` X X!Xh!X!q4"0d"0"0"0"0$#0T#0#0#0#)$%%3%%& $anotate 999P999X99 9` 9 :! :h!:!:4"$:d",:"4:"<:"D:$#L:T#T:#\:#d:#anotated'T',(*)$-../anotate anotatep0P00 0 0 001304(X4N4V5eh566667(7H7h77777pX8h8s86 X66e8anotate anotate(9\9)@90%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.11 SunOS_i386 2010/08/13iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.11 SunOS_i386 2010/08/13iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.11 SunOS_i386 2010/08/13iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.11 SunOS_i386 2010/08/13iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ld: Software Generation Utilities - Solaris Link Editors: 5.11-1.1726*pg_config.c /var/tmp/postgresql-9.2.0/src/bin/pg_config /opt/SUNWspro/prod/bin/cc -Xa -v -O -I../../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -DVAL_CONFIGURE='"'--prefix=/usr/local' '--with-tcl' '--with-tclconfig=/usr/local/lib' '--with-perl' '--with-python' '--with-gssapi' '--with-krb5' '--with-pam' '--with-ldap' '--with-openssl' '--with-libxml' '--with-libxslt' 'CC=cc' 'LDFLAGS=-L/usr/local/lib' 'CPPFLAGS=-I/usr/local/include'"' -DVAL_CC='"cc -Xa"' -DVAL_CPPFLAGS='"-I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include"' -DVAL_CFLAGS='"-v -O"' -DVAL_CFLAGS_SL='"-KPIC"' -DVAL_LDFLAGS='"-L/usr/local/lib -L/usr/local/lib -L/usr/local/lib -L/usr/local/lib -Wl,-R'/usr/local/lib:/usr/local/lib'"' -DVAL_LDFLAGS_EX='""' -DVAL_LDFLAGS_SL='""' -DVAL_LIBS='"-lpgport -L/usr/local/lib -lxslt -lxml2 -lpam -lssl -lcrypto -lkrb5 -lcom_err -lssl -lcrypto -lgss -lz -lreadline -ltermcap -lnsl -lsocket -lm "' -c pg_config.cXa;O;R=Sun C 5.11 SunOS_i386 2010/08/13;backend;raw;cd;DBG_GEN 5.3.0%exec.c /var/tmp/postgresql-9.2.0/src/port /opt/SUNWspro/prod/bin/cc -Xa -v -O -I../../src/port -DFRONTEND -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c exec.cXa;O;R=Sun C 5.11 SunOS_i386 2010/08/13;backend;raw;cd;DBG_GEN 5.3.0U%,path.c /var/tmp/postgresql-9.2.0/src/port /opt/SUNWspro/prod/bin/cc -Xa -v -O -I../../src/port -DFRONTEND -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c path.cXa;O;R=Sun C 5.11 SunOS_i386 2010/08/13;backend;raw;cd;DBG_GEN 5.3.0`Bthread.c /var/tmp/postgresql-9.2.0/src/port /opt/SUNWspro/prod/bin/cc -Xa -v -O -D_REENTRANT -D_THREAD_SAFE -D_POSIX_PTHREAD_SEMANTICS -I../../src/port -DFRONTEND -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c thread.cXa;O;R=Sun C 5.11 SunOS_i386 2010/08/13;backend;raw;cd;DBG_GEN 5.3.0QK /var/tmp/postgresql-9.2.0/src/bin/pg_configpg_config.cC= /var/tmp/postgresql-9.2.0/src/portexec.cC= /var/tmp/postgresql-9.2.0/src/portpath.cE? /var/tmp/postgresql-9.2.0/src/portthread.c DD% DD% DD% DD%.interp.SUNW_cap.hash.SUNW_ldynsym.dynsym.dynstr.SUNW_version.SUNW_versym.SUNW_dynsymsort.SUNW_reloc.rel.plt.text.init.fini.rodata.rodata1.got.dynamic.data.bssf.tdata.tbss.bss.symtab.strtab.annotate.comment.debug_info.debug_line.debug_abbrev.shstrtab oo.' /"  v 7o,,pEoRoTT@c o B8 sxpp~p9p99999p:p:$K$KKKMMLMMMMMMNN@M m XZo8a4fv ~, X  f0707010001f5da000081ed000000000000000000000001504ffcb00000671c000000b600010002ffffffffffffffff0000002500000000root/usr/local/bin/pg_archivecleanupELF4a4 (! 44oj3j3l3l333/usr/lib/ld.so.1a]  !"#$'(),-.02369;<=>@BDEFHKMNOPQRSTUWXYZ %&*+/14578:?ACGIJLV[\!(.:Ne YdV g |  \+6 *s 'e ' p+) &( 9 @G5P nH)  Bt# 6d PP$ 5 63 ,* +B2j39@& cBl Bqx,#  ph*p +`:L#  5) H* 5$B+>>"Vl3l)  0 @:(,> #  h) 6 { #() 0(* >@EBU@6[bl# }) `H5!l# _('V 6,! 0B*  +0 )  &N ) V@6pg_archivecleanupcrti.scrt1.ocrt1.sfsr.svalues-Xa.cpg_archivecleanup.cInitializeTrimExtensionCleanupPriorWALFilesSetWALFileNameForCleanupusagegetopt.cpath.ctrim_trailing_separatortrim_directorydir_strcmpmake_relative_paththread.ccrtn.sstrncmpstrspnpqStrerrorpath_is_relative_and_below_cwdatexitsscanf_environ__1cG__CrunMdo_exit_code6F_v_get_include_path_exitopterrjoin_path_componentsadditional_extabortmainstrlcpygeteuidfprintfstrerrorcanonicalize_path__longdouble_used_edata_DYNAMIC_finiget_parent_directoryoptopt_etextunlinkpath_contains_parent_referenceget_progname_endstrdupfirst_path_var_separator__posix_getpwuid_rsnprintfget_home_path_initstrcatWALFilePathlast_dir_separator__environ_lockget_pkglib_pathget_man_path___ArgvclosediroptargrestartWALFileName_get_exit_frame_monitor_GLOBAL_OFFSET_TABLE_get_includeserver_path_startputs_PROCEDURE_LINKAGE_TABLE_strchrerrno_lib_versionexclusiveCleanupFileNamefirst_dir_separatorget_pkginclude_pathdryrunstrncpy__fsr__fpstartget_etc_pathget_html_pathstat64archiveLocation__iobstrstrreaddir64has_drive_prefixget_locale_pathstrlenmake_native_pathdebuggetoptstrerror_r__fsr_init_valueoptindget_doc_pathstrcpypqGetpwuidget_lib_pathopendirpath_is_prefix_of_pathget_share_pathlibc.so.1SUNW_1.22SUNW_1.19SUNW_1.1SUNW_0.7SYSVABI_1.3SUNWprivate_1.1libxslt.so.1libxml2.so.2libpam.so.1libssl.so.0.9.8libcrypto.so.0.9.8libkrb5.so.3libcom_err.so.3libgss.so.1libz.solibreadline.so.6libtermcap.so.1libnsl.so.1libsocket.so.1libm.so.2/usr/local/lib:/usr/local/lib/y9yC'= M(= V7_qN kKIT $d]P6>a!)2obpVQHm@^iWA:.k;-NG,`?B*"RcZM=EOD h/3Y45@6E:8B/BSB B x3@|3 33Q3C33J3#3Y3G3>33$33W3.333U353733'33F3 333P3"315p3%t3%x3h%|3h%3h%3h%3h %3h(%3h0%3h8p%3h@`%3hHP%3hP@%3hX0%3h` %3hh%3hp%3hx%3h%3h%3h%3h%3h%3h%3h%3hp%3h`%3hP%3h@%3h0%3h %3h%3hjjR3th ,5t5t PE5u T5RU 5RPPjURQt`|$у5 D$td$у`tƒ 3fd$f T$tfd$f L$l$YZ]ÐUShS5B(uC%=@u Ĕ[5B5Bhx1h`6j͐USVE tF Pu;~)M 1+ލEPu E^[ÐUSVW5B W4XhSV56VIV<hd1Vrh>P S5Bh\1hh:9 =6uF=6th:5Bh$1h`6 h: tG`6:fh:h,,=6th:5Bh<1h`6? Ws W _^[à 5:PV5Bh0S 5:P5B5Bh0h`6 뚐USVW$565>5>uhd15>tr 5>k(uzE3E܉EEEPuV]S}Wh05> u=637h0jh>l 5>h>_^[Ã5Bh0`6S 5BhX0Sjb뼐U5Bh 0h0, 5Bh/h/h/hX/h /h.h.h-h<-h -ÐUSV u 6B]~lh-vmh-vRh,vNh,v3h,VS+tKM 1du 6!nu 6xB6h,VSuB]; M B@BB;*M >@B9BKV=6tB h>5Bh\1hh: h:5Bh8,h`6] j 3^[ j h,j5BhX0h`6j5Bh,`6V 5BhX0Vjk5Bhx,`6V 5BhX0Vvj,5Bh\,`6SK 5BhX0S7jvUS68tB<B;UE 9-AYu-u yTH 6B:Pux:t#B68B B68ueA B9ML61E8:t.= Bt5Bh1h`6$?:E BB61A BBB=B-tE68uBB= Bt#E8:t5Bh1h`6?961(BB6161[ÐU3ÐUEt/t @u3UEt:t @u3UU 3t/uB uUÐUSVW ]ME ;thPQ.u{/u.u{/ttJE 8uL3P3 uuuSWhT3+QuV ] _^[USVW(u7]˅t,3/u t C/t;t/CAuuu3ۃ u}hD3E0u`hH3>PhD3E0|Eh1P{t\h@3E0btCE8tl PKE8,hD3P E0C E0mEK~gÅ3|AE01WVWVWVWV}ͅ~uh1ViKh@3uQ_^[ÐUSu5h@3u3t4jh1E0th83E0t(}3h1EDP[UE8/u3 PQUSuy Su uxuE /t 3[ÐUSV utXE S>t^[ÃSh$3h`6$ݐUSVW}M t2t;:t /u. Or for use as a standalone archive cleaner: e.g. pg_archivecleanup /mnt/server/archiverdir 000000010000000000000010.00000020.backup For use as archive_cleanup_command in recovery.conf when standby_mode = on: archive_cleanup_command = 'pg_archivecleanup [OPTION]... ARCHIVELOCATION %%r' e.g. archive_cleanup_command = 'pg_archivecleanup /mnt/server/archiverdir %%r' -?, --help show this help, then exit -x EXT clean up files if they have this extension -V, --version output version information, then exit -n dry run, show the names of the files that would be removed -d generate debug output (verbose mode) Options: %s [OPTION]... ARCHIVELOCATION OLDESTKEPTWALFILE %s removes older WAL files from PostgreSQL archives. Try "%s --help" for more information. %s: invalid filename input %08X%08X%08X%08X%08X%08X.%08X.backup%s: could not open archive location "%s": %s %s: ERROR: could not remove file "%s": %s %s: removing file "%s" %s: file "%s" would be removed %s/%s0123456789ABCDEF%s: archive location "%s" does not exist option requires an argument -- %c illegal option -- %c ..//../usr/local/share/man/usr/local/share/doc//postgresql/usr/local/share/locale/usr/local/lib/postgresql/usr/local/lib/usr/local/include/postgresql/server/usr/local/include/postgresql/usr/local/include/usr/local/etc/postgresql/usr/local/bin/usr/local/share/postgresql%s: out of memory /../..././%s%sUnknown error3&6FVfv&6FVfv{"1/ + ,;;8  Yh `` ```oXoo0`o``>l31h8      + ,(,,,l335 6 6 6@6 t Bz!(5E5X^5 iu5@6(,e dV    6u6@6(, 6 6u6@6(, 6\+6 7*s F'e Q' 6u5@6(, 6d 6u5@6(, 6mp+) &(  5 H)  Bt# #628d =PEMPU^$ p5 63 ,* Bj3& B B,#  Jp&/h*p =+C`J:VL#  i5x) H* 5B>"l3)  0 +@2:8(,E>^ #  rh) 6{ () (* @B@6# ) `5!l# ('V '6-,! 40?PBW* d k+0 Nv) &N ) @6pg_archivecleanupcrti.scrt1.ocrt1.s__get_exit_frame_monitor_ptr__do_exit_code_ptrfsr.strap_tablevalues-Xa.cDdata.dataBbss.bssDrodata.rodatapg_archivecleanup.cInitializeTrimExtensionCleanupPriorWALFilesSetWALFileNameForCleanupusageTtdata.dataTtbss.bssgetopt.cpath.ctrim_trailing_separatortrim_directorydir_strcmpmake_relative_paththread.ccrtn.s_END__START_strncmpstrspnpqStrerrorpath_is_relative_and_below_cwdatexitsscanf_environ__1cG__CrunMdo_exit_code6F_v_get_include_path_exitopterrjoin_path_componentsadditional_extabortmainstrlcpygeteuidfprintfstrerrorcanonicalize_path__longdouble_used_edata_DYNAMIC_finiget_parent_directoryoptopt_etextunlinkpath_contains_parent_referenceget_progname_endstrdupfirst_path_var_separator__posix_getpwuid_rsnprintfget_home_path_initstrcatWALFilePathlast_dir_separator__environ_lockget_pkglib_pathget_man_path___ArgvclosediroptargrestartWALFileName_get_exit_frame_monitor_GLOBAL_OFFSET_TABLE_get_includeserver_path_startputs_PROCEDURE_LINKAGE_TABLE_strchrerrno_lib_versionexclusiveCleanupFileNamefirst_dir_separatorget_pkginclude_pathdryrunstrncpy__fsr__fpstartget_etc_pathget_html_pathstat64archiveLocation__iobstrstrreaddir64has_drive_prefixget_locale_pathstrlenmake_native_pathdebuggetoptstrerror_r__fsr_init_valueoptindget_doc_pathstrcpypqGetpwuidget_lib_pathopendirpath_is_prefix_of_pathget_share_pathanotate anotate0 ,(3 ,55anotateX/HedVdanotate anotate,! ,!anotate anotatep#P# # ,# L# l#t#$&&(&N('V'e')()H)h)))))*(*H*h*p**s\+6 ()*anotate anotate(+\+)+0%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.11 SunOS_i386 2010/08/13iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.11 SunOS_i386 2010/08/13iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.11 SunOS_i386 2010/08/13iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.11 SunOS_i386 2010/08/13iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ld: Software Generation Utilities - Solaris Link Editors: 5.11-1.1726<pg_archivecleanup.c /var/tmp/postgresql-9.2.0/contrib/pg_archivecleanup /opt/SUNWspro/prod/bin/cc -Xa -v -O -I. -I. -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c pg_archivecleanup.cXa;O;R=Sun C 5.11 SunOS_i386 2010/08/13;backend;raw;cd;DBG_GEN 5.3.0)getopt.c /var/tmp/postgresql-9.2.0/src/port /opt/SUNWspro/prod/bin/cc -Xa -v -O -I../../src/port -DFRONTEND -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c getopt.cXa;O;R=Sun C 5.11 SunOS_i386 2010/08/13;backend;raw;cd;DBG_GEN 5.3.0e%,path.c /var/tmp/postgresql-9.2.0/src/port /opt/SUNWspro/prod/bin/cc -Xa -v -O -I../../src/port -DFRONTEND -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c path.cXa;O;R=Sun C 5.11 SunOS_i386 2010/08/13;backend;raw;cd;DBG_GEN 5.3.0`Bthread.c /var/tmp/postgresql-9.2.0/src/port /opt/SUNWspro/prod/bin/cc -Xa -v -O -D_REENTRANT -D_THREAD_SAFE -D_POSIX_PTHREAD_SEMANTICS -I../../src/port -DFRONTEND -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c thread.cXa;O;R=Sun C 5.11 SunOS_i386 2010/08/13;backend;raw;cd;DBG_GEN 5.3.0a[ /var/tmp/postgresql-9.2.0/contrib/pg_archivecleanuppg_archivecleanup.cE? /var/tmp/postgresql-9.2.0/src/portgetopt.cC= /var/tmp/postgresql-9.2.0/src/portpath.cE? /var/tmp/postgresql-9.2.0/src/portthread.c DD% DD% DD% DD%.interp.SUNW_cap.hash.SUNW_ldynsym.dynsym.dynstr.SUNW_version.SUNW_versym.SUNW_dynsymsort.SUNW_reloc.rel.plt.text.init.fini.rodata.rodata1.got.dynamic.data.bssf.tdata.tbss.bss.symtab.strtab.annotate.comment.debug_info.debug_line.debug_abbrev.shstrtab ooP' hh/"8 8 Y7opEoRoc 8o B sx~++ , ,(,(,,,,,>l3l33355X 6 6 6 6 6 6@6@6 @ 6 Q @oFlIIZ C_> `X  `0707010001f5de000081ed000000000000000000000001504ffcae0000bad4000000b600010002ffffffffffffffff0000001a00000000root/usr/local/bin/pg_ctlELF!44 (! 44osssstt/usr/lib/ld.so.1w  "#$&()*+,.013456789;<>?@BDHIJLMNOPQSUVXZ[]_`abdefghijklopqrs !%'-/2:=ACEFGKRTWY\^cmntuv#/8" E#B O\#B W#7 a# k$< t% \& 5@ d)m ) * |+ |, H. H0I 2 t3 %5 /6` 76 A7 I9 R:: ZD; jqdG J) M X6 $Xs Te $U ! x 8!% ,h!3Y9vBG OP `N m!DY0 2 X 8D=  t( ( O vdTV Y dV &/6w=hP  V̏[HcdW qzv!W :v!tY!XE Y) P  !"ďV /h 4;@P LR\W iHP  8H!}L (S( $W Wp DV hPX!     % 8 ,XS KR HHYvk(!q x!PQ P V V !hX !X!H  Xs%,"{ 2x!<TN S ZDW gxnxusV  ȏpg_ctlcrti.scrt1.ocrt1.sfsr.svalues-Xa.cpg_ctl.cwrite_stderrpg_mallocxstrdupprint_msgget_pgpidreadfilestart_postmastertest_postmaster_connectionpostmaster_is_aliveunlimit_core_sizeread_post_optsfind_other_exec_or_diedo_initdo_startdo_stopdo_restartdo_reloaddo_promotedo_statusdo_killdo_advicedo_helpset_modeset_sigadjust_data_direxec.cvalidate_execresolve_symlinkspipe_read_linepath.ctrim_trailing_separatortrim_directorydir_strcmpmake_relative_pathpgsleep.cthread.ccrtn.sstrncmpumaskatexitfreechdirstrcatperror_fini_environfind_my_execmake_native_pathpclose_check__posix_getpwuid_rpqGetpwuidget_parent_directoryatoimainlstat64_DYNAMICgetpidatolgetopt_longset_pglocale_pgservice___Argvget_progname_lib_versionget_etc_pathfgetcsystemstrerrorfscanf_edatafirst_path_var_separator_endstrlcpyget_html_pathsnprintf__environ_lockgetppidsetrlimit64vfprintffgetsget_pkglib_pathselectpg_usleepstrcspn__iobpqStrerrorlast_dir_separator_get_exit_frame_monitoroptargget_includeserver_pathtimePQpinghas_drive_prefixerrno__fpstartget_man_pathfirst_dir_separatorfind_other_exec_exitpath_is_relative_and_below_cwdget_locale_pathget_home_pathget_share_path__1cG__CrunMdo_exit_code6F_v_geteuid_PROCEDURE_LINKAGE_TABLE_fputsstrlenpath_contains_parent_referencestrstrgetcwd__longdouble_usedfputcgetenvstrncpycanonicalize_pathjoin_path_componentsputenvget_lib_pathget_include_pathfcloseabortpclosestrerror_rreadlinkpopen__fsr_init_valuegetrlimit64strchr_etextrewind__fsrsetlocalepath_is_prefix_of_pathaccessget_doc_pathstrcpyfflush_GLOBAL_OFFSET_TABLE_fopen64get_pkginclude_pathunlinkoptindlibc.so.1SUNW_1.22SUNW_1.19SUNW_1.1SUNW_0.7SYSVABI_1.3SUNWprivate_1.1libpq.so.5libxslt.so.1libxml2.so.2libpam.so.1libssl.so.0.9.8libcrypto.so.0.9.8libkrb5.so.3libcom_err.so.3libgss.so.1libz.solibreadline.so.6libtermcap.so.1libnsl.so.1libsocket.so.1libm.so.2/usr/local/lib:/usr/local/libyy'= (= 7qN {x  ?"7#o$9EhlOb8qG()uIeYsRkt='&]a;[5HAZTF_idPvL2<ȏvď7s=sEssCs@sUsJsasqsss s_sssjs+tt&t ttt$thtI tp$t:(t,tg0t)4t18tSUSV؅z}ۃ S S!5wSi=wuFhPhu+hPht hi hi3= w~1؅t& htnth@B'F;5 w|υtI h4kJ5whti=wu hhz jy hkhY$S5wh0h7hh*Chw5whjhjhhĐ^[]Đ^[ÃS5whhhdhj 5NPS5wh8j}jUS8؅t_|)5wSOu| hg[ۃS5whghdhj륃hw5whjhjjn 5nPS5whgjOUSVT؅hPhhgh VwjS   h8fĠ^[ۃS5wh\gjOhw5whjhjj5wh gkjm 5Ph5whf2j4 5Ph5whfj 5PS5whfht* 5^Ph5whLf jUS];t"H;u3jSU3[US؅|\ St{S5whe2h{}؅tKtEhP8u)ۃ S?tS5whf[Ã5whej~ؐUS 5w]Sbu[à 5PS5w5whe E[U5whteU5wh$ehY 5whd5whd5whTd5whc5whc5whc5whc5whtcuh`chh c[hbNhbAhXb4hb'haha h`ahah`h`ht`h_h_h_hP_h8_h_~h^qh|^dhX^Wh4^Jh^=ÐUh^uUth]E0<u3wwh]E0 th]E0uwwFh]E0th]E0uwwÃE05wh] EUhYuMuwhYE0%uwh]E0uwh]E0u wmh]E0u wHh]E0u w#h]E0fu wÃE05whh]EUSV=v5vhT]hPh pPw P5vhD]hPIh pP$vt Plhlh8l5vءvu$] vu ]QPSh(]hPh pPVhPe VSXj Ptj P 5vPpv PS P^[ÃP5wh\jJUSVW(] 3 wh\3jwv j?u"ȏ3Sh\s:h\sh\shh\sMh\s2BȏE EPhwh[SV! 3N$FwMww:ww'j\5ď ďt Qnv QP8v+h[PJ5ď5vv 5ď w5wh[jewY 5ďv> 5ďv# 5ďv 5ďgv 5ď 5ď6v 5ďgPE܃ 5ďW5ď.Wh[Puyu^WPiv WWh[P5v0 j EPhwh[SV p95ȏ=wIhH[ȏ4'ȏthl4 ȋȏuwzh@[4ȏuwNh8[4ȏuw"hY4ȏuwh0[4Xȏuwh([4,ȏuwhY4ȏu wuh [4 ȏ;+wAȏ t;ȏH ȏ t>EȏBȏ95ȏU]=w hZvt0 P v P5vv=vuwt =wu$wtu w uw=wuww=v5vhLZhh{5vh8Zhhw5vhYhh5vh$Zhh5vhZhhwwD$pF S /(!  jG,3_^[Ã5wh[j  hl\j2 j5wh[j5wh$pjvȏ45whP[lX jf5whZ?+ j9 ȏ45whZ  jȏ5whZ j5wh`Z jDDDDDDDDzD3@@@@@@@@@@?@?@@e?@>@>@@@@@@@@@@@>@@@@@@@@@@@??@@?J?@@>UShSu|SC%=tBjE0?jE0.ut3 Ĕ[ÐUSVhPn u.E8/tPQu nhPu E ƀ u u u E 0%E 0hr SiSj n hqk8bu M Dž3ۉt C SDu SnÉ+ÍP+H#…v+PSQD8/t,PPV VVPV VfVqu'Vhqh  h j  tt8 Vo)uhq SSj ^[à 5- Phr SySj ~USVWXhP'u V؅t V5toCރXPS(p%=hWS|P=sIƄWVkVhqh h j Shpq S[Sj `SPh]utpPPP34XP t3-XPhq SSj Ĝ_^[à 5; Phr SSj 뾃 5 Phr SPSj U뇐USVxuuu} 6t 6,6z6nhdqu hhq+QS6tZ6hDphP~ EjdPQ9t!EuPu3 p^[ÐUSVWh V3=h`qu4؅=Suu t SruE 33/C t,E0h(qV S3 _^[à hq؃ hPq3ҐUSutVv.u'Php SSj LPhp SSj (Php SSj 3[à hqߐU hppu thlpjPu'|t h\pu`PQrPhLphPP/P(PÐU3ÐUEt/t @u3UEt:t @u3UU 3t/uB uUÐUSVW ]ME ;thPQs.u{/u.u{/ttJE 8uss uuSWhs+QuV ] _^[USVW(u7]˅t,3/u t C/t;t/CAuuu3ۃ u}hsE0u`hs>PzhsE0]|EhDrP7t\hsE0tCE8tl PKE8,hsP E0C E0mEK~gÅ3|AE0@rWVWVWVWV}ͅ~uh@rVKhsum_^[ÐUSuAhsut4jh@rE0thsE0+t(}3hDrEDP[UE8/u3 PQUSu Su uTuE /t 3[ÐUSV utXE St^[ÃShlsh hݐUSVW}M t2t;:t /u. ABRT HUP INT QUIT TERM USR1 USR2 Allowed signal names for kill: immediate quit without complete shutdown; will lead to recovery on restart fast quit directly, with proper shutdown smart quit after all clients have disconnected Shutdown modes are: -m, --mode=MODE MODE can be "smart", "fast", or "immediate" Options for stop or restart: -p PATH-TO-POSTGRES normally not necessary -o OPTIONS command line options to pass to postgres (PostgreSQL server executable) or initdb -l, --log=FILENAME write (or append) server log to FILENAME -c, --core-files allow postgres to produce core files Options for start or restart: If the -D option is omitted, the environment variable PGDATA is used. (The default is to wait for shutdown, but not for start or restart.) -?, --help show this help, then exit -W do not wait until operation completes -w wait until operation completes -V, --version output version information, then exit -t, --timeout=SECS seconds to wait when using -w option -s, --silent only print errors, no informational messages -D, --pgdata=DATADIR location of the database storage area Common options: %s kill SIGNALNAME PID %s promote [-D DATADIR] [-s] %s status [-D DATADIR] %s reload [-D DATADIR] [-s] %s restart [-w] [-t SECS] [-D DATADIR] [-s] [-m SHUTDOWN-MODE] [-o "OPTIONS"] %s stop [-W] [-t SECS] [-D DATADIR] [-s] [-m SHUTDOWN-MODE] %s start [-w] [-t SECS] [-D DATADIR] [-s] [-l FILENAME] [-o "OPTIONS"] %s init[db] [-D DATADIR] [-s] [-o "OPTIONS"] %s is a utility to initialize, start, stop, or control a PostgreSQL server. Try "%s --help" for more information. %s: could not send signal %d (PID: %ld): %s %s: no server running %s: server is running (PID: %ld) %s: single-user server is running (PID: %ld) server promoting %s: could not remove promote signal file "%s": %s %s: could not send promote signal (PID: %ld): %s %s: could not write promote signal file "%s": %s %s: could not create promote signal file "%s": %s w%s: cannot promote server; server is not in standby mode %s: cannot promote server; single-user server is running (PID: %ld) server signaled %s: could not send reload signal (PID: %ld): %s %s: cannot reload server; single-user server is running (PID: %ld) %s: old server process (PID: %ld) seems to be gone Please terminate the single-user server and try again. %s: cannot restart server; single-user server is running (PID: %ld) starting server anyway HINT: The "-m fast" option immediately disconnects sessions rather than waiting for session-initiated disconnection. %s: server does not shut down waiting for server to shut down...WARNING: online backup mode is active Shutdown will not complete until pg_stop_backup() is called. server shutting down %s: could not send stop signal (PID: %ld): %s %s: cannot stop server; single-user server is running (PID: %ld) Is server running? %s: PID file "%s" does not exist server starting %s: could not wait for server because of misconfiguration failed %s: could not start server Examine the log output. server is still starting up stopped waiting done waiting for server to start...%s: could not start server: exit code was %d PG_GRANDPARENT_PID=%dpostgres (PostgreSQL) 9.2.0 postgres%s: another server might be running; trying to start server anyway %s: database system initialization failed "%s" %s%s > "%s""%s" %s%sinitdb (PostgreSQL) 9.2.0 initdbThe program "%s" was found by "%s" but was not the same version as %s. Check your installation. The program "%s" is needed by %s but was not found in the same directory as "%s". Check your installation. " %s: option file "%s" must have exactly one line %s: could not read file "%s" %s: cannot set core file size limit; disallowed by hard limit . %s: this data directory appears to be running a pre-existing postmaster dbname=postgres port=%d host='%s' connect_timeout=5localhost* %s: -w option cannot use a relative socket directory specification %s: -w option is not supported when starting a pre-9.1 server "%s" %s%s < "%s" 2>&1 &/dev/null"%s" %s%s < "%s" >> "%s" 2>&1 &%s: invalid data in PID file "%s" %s: could not open PID file "%s": %s r%s: out of memory PostgreSQL"%s" -VPGSYSCONFDIR=%sPGSYSCONFDIRpostgres-9.2child process exited with unrecognized status %dchild process was terminated by signal %dchild process exited with exit code %dpclose failedfgets failureno data was returned by command "%s" popen failurer/%s%scould not read symbolic link "%s"could not change directory to "%s"could not find a "%s" to executecould not read binary "%s"PATHinvalid binary "%s"could not identify current directory: %s..//../usr/local/share/man/usr/local/share/doc//postgresql/usr/local/share/locale/usr/local/lib/postgresql/usr/local/lib/usr/local/include/postgresql/server/usr/local/include/postgresql/usr/local/include/usr/local/etc/postgresql/usr/local/bin/usr/local/share/postgresql%s: out of memory /../..././%s%sUnknown errort.>N^n~.>N^n~  . > N ^ n ~         !!.!>!N!^!n!~!!!!!!! &2BUbr~ tY Y8  ``@ ```Do_o$o `o``>s!8p<\?YVYl\m\D\sYt\c8$    ! tYYYYstvwwww ̏v:vMSv ^jvuw~Y" #B \#B #7 w# $< % vvvv\& 7 wD5@ Xd)m ) jwv* |+ v|, wwH. wwH0I 2 t3 5 6` 6 7 9 :: (D; 8vBvJwSvevwvwwww{jvuw~YwdG J) M wjvuw~Yw-4X6 L$Xs [Te f$U wjvuw~Ywywjvuw~Ywwjvuw~Yw!x 8! h!YvG P N !DY0  'X <8AD=  GNtW( ^(c oO vdTV YdV whP  ̏HdW  v -!5;W v!tYK!RXE \dejY) uP  !"ďV h @P W HP  ,8FH!L (S( <$W LWp ZDV _hX! i     .8 XS  Hv(! ! PQ P 18V EV V]!hcX j!uX!~H Xs"{ x!TN  DW xxsV 1 8ȏpg_ctlcrti.scrt1.ocrt1.s__get_exit_frame_monitor_ptr__do_exit_code_ptrfsr.strap_tablevalues-Xa.cDdata.dataBbss.bssDrodata.rodatapg_ctl.cwrite_stderrpg_mallocxstrdupprint_msgsilent_modeget_pgpidreadfilestart_postmasterlog_fileread_post_optspgdata_optexec_pathtest_postmaster_connectionwait_secondspostmaster_is_aliveunlimit_core_sizectl_commandfind_other_exec_or_diedo_initargv0do_startallow_core_filesdo_waitdo_stopset_sigshutdown_modedo_restartdo_reloaddo_promotedo_statusdo_killdo_advicedo_helpset_modeadjust_data_dirpg_configpg_datawait_setregister_usernameregister_passwordregister_servicenameTtdata.dataget_prognamepid_filestart_timepostopts_filebackup_filerecovery_filepromote_fileTtbss.bssexec.cvalidate_execresolve_symlinkspipe_read_linepath.ctrim_trailing_separatortrim_directorydir_strcmpmake_relative_pathpgsleep.cthread.ccrtn.s_END__START_strncmpumaskatexitfreechdirstrcatperror_fini_environfind_my_execmake_native_pathpclose_check__posix_getpwuid_rpqGetpwuidget_parent_directoryatoimainlstat64_DYNAMICgetpidatolgetopt_longset_pglocale_pgservice___Argv_lib_versionget_etc_pathfgetcsystemstrerrorfscanf_edatafirst_path_var_separator_endstrlcpyget_html_pathsnprintf__environ_lockgetppidsetrlimit64vfprintffgetsget_pkglib_pathselectpg_usleepstrcspn__iobpqStrerrorlast_dir_separator_get_exit_frame_monitoroptargget_includeserver_pathPQpinghas_drive_prefixerrno__fpstartget_man_pathfirst_dir_separatorfind_other_exec_exitpath_is_relative_and_below_cwdget_locale_pathget_home_pathget_share_path__1cG__CrunMdo_exit_code6F_v_geteuid_PROCEDURE_LINKAGE_TABLE_fputsstrlenpath_contains_parent_referencestrstrgetcwd__longdouble_usedfputcgetenvstrncpycanonicalize_pathjoin_path_componentsputenvget_lib_pathget_include_pathfcloseabortpclosestrerror_rreadlinkpopen__fsr_init_valuegetrlimit64strchr_etextrewind__fsrsetlocalepath_is_prefix_of_pathaccessget_doc_pathstrcpyfflush_GLOBAL_OFFSET_TABLE_fopen64get_pkginclude_pathunlinkoptindanotate anotate0 ,(!t"Y"vvanotate"h$,"#B\#B#7#$<%\&d)m)*|+|,H.H0I2t35@56`679::D;D= mF,sDpFD?1*#8>FNNNNNNNNNXNNNN9NNNNNNNNNNNNNNNNNNNNsN="NNNN&pF$F #26:=;anotate >FvDpFpFDtFDxFD|FDFDFDFDFDFzDF3@F@F@F@F@F@F@F@F@F@F?F@F?F@F@Fe?F@F>F@F>F@F@F@F@F@F@F@G@G@G@ G@G>G@G@G@ G@$G@(G@,G@0G@4G@8G@anotateddGTdGGJ)LMNOanotate anotatep@PP@PHP hP P PPPQXSS(TNdTVTe$UDVdVVVVVW$WDWdWWWpX$XsX6 V= $argc} { puts stderr "no value given for option $opt" incr errors continue } set val [lindex $argv $i] incr i switch -- $opt { -host { append options "-host \"$val\" " } -port { append options "-port $val " } default { puts stderr "unknown option '$opt'" incr errors } } } # # Final syntax check # if {$i >= $argc || $errors > 0} { puts stderr "" puts stderr "usage: pltcl_delmod dbname \[options\] modulename \[...\]" puts stderr "" puts stderr "options:" puts stderr " -host hostname" puts stderr " -port portnumber" puts stderr "" exit 1 } proc delmodule {conn modname} { set xname $modname regsub -all {\\} $xname {\\} xname regsub -all {'} $xname {''} xname set found 0 pg_select $conn "select * from pltcl_modules where modname = '$xname'" \ MOD { set found 1 break; } if {!$found} { puts "Module $modname not found in pltcl_modules" puts "" return } pg_result \ [pg_exec $conn "delete from pltcl_modules where modname = '$xname'"] \ -clear pg_result \ [pg_exec $conn "delete from pltcl_modfuncs where modname = '$xname'"] \ -clear puts "Module $modname removed" } set conn [eval pg_connect $dbname $options] while {$i < $argc} { delmodule $conn [lindex $argv $i] incr i } pg_disconnect $conn 0707010001f5ef000081ed000000000000000000000001504ffcae00011520000000b600010002ffffffffffffffff0000001d00000000root/usr/local/bin/reindexdbELF,44 (! 44oTH تت/usr/lib/ld.so.1  !"#$%&'()*+,./345689:;=>?@ABCDEFGINORUY\]^_adefghijklmopqtuwxy{|~ -0127<HJKLMPQSTVWXZ[`bcnrsvz}  &2>x7* C|3 X6 pl5\ @@ @- @| \N  Z [\ e Ph) 'tk 6=4v6 Uus dXre or  ! `b (L+p *)x C -*4t D8Y Ra gحpl{) {n )EP  |D  u `t ,*|) +)0B ,K (SYx= L(f(p!x(( *` ,+@t (u {\*|+B 'P-{ J*$++(59@ Et R{0 ]e j t {,"(|` |(Hc n  t q( ) s *''-,(T=L)W+_l(hܭ~*$n  ' <)HE تo )t l)m |j crV ?xxB $L*+<*3pA H`% ]+c? pu >n Ln cB c+ l*@F& \),\+(<+) Dn ,)#<,* +xbe 1,<ȬN@up \Դarx +{L,\,4?j ') m  A 9 )t '|4|,:)Kl,U4xD ] ,* + ) * |* ( ,hL(" xt 0 l+9 дreindexdbcrti.scrt1.ocrt1.sfsr.svalues-Xa.creindexdb.chelpreindex_one_databasereindex_system_catalogsreindex_all_databasescommon.cSetCancelConnResetCancelConnhandle_sigintdumputils.cparseAclItemcopyAclUserNameAddAclkwlookup.ckeywords.cexec.cvalidate_execresolve_symlinkspipe_read_linepath.ctrim_trailing_separatortrim_directorydir_strcmpmake_relative_pathpgstrcasecmp.csprompt.cthread.ccrtn.s__ctypevwrite_msggeteuidchdirpath_contains_parent_referenceabortPQconnectdbParamspg_ascii_tolowerappendStringLiteralConnlstat64get_locale_pathget_user_nameset_dump_sectionget_prognamepqStrerrorcanonicalize_pathsnprintfparse_versionNumFEScanKeywordsappendStringLiteralDQget_man_pathget_includeserver_pathpg_toupperstrlenpg_strdupgetcwd_GLOBAL_OFFSET_TABLE__edata__environ_lockpg_tolowervfprintf__iobexecuteQuerygetpwuid_environstrerrorPQgetvalueappendPQExpBufferCharemitShSecLabelsstrncpyget_pkginclude_pathgetenvget_html_path_finiPQserverVersionstrcpyappendStringLiteral__fpstart__fsrpclosePQntuplesconnectDatabaseget_etc_pathpqGetpwuidfind_my_execget_include_path_get_exit_frame_monitortermPQExpBufferon_exit_nicelyfirst_path_var_separatorget_lib_pathpath_is_relative_and_below_cwdcreatePQExpBuffer_etextget_share_pathstrncmp_exitinitPQExpBufferPQconnectionNeedsPasswordstrlcpyPQfinishquote_all_identifiersstrstrlast_dir_separator_PROCEDURE_LINKAGE_TABLE_PQstatusappendByteaLiteral_DYNAMICmallocerrnoget_pkglib_pathPQresultStatushas_drive_prefixfind_other_execstrchrPQmblensetup_cancel_handlerbuildShSecLabelQuerypopenyesno_promptget_parent_directoryexecuteMaintenanceCommandjoin_path_componentsScanKeywordLookupPQclientEncodingparsePGArrayPQexecfflushfputcappendPQExpBufferStrmake_native_pathfreefcloseaccessstrerror_r__longdouble_usedget_home_path_end__fsr_init_valuepg_ascii_touppersetlocale_initfilenotcgetattrgetopt_longPQfreeCancel__1cG__CrunMdo_exit_code6F_v_first_dir_separatorfmtIdhandle_help_version_optsPQgetCancelget_doc_path_lib_versionfputsresetPQExpBuffertcsetattr___Argvpg_strncasecmpprocessSQLNamePatternPQerrorMessageconnectMaintenanceDatabasepg_strcasecmpsscanfbuildACLCommandsexit_horriblypath_is_prefix_of_pathatexitbuildDefaultACLCommandsappendPQExpBufferinit_parallel_dump_utilsset_pglocale_pgserviceperrorpclose_check_startfgetsoptargstrcatmainPQcancelfopen64destroyPQExpBufferexecuteCommandenlargePQExpBufferputenvpqsignalprintfPQExpBufferPQescapeStringConnPQclear__posix_getpwuid_rsimple_promptreadlinkoptindlibc.so.1SUNW_1.22SUNW_1.19SUNW_1.1SUNW_0.7SYSVABI_1.3SUNWprivate_1.1libpq.so.5libxslt.so.1libxml2.so.2libpam.so.1libssl.so.0.9.8libcrypto.so.0.9.8libkrb5.so.3libcom_err.so.3libgss.so.1libz.solibreadline.so.6libtermcap.so.1libnsl.so.1libsocket.so.1libm.so.2/usr/local/lib:/usr/local/lib@ yJ yT '= ^ (= g 7p qN | sV 0ZE T-8u6L1&b]}|cr4)e~h[^N:dz/P9,3\Q7`?vHA2pDy$Ĭ̴!дV2G ,HĩLȩ>̩6Щ'ԩ#ةlܩ$&UpQJjX  $C(n,(048^<]@/DhHLNPTX\F`d4h lrpt*xm|k0a5zKq|}ĪȪ̪tЪԪ<5%%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%ĩhX0%ȩh` %̩hh%Щhp%ԩhx%ةh%ܩh%h%h%h%h%h%hp%h`%hP%h@%h0%h % h%h%h%h%h% h%$h%(h %,h(%0h0%4h8p%8h@`%<hHP%@hP@%DhX0%Hh` %Lhh%Php%Thx%Xh%\h%`h%dh%hh%lh%ph%thp%xh`%|hP%h@%h0%h %h%h%h%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%ĪhX0%Ȫh` %̪hh%Ъhp%ԪhxjjRتth{tĬt PEu TRU RPNPjURQt`|$у̬ D$td$у`tƒ 3fd$f T$tfd$f L$l$YZ]ÐUSVWhu 6!Dh6,?hx7hVuV EPhhu V 33EEEEEEEEEE*M 9E]3EEEEEEu ̴"w$2̴E̴EEwEn̴EdE[EREIE@̴E6̴E,̴E"uhXhjd EPhhWVy #]M؋E܉E}Ћ]ԡдU;} u <@д;Mu}}u^ h|#t h|6 htt ht S_t$ EPSuuuuhlWV 0}t& EPSuuuuhdWu0 u EPSuuuuhXWW0}6Su^ h|)t h|6 htt ht SeEPSuuuuWi F} }$AEPEPSuuuuu jl3_^[áдU 4Sh hMEE* ShXhjEEMShԎhjShhjzSh؏hjUShhzj0ShXhUj Sh h0j+/I//I/I/I/I/I/I/I/I/I/.I/I/./I/I/?/.I/I/I/I/I/I/5//I/..I/I/"/USVEPEhPhd]utghl3t8hX3ouR u PEh0P;0uEh@P"uEhLP h,EP ju$u uuuu UE(PuVN hd3hl3t+ VPE 0E$0hh5 , VwPE 0uE$0hh V[j VEEPI ^[à VPE 0uE$0hh 0USVW4uEEPuuu uh } WuhHVVS}$tfE EԍEE܍EE؍EE3jVSWuuuuuhXPPb0F Se;|EEE E܍EEԍEEЉ}3jVS8 Wuh(5hЮ8uuuuuuhXWW0F S;|],_^[US EPT uhEPP juuuuu uE PuSt SAEPE$[à SPE0hhSj[묐Uuh!huhhh`h,hhhph8hhhhhuh hh[hNh|AhH4h 'ḧE US, P3؅t[à 5$PuhhjŐUS}~_h] s,tKh st4hst=hst&[à 38PUj?묃uh E[USVW,E j'j*"E GEFGEFG 3F GMMNG|MMNGFjVWWV SE< S+jjdhؒ2>MMM MԋMM؋MM܋MMЉE jj iaEԉGE؉FGE܉FG EF GEЉFG|EF3GFjVWWV  Su; St+}u% S jjdhؒ#=E Et P< S@u}  SU3؋Ã,_^[ÃuhĒhjuuhThj^uhĒhj7xuuhThZj SPuuh(h&j&USEtjuuuuu P Mju]Suuu ht u'jE0SE0E0E 0hI [USV}tu h$u u؅t Su^[à E0PuhV$E 0uhVE0aj뤐USV}tu h$uu u؅t Su ]^[_ E0PuhV{E 0uhVeE0j럐USV}tu h$ uu uat VZà V3^[ÐUS]t S1؅t)Ã[ÃhhjTŃhh}j3붐USVWhhuhhPjjP9hVZtkSV?t@ V SWhd jjP8WVt믃 V3 V _^[ÐUЭE3Э}t E0 uЭUЭE3Э}t E0ÐUS=ЭtThP5ЭuPh(hhLh[Uh@jJUÐUSVԭt S8 >؉ԭ=ܭunUHv_u[tȍqv Ѓ v<_u@Bu5 |h(|u!t@uE0SSj"Sut-<"uj"SPSFuӃj"S^[ÐUSVW8u u EPuzEMA 'CMMMMu<'t <\u }uCCFAuV$3҅~(΋Ӊ]uԋڋ3ҋM t } FCB;|;| u!Mq t1+ʍ<;s  CB;|'CE+CX,_^[ÐUSu }j\u ti u=8|T]UJv| tj R!jE3E0ejPE 03of]PutLj'E0jSE 0EAPu M AE 'M[[ÐUSVW Rj$WeEt PWA7u t1E 03ۃ|PW"C7Vuփj$W7uu u7u} _^[TUSVW u ]]PutvEP<'O}uD\O\AxASv3Y>F|| Jхw'@M+@A _^[ÐUSVW(}W]SuVhԗu |t3kd kd_^[USVW 3ɋu E u؃E8{|} QwWO3}t~ }tM,tHtg"t BC,zJ"ttH\uGt7 GC"uW }t,uC ,uB F}u3(3$3 3zu E0 333 _^[ÐUSVWL] u=t;u3ۃEPEPE0uEt Pi3E EEEEuhėu-E tPhuuuhuM H9}ChE0υu& E0E0E0hpu ύE8EGEčEEȍEE̍E EЍEE3ME uuVuuuuuȍE48[0~EtShlVExvu$~ExSE0uS6t@~wExEx126S,EE}}hXE0ehXE0FuhėuEЅtPhu E0=PuuhXu Exv/ E0 PuuȋE0uh<u Ex( E0 PuuȋE0uh ub ~ 6 Phu5ExuuȋE0uhԖu E܃xt{ h PhE0kt# E0 PhuD hMP PhuhȖupExuuȋE0uhԖuB E܃xt{ h PhE0t# E0R PhluD hMP! Phuhuhu~v)t6Sth`uiE@E؍M;}u؋u}uRtNuhėV-E tPhV SXPuuhXV uEu:u/u$76hXu$VWuE 0l3]L_^[ÐUSV u Ph0V:E t Pw Ph Vuu6E0uujh"VK^[ÐUSVW(u\ Vuv 8=4 xj/Wt+@Pu E 8t! Vd3 u  u$u(hu FhE 0)hE 0 hE 0hE 0%hE 0hE 0vhxE 0{hE 0^8hXE 0Ah@E 0$h0E 0h E 0hE 0Y jrWtOx*t#uhE$0 3E/uhE(0 E E3ۃjwWMtIx*tE$uh0w 3 uhE(0X EE3jrWtUx*t&uhE$0 3EuhE(0 EkE3]jUWotUx*t&uhE$0 3EuhE(0s EE3jUWtUx*t&uhE$0$ 3EuhE(0EE3sjCWtUx*t&uhpE$03E5uhpE(0E E3jCWtOx*t#uhpE$0:3E/uhpE(0E E3ۃjcWtCx*tE$uhd03*uhdE(0E E3ۃjTWHtIx*tE$uhd0r3uhdE(0SEE3jCWtOx*t#uhpE$0 3E/uhpE(0E E3ۃjUWutIx*tE$uh03,uhE(0EE3jUW tUx*t&uhE$063EuhE(0EE3jXWtUx*t&uhlE$03EGuhlE(0EE3jrW"tOx*t#uhE$0L3E/uhE(0)E E3ۃhE 0thE 0umjUWtCx*tE$uh03*uhE(0E E3ہ}8ojaWtCx*tE$uhܕ0C3*uhܕE(0'E E3ۋEE=8hE 0hE 0jwWptIx*tE$uh03'uhE(0{EE3jxWtCx*tE$uhЕ013*uhЕE(0E E3ۋE.jdWEtCx*tE$uhȕ03*uhȕE(0E E3ۃjtW=tGx*tE$M1ht0e3,E0htE(0GE E3ہ}:|bjDWtGx*tE$M1h03,E0hE(0E E3ۃjwWptCx*tE$uh03*uhE(0~E E3ۄۍ]$uA}tw E(0hX3dEtQPh3< 3[hXE(0)EtPhE(0 Vp V]33_^[E6USV] utt=toM1<"uIC"u{"u7tS<"uKS"uًCPV"uπ{"tCCPVt=u] E ^[ÐUS]Exvj,PVu hl3qEt EE M[N[USVWHug]J EP EPEhP EEE"}t $?=*?.$}t)Phtj\EP3WSVp )!PEPCF΋t  u hEPC EPE0EPEPdhEPsC j.EPiC thEP?C Z RPEP-C 8}t's{"t Ej"EPEC 2}7h]Shؔu }uPu u }}$tTu hД6 u36 Wh6 u36h6$0u h6M u36j 6}w}( ]hEPhؔu}}wJ3ۃ}(}tPu c u(hTu hEP2hؔur3ۅt_3ۃ}tW}tPu uhu uuu cj u  EP.EP"@u(3ۅt7}uPu v VhTu Ã<_^[ÐUUE MMEE @UkUSVW8u E }EEEE܋EE3jVSE؃jVSrEԃ uQuPh$Wu4 Ph\W uuWh WF S;p,_^[US] ;uhuu h E0bu ahE0Du CE05حhؓS 5حhSE[[ÐU EPu uÐU=حt=EtP5حhhh5حhhKM EEM EU EPu ujIÐU=|h|jM M @ÐUSVW Kxe4}3|<}vWvWVvWVvWV}˅|}vWK}EE _^[USVWhu7E@EH}33|juE3;Pw D=WD;xw DDxw DDxw Dz;~;U:Xw D=G;~ED] Et;wE+ˋ<˃EP4vt|w_;v33ǃ\_^[ÐUShSu|SC%=tBjE0jE0ut3 Ĕ[ÐUSVhP|n u.E8/tPQu nhPu 8E ƀ u u u E 0%E 0hSSj  hk8bu M Dž3ۉt C SDu SFÉ+ÍP+H#…v+PSQD8/t,PPV VVPV VfVqu'Vhhbhj  tt8 Vo)uhxSSj 5^[à 5 PhԧSѿSj USVWXhPu V؅t VtoCރXPSp%=hWS~|P=sIƄWVnkVhThhj Sh0S賾Sj SPh]utpPPP34XPt3-XPhTSSj DĜ_^[à 5 PhԧS߽Sj 뾃 5謾 PhԧS訽Sj 뇐USVxuuu} 6t 6,6R6Fh$u h(+QS薾6tZ6hhPf EjdPQ9t!EuPu3 p^[ÐUSVWhЮ5V'3=h uܿ؅=Suu ʿt SruE 33/C t,E0hV S莿3 _^[à hئ脿؃ hr3ҐUSuItVv.u'PhtSoSj 蔾LPh@SKSj p(PhS!Sj F3[à hȦ觾ߐU h0u th,j脾Pu'|t h諺u`PQrPh hP޻P/P谻PÐU3ÐUEt/t @u3UEt:t @u3UU 3t/uB uUÐUSVW ]ME ;thPQ{.u{/u.u{/ttJE 8uTX ufuYSWh\+QuV论 ] _^[USVW(u7]˅t,3/u t C/t;t/CAuuu3ۃ u˺}hLE0߸u`hP>P¸hLE0襸|EhPt\hHE0ftCE8tl PKE8,hLPT E0C E0mEK~gÅ3|AE0WVkWVaWVWWVM}ͅ~uhV-KhHu_^[ÐUSuhHu7t4jhE0蜹th@E0Ct(}3hEDPն[UE8/u3 PQUSu] Su uuE /t 3[ÐUSV utXE SRt^[ÃSh,h舸ݐUSVW}M t2t;:t /u. Read the description of the SQL command REINDEX for details. --maintenance-db=DBNAME alternate maintenance database -W, --password force password prompt -w, --no-password never prompt for password -U, --username=USERNAME user name to connect as -p, --port=PORT database server port -h, --host=HOSTNAME database server host or socket directory Connection options: -?, --help show this help, then exit -V, --version output version information, then exit -t, --table=TABLE reindex specific table only -s, --system reindex system catalogs -q, --quiet don't write any messages -i, --index=INDEX recreate specific index only -e, --echo show the commands being sent to the server -d, --dbname=DBNAME database to reindex -a, --all reindex all databases Options: %s [OPTION]... [DBNAME] %s reindexes a PostgreSQL database. %s: reindexing of system catalogs failed: %sREINDEX SYSTEM %s; %s: reindexing database "%s" SELECT datname FROM pg_database WHERE datallowconn ORDER BY 1;%s: reindexing of database "%s" failed: %s%s: reindexing of index "%s" in database "%s" failed: %s%s: reindexing of table "%s" in database "%s" failed: %s; DATABASE %s INDEX %s TABLE %sDATABASETABLEINDEXPGUSERPGDATABASE%s: cannot reindex a specific index and system catalogs at the same time %s: cannot reindex a specific table and system catalogs at the same time %s: cannot reindex a specific index in all databases %s: cannot reindex a specific table in all databases %s: cannot reindex all databases and system catalogs at the same time %s: cannot reindex all databases and a specific one at the same time %s: too many command-line arguments (first is "%s") Try "%s --help" for more information. h:p:U:wWeqd:ast:i:reindexdbpgscripts-9.2maintenance-dbindextablesystemdbnamequietechopasswordno-passwordusernameporthost%s Could not send cancel request: %sCancel request sent Please answer "%s" or "%s". ny%s (%s/%s) out of memory pg_strdup: cannot duplicate null pointer (internal error) %s: query was: %s %s: query failed: %stemplate1postgres%s: could not connect to database %s: %s%s: could not connect to database %s fallback_application_namedbnamepassworduserporthost%s: out of memory Password: %s (PostgreSQL) 9.2.0 -V--version-?--help%s: could not obtain information about current user: %s %s ALL %s IS CONNECTEXECUTETRIGGERout of on_exit_nicely slots %s: %s: [%s] Try "%s --help" for more information. %s: unrecognized section name: "%s" post-datadatapre-data; SECURITY LABEL FOR %s ON %sSELECT provider, label FROM pg_catalog.pg_shseclabel WHERE classoid = '%s'::pg_catalog.regclass AND objoid = %u%s ~ ) OR %s ~ (%s ~ ^(.*)$)$|*+?()[]{}.^$\\$.*^(WHERE AND LARGE OBJECTFOREIGN TABLEFOREIGN SERVERFOREIGN DATA WRAPPERTABLESPACETEMPORARYCREATESCHEMALANGUAGEFUNCTIONSFUNCTIONUPDATE,DELETEUPDATETRUNCATEDELETEREFERENCESINSERTUSAGESELECTSEQUENCESTABLESSEQUENCETABLEIN SCHEMA %s ALTER DEFAULT PRIVILEGES FOR ROLE %s %s%sRESET SESSION AUTHORIZATION; WITH GRANT OPTION; GROUP %sPUBLIC%s; GROUP %s; group PUBLIC; %sGRANT %s ON %s %s TO SET SESSION AUTHORIZATION %s; %sGRANT %s ON %s %s TO %s WITH GRANT OPTION; %sGRANT %s ON %s %s TO %s; ON %s %s FROM %s; %s%sGRANT CONNECT ON %s %s TO PUBLIC; DATABASE ON %s %s FROM PUBLIC; (%s)%sREVOKE ALL%d.%d.%dyesxmlsetrowrefoutoffnotkeyintforenddecdaycsvbitascanyandalladdxmlrootwrapperwithoutversionverbosevaryingvarcharunknowntrustedtriggerstoragesimilarsessionreturnsrestartreplicareplacereleasereindexrecheckprimaryprepareplacingpassingpartialoverlayoptionsnumericnotnullnothingnaturalmappingleadinginvokerintegerinsteadinheritindexeshandlergrantedforwardforeignextractexplainexecuteexcludediscarddisabledefinerdefaultdeclaredecimalcurrentcontentcommentcollateclustercatalogcascadebooleanbetweenanalyzeanalysecurrent_catalogcharacteristicszoneyearxmlserializexmlpixmlparsexmlforestxmlexistsxmlelementxmlconcatxmlattributeswriteworkwithwindowwhitespacewherewhenvolatileviewvariadicvaluesvaluevalidatorvalidatevalidvacuumusinguserupdateuntilunloggedunlistenuniqueunionunencrypteduncommittedunboundedtypestypetruncatetruetrimtreattransactiontrailingtotimestamptimethentexttemporarytemplatetemptablespacetablestablesystemsysidsymmetricsubstringstripstrictstdoutstdinstatisticsstatementstartstandalonestablesomesnapshotsmallintsimpleshowsharesetofsession_userserverserializablesequencessequenceselectsecuritysecondsearchscrollschemasavepointrulerowsrollbackrolerightrevokereturningrestrictresetrepeatablerenamerelativereferencesrecursivereassignrealreadrangequoteprocedureproceduralprivilegespriorpreservepreparedprecisionprecedingpositionplanspasswordpartitionparserownerownedoverlapsoverouterorderoroptionoperatoronlyonoidsoffsetofobjectnullsnullifnullnowaitnotifynonenonextncharnationalnamesnamemovemonthmodeminvalueminutemaxvaluematchlocklocationlocaltimestamplocaltimelocalloadlistenlimitlikelevelleftleastleakprooflc_ctypelc_collatelastlargelanguagelabeljoinisolationisnullisintointervalintersectinsertinsensitiveinputinoutinnerinlineinitiallyinheritsindexincrementincludinginimplicitimmutableimmediateilikeifidentityhourholdheaderhavinggroupgreatestgrantglobalfunctionsfunctionfullfromfreezeforcefollowingfloatfirstfetchfamilyfalseexternalextensionexistsexclusiveexcludingexceptescapeenumencryptedencodingenableelseeachdropdoubledomaindocumentdodistinctdictionarydescdelimitersdelimiterdeletedeferreddeferrabledefaultsdeallocatedatabasedatacyclecursorcurrent_usercurrent_timestampcurrent_timecurrent_schemacurrent_rolecurrent_datecrosscreatecostcopyconversioncontinueconstraintsconstraintconnectionconfigurationconcurrentlycommittedcommitcommentscolumncollationcoalescecloseclasscheckpointcheckcharactercharchaincastcasecascadedcalledcachebybothbinarybigintbeginbeforebackwardauthorizationattributeatasymmetricassignmentassertionasarrayalwaysalteralsoaggregateafteradminactionaccessabsoluteabort"%s" -VPGSYSCONFDIR=%sPGSYSCONFDIRpostgres-9.2child process exited with unrecognized status %dchild process was terminated by signal %dchild process exited with exit code %dpclose failedfgets failureno data was returned by command "%s" popen failurer/%s%scould not read symbolic link "%s"could not change directory to "%s"could not find a "%s" to executecould not read binary "%s"PATHinvalid binary "%s"could not identify current directory: %s..//../usr/local/share/man/usr/local/share/doc//postgresql/usr/local/share/locale/usr/local/lib/postgresql/usr/local/lib/usr/local/include/postgresql/server/usr/local/include/postgresql/usr/local/include/usr/local/etc/postgresql/usr/local/bin/usr/local/share/postgresql%s: out of memory /../..././%s%s wr/dev/ttyUnknown errorت''''(("(2(B(R(b(r((((((((())")2)B)R)b)r)))))))))**"*2*B*R*b*r*********++"+2+B+R+b+r+++++++++,,",2,B,R,b,r,,,,,           " 2 > M @ { {W W  u  ``P ``P#`oo|!o,%$`o``>,hpUwWeqؐdaАsȐti|!!P# $ ,% ' , {{|ت SԴY  =ĬPV̬ amx|x7* |3 6 l5\ mx|@@ @- !Э,@| mЭx|:F\N  SZ c[\ jmԭx|mx|mx |e Ph) tk mx|4v6 us Xre r mx|*mx|9mx|Cmx|Lb !a j`b t(|L+p *)x C *t 8Y a ح&l{) 1n C)LEP Z |lD  u `t ,*|)+ , ( x= ((&!.(7(B *X` h,+p@t (u {\*|+B 'P-{ *+(9@ t {0 e  t 1,"](|` I|(\Hc hn  t q( )s *',( L) +l(ܭ4*;$n  N' h<)qHE ت% )t l)m |j rV xxB L*<*pA `% +? &u ;>n ULn YcB jc+ |l*@F& \)\+(<+)Dn ,)<, +ixbe ,Ȭ@up Դ(x 9+C{IL,P\,4?j Z'f)s m  A 9 )t ||,) l, 4xD   u ,* + ) * |* ( ,L( xt l+ дreindexdbcrti.scrt1.ocrt1.s__get_exit_frame_monitor_ptr__do_exit_code_ptrfsr.strap_tablevalues-Xa.cDdata.dataBbss.bssDrodata.rodatareindexdb.chelpreindex_one_databasereindex_system_catalogsreindex_all_databasesTtdata.dataTtbss.bsscommon.cSetCancelConnResetCancelConncancelConnhandle_sigintdumputils.cparseAclItemcopyAclUserNameAddAclon_exit_nicely_indexon_exit_nicely_listkwlookup.ckeywords.cexec.cvalidate_execresolve_symlinkspipe_read_linepath.ctrim_trailing_separatortrim_directorydir_strcmpmake_relative_pathpgstrcasecmp.csprompt.cthread.ccrtn.s_END__START___ctypevwrite_msggeteuidchdirpath_contains_parent_referenceabortPQconnectdbParamspg_ascii_tolowerappendStringLiteralConnlstat64get_locale_pathget_user_nameset_dump_sectionget_prognamepqStrerrorcanonicalize_pathsnprintfparse_versionNumFEScanKeywordsappendStringLiteralDQget_man_pathget_includeserver_pathpg_toupperstrlenpg_strdupgetcwd_GLOBAL_OFFSET_TABLE__edata__environ_lockpg_tolowervfprintf__iobexecuteQuerygetpwuid_environstrerrorPQgetvalueappendPQExpBufferCharemitShSecLabelsstrncpyget_pkginclude_pathgetenvget_html_path_finiPQserverVersionstrcpyappendStringLiteral__fpstart__fsrpclosePQntuplesconnectDatabaseget_etc_pathpqGetpwuidfind_my_execget_include_path_get_exit_frame_monitortermPQExpBufferon_exit_nicelyfirst_path_var_separatorget_lib_pathpath_is_relative_and_below_cwdcreatePQExpBuffer_etextget_share_pathstrncmp_exitinitPQExpBufferPQconnectionNeedsPasswordstrlcpyPQfinishquote_all_identifiersstrstrlast_dir_separator_PROCEDURE_LINKAGE_TABLE_PQstatusappendByteaLiteral_DYNAMICmallocerrnoget_pkglib_pathPQresultStatushas_drive_prefixfind_other_execstrchrPQmblensetup_cancel_handlerbuildShSecLabelQuerypopenyesno_promptget_parent_directoryexecuteMaintenanceCommandjoin_path_componentsScanKeywordLookupPQclientEncodingparsePGArrayPQexecfflushfputcappendPQExpBufferStrmake_native_pathfreefcloseaccessstrerror_r__longdouble_usedget_home_path_end__fsr_init_valuepg_ascii_touppersetlocale_initfilenotcgetattrgetopt_longPQfreeCancel__1cG__CrunMdo_exit_code6F_v_first_dir_separatorfmtIdhandle_help_version_optsPQgetCancelget_doc_path_lib_versionfputsresetPQExpBuffertcsetattr___Argvpg_strncasecmpprocessSQLNamePatternPQerrorMessageconnectMaintenanceDatabasepg_strcasecmpsscanfbuildACLCommandsexit_horriblypath_is_prefix_of_pathatexitbuildDefaultACLCommandsappendPQExpBufferinit_parallel_dump_utilsset_pglocale_pgserviceperrorpclose_check_startfgetsoptargstrcatmainPQcancelfopen64destroyPQExpBufferexecuteCommandenlargePQExpBufferputenvpqsignalprintfPQExpBufferPQescapeStringConnPQclear__posix_getpwuid_rsimple_promptreadlinkoptindanotate anotate0 ,(,ت,{Y-Ĭanotate- 0|3l5\6x7*-2.2aO*3Fuk=!X 2 68anotate0 ,(-x7.22+/2I/2/2I/3I/3I/3I/ 3I/3I/3I/3I/3I/ 3.$3I/(3I/,3.03/43I/83I/<3?/@3.D3I/H3I/L3I/P3I/T3I/X3I/\35/`3/d3I/h3.l3.p3I/t3I/x3"/anotate88Y99@<x=>>n4?j?@@@-@|pA9 9h>anotate wA@anotatePAN"AABCDHEEP@F&hGrM\N Z[\[`%`a`bxbeb!cBHcwccccc DCE[`Rbbcanotate anotatec+ c+anotatedeTeePh)|jtkTlmanotate anotatepmPmm n $n DnLnnpq(qNrVXrerst t@t`tttttu u@upuus4v6 ssuanotate anotateXlvHlv?@ABCDEFGINORUY\]^_adefghijklmopqtuwxy{|~ -0127<HJKLMPQSTVWXZ[`bcnrsvz}  &2>`4 C1v X2h nw`=@ =- =| 8K  W tX\ a ,e) Ph %s6 =rs L4oe Wo jy ! <_ ( +m *(u l@ *q ,5Y :^ OXHx) ck u`)~BP yhA q  0]% E`+K|< Xr m;n (k _B `+ @*C& 0)0+(+) k ) ,*T_e `,$6rp DIZu k+ux{ ,0,<j 'p) j  h> 5 )q xP,")3@,=uD Et TX j@(y9 Hs *DDr _! 'nN 'J ( `> ) i @ +G 0i T , [ p+a h +o - t )} , p* : * + ) * P* ( p,P( ut  @+! clusterdbcrti.scrt1.ocrt1.sfsr.svalues-Xa.cclusterdb.chelpcluster_one_databasecluster_all_databasescommon.cSetCancelConnResetCancelConnhandle_sigintdumputils.cparseAclItemcopyAclUserNameAddAclkwlookup.ckeywords.cexec.cvalidate_execresolve_symlinkspipe_read_linepath.ctrim_trailing_separatortrim_directorydir_strcmpmake_relative_pathpgstrcasecmp.csprompt.cthread.ccrtn.s__ctypevwrite_msggeteuidchdirpath_contains_parent_referenceabortPQconnectdbParamspg_ascii_tolowerappendStringLiteralConnlstat64get_locale_pathget_user_nameset_dump_sectionget_prognamepqStrerrorcanonicalize_pathsnprintfparse_versionNumFEScanKeywordsappendStringLiteralDQget_man_pathget_includeserver_pathpg_toupperstrlenpg_strdupgetcwd_GLOBAL_OFFSET_TABLE__edata__environ_lockpg_tolowervfprintf__iobexecuteQuerygetpwuid_environstrerrorPQgetvalueappendPQExpBufferCharemitShSecLabelsstrncpyget_pkginclude_pathgetenvget_html_path_finiPQserverVersionstrcpyappendStringLiteral__fpstart__fsrpclosePQntuplesconnectDatabaseget_etc_pathpqGetpwuidfind_my_execget_include_path_get_exit_frame_monitortermPQExpBufferon_exit_nicelyfirst_path_var_separatorget_lib_pathpath_is_relative_and_below_cwdcreatePQExpBuffer_etextget_share_pathstrncmp_exitinitPQExpBufferPQconnectionNeedsPasswordstrlcpyPQfinishquote_all_identifiersstrstrlast_dir_separator_PROCEDURE_LINKAGE_TABLE_PQstatusappendByteaLiteral_DYNAMICmallocerrnoget_pkglib_pathPQresultStatushas_drive_prefixfind_other_execstrchrPQmblensetup_cancel_handlerbuildShSecLabelQuerypopenyesno_promptget_parent_directoryexecuteMaintenanceCommandjoin_path_componentsScanKeywordLookupPQclientEncodingparsePGArrayPQexecfflushfputcappendPQExpBufferStrmake_native_pathfreefcloseaccessstrerror_r__longdouble_usedget_home_path_end__fsr_init_valuepg_ascii_touppersetlocale_initfilenotcgetattrgetopt_longPQfreeCancel__1cG__CrunMdo_exit_code6F_v_first_dir_separatorfmtIdhandle_help_version_optsPQgetCancelget_doc_path_lib_versionfputsresetPQExpBuffertcsetattr___Argvpg_strncasecmpprocessSQLNamePatternPQerrorMessageconnectMaintenanceDatabasepg_strcasecmpsscanfbuildACLCommandsexit_horriblypath_is_prefix_of_pathatexitbuildDefaultACLCommandsappendPQExpBufferinit_parallel_dump_utilsset_pglocale_pgserviceperrorpclose_check_startfgetsoptargstrcatmainPQcancelfopen64destroyPQExpBufferexecuteCommandenlargePQExpBufferputenvpqsignalprintfPQExpBufferPQescapeStringConnPQclear__posix_getpwuid_rsimple_promptreadlinkoptindlibc.so.1SUNW_1.22SUNW_1.19SUNW_1.1SUNW_0.7SYSVABI_1.3SUNWprivate_1.1libpq.so.5libxslt.so.1libxml2.so.2libpam.so.1libssl.so.0.9.8libcrypto.so.0.9.8libkrb5.so.3libcom_err.so.3libgss.so.1libz.solibreadline.so.6libtermcap.so.1libnsl.so.1libsocket.so.1libm.so.2/usr/local/lib:/usr/local/lib( y2 y< '= F (= O 7X qN d rU /YD S,7t5K0%a\|{bq3(d}gZ]M9cy.O8~+2[P6_>uG@1oCx#!@V|2G ,HL>6'#lĤ$Ȥ&̤ФUԤؤpܤQJjXC n(^ ]$/(h,0N48<@FDH4L PrTX*\m`dkhl0patx5|zKq|}t<5t%x%|h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h%Ĥh%Ȥh%̤h%Фh%Ԥh%ؤhp%ܤh`%hP%h@%h0%h %h%h%h%h%h%h%h% h %h(%h0%h8p%h@`% hHP%$hP@%(hX0%,h` %0hh%4hp%8hx%<h%@h%Dh%Hh%Lh%Ph%Th%Xhp%\h`%`hP%dh@%hh0%lh %ph%th%xh%|h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hxjjRt hxtt PEu TRU RPKPjURQt`|$у D$td$у`tƒ 3fd$f T$tfd$f L$l$YZ]ÐUSVWXu 6-Ah68<h`4hV}WEPhاhtu W 3EEEEEEEEEEM 1E]3EEEEu "wr$0EEwEnEdE[EREIE@E6E,E"uhLhj EPhاhtVW 0]E؉EE܉EuЋ]ԡM;}U 4@;}u^ hQt h=6 h)t h S EPSuuuuuEPVm0<} EPEPSuuuuuEP0 jB\3_^[áM 4Shh] ShLhJjSh̊h%jSShhj8...................................US EPpEhxPo} tEhtPUEt[PEhhP9hpEP( ju$u uuuuE(PuS uIbhpEP ju$u uuuuGE(PuS@ tK SEP$[à SPE0E0E$0h4h3 ) SPE0E$0hh S<jqUSVW4u EEPuuuu  }$Wu hȉV VS}(tlEE؍EEЍEE܍EEԍE E3jVSWuuuuujuP0F S;|E EEE܍EE؍EE̍EEԉ}3jVSc Wuh`hcuuuuuujuWC0F S;|],_^[0UuhhhpuhLh@h h؈hhXhhhxhlkhT^h Qh؆Dh7hh*h4hhEUS P؅t[à 5@ PuhhjŐUS}~_h] stKhst4hst=hst&[à 38PUj7묃uhȍE[USVW,E jj*"E GEFGEFG 3F G|MMNG`MMNGFjVWWV SE< S+jjdh2>MMM MԋMM؋MM܋MMЉE jjiaEԉGE؉FGE܉FG EF G|EЉFG`EF3GFjVWWV  Su; St+}u% S jjdh#=E Et P4 S8u}  S-3؋Ã,_^[Ãuhhj}uuh8hjVuhhyj/xuuh8hRj SPuuh hj&USEtjuuuuu P Mju]Suuu ht u'jE0SE0E0E 0hI [USV}tu hu u؅t Su^[à E0Puh܌VE 0uhȌVE09j뤐USV}tu h]u u ؅t S u ]^[G E0Puh܌VsE 0uhȌV]E0j럐USV}tu h uu uYt VRà V3^[ÐUS]t S)؅t)Ã[ÃhhjLŃh|huj+붐USVWhhhluhphPjjP9hlVtkhlSVt@ V SWhHh jjP8WVt믃 V3 V _^[ÐUE3}t E0 uUE3}t E0ÐUS@=tThP5uPh hh0h@[Uh=jBUÐUSVt S0 6؉=unUHv_u[tȍqv Ѓ v<_u@Bu5yhyu!t@uE0SSj"Sut-<"uj"SPSFuӃj"S^[ÐUSVW8u {u EPurEMA 'CMMMMu<'t <\u }uCCFAuV3҅~(΋Ӊ]uԋڋ3ҋM t } FCB;|;| u!Mq t1+ʍ<;s  CB;|'CE+CX,_^[ÐUSu uj\u ti u=8|T]UJv| tj RjE3 E0]jPE 03of]PutLj'E0jSE 0EAPu M AE 'M[[ÐUSVW Jj$W]Et PW97u t1E 03ۃxPWC7Vuփj$W7uu u7u} _^[LUSVW u ]]PutvEP<'O}uD\O\AxASv3Y>Fxx Jхw'@M+@A _^[ÐUSVW(}W]SuVhu |t3kd kd_^[USVW 3ɋu E u؃E8{|} QoWO3}t~ }tM,tHtg"t BC,zJ"ttH\uGt7 GC"uW }t,uC ,uB F}u3(3$3 3zu E0 333 _^[ÐUSVWL] u=t;u3ۃEPEPE0uEt Pa3E EEEEuhu%E tPhu uuhuM H9}Ch|E0υu& E0E0E0hTu ύE8EGEčEEȍEE̍E EЍEE3ME uuVuuuuuȍE48[0~EtShPVExvu$~ExSE0uS6vt@~wExEx126S?,EE}}h<E0 h<E0uhuEЅtPhu E0=Puuh<u Exv/ E0 PuuȋE0uh u Ex( E0 PuuȋE0uhuZ ~ 6 PhБu-ExuuȋE0uhu E܃xt{ h PhE0ct# E0 PhuD h|MP Phu}huhExuuȋE0uhu: E܃xt{ h PhE0t# E0R PhPuD hMP! Ph|uhuhdu~v)t6S8thDuaE@E؍M;}u؋u}uRtNuhV%E tPhV  SXPuuh<V u=u2u'u76h<u$VWu{E 0d3]L_^[ÐUSV u PhV2E t Pw PhVuu6E0uujh"VC^[ÐUSVW(u\ Vuv 8=4 xj/Wt+@Pu E 8t! V\3 u  u$u(hu hE 0hE 0hؐE 0h|E 0z%hpE 0]hdE 0@vh\E 0#h|E 08h<E 0h$E 0hE 0hE 0hE 0uY jrWtOx*t#uhАE$0 3E/uhАE(0 E E3ۃjwWEtIx*tE$uh0w 3 uhE(0X EE3jrWtUx*t&uhАE$0 3EuhАE(0 EkE3]jUWgtUx*t&uhȐE$0 3EuhȐE(0s EE3jUWtUx*t&uhȐE$0$ 3EuhȐE(0EE3sjCW}tUx*t&uhTE$03E5uhTE(0E E3jCWtOx*t#uhTE$0:3E/uhTE(0E E3ۃjcWtCx*tE$uhH03*uhHE(0E E3ۃjTW@tIx*tE$uhH0r3uhHE(0SEE3jCWtOx*t#uhTE$0 3E/uhTE(0E E3ۃjUWmtIx*tE$uhȐ03,uhȐE(0EE3jUWtUx*t&uhȐE$063EuhȐE(0EE3jXWtUx*t&uhPE$03EGuhPE(0EE3jrWtOx*t#uhАE$0L3E/uhАE(0)E E3ۃhE 0YthؐE 0@umjUW~tCx*tE$uhȐ03*uhȐE(0E E3ہ}8ojaWtCx*tE$uh0C3*uhE(0'E E3ۋEE=8hE 0KhؐE 0.jwWhtIx*tE$uh03'uhE(0{EE3jxWtCx*tE$uh013*uhE(0E E3ۋE.jdWEtCx*tE$uh03*uhE(0E E3ۃjtW5tGx*tE$M1hX0e3,E0hXE(0GE E3ہ}:|bjDWtGx*tE$M1h03,E0hE(0E E3ۃjwWhtCx*tE$uh03*uhE(0~E E3ۄۍ]$uA}tw E(0h<3\EtQPh3< 3Sh<E(0!EtPhE(0 Vh VU33_^[E6USV] utt=toM1<"uIC"u{"u7tS<"uKS"uًCPV"uπ{"tCCPVt=u] E ^[ÐUS]Exvj,PNu hP3iEt EE M[F[USVWHu_]J EPEPEhP EEE"}t $?=*?.$}t)Phȏtj\EP+WSNp )!PEPCF΋t  u h؏EPC EPyE0EPEP\hEPkC j.EPaC th܏EP7C Z RPEP%C 8}t's{"t Ej"EPEC 2}7hď]Shu }uPu u u}$tTu h6 u36 Wh6z u36h60u h6E u36j 6}w}( ]hďEPhu}}wJ3ۃ}(}tPu [ u(h8u hďEP*hu3ۅt_3ۃ}tW}tPu uhu  uuu cj u  EPEP@u(3ۅt7}uPu n Vh8u Ã<_^[ÐUUE MMEE $UcUSVW8u E }EEEE܋EE3jVSlE؃jVSZEԃ uQuPhWu4 Ph@W uuWhWF S;p,_^[US] ;uhu(u hE0 u ahE0u CE05hS 5hSE[[ÐU EPu uÐU=t=EtP5hh`5hhCM EEM EU EPu ujIÐU=|h`jM ȨM ̨@ÐUSVW Kxe4}3|<}vWvWVvWVvWV}˅|}vWK}EE _^[USVWhu/E@EH}33|juE3;Pw D=WD;xw DDxw DDxw Dz;~;U:Xw D=G;~ED] Et;wE+ˋ<˃EP4t|w_;v33ǃ\_^[ÐUShSu|SC%=tBjE0jE0ut3 Ĕ[ÐUSVhPtn u.E8/tPQu nhPu 0E ƀ u u u E 0%E 0hSSj  hk8bu M Dž3ۉt C SDu S>É+ÍP+H#…v+PSQ D8/t,PPV VVPV VfVqu'VhhZhj { tt8 Vo)uh\SSj -^[à 5@ PhSSj USVWXhPu V؅t VtoCރXPSp%=hWSv|P=sIƄWVfkVh8hhj ShSSj SPh]utpPPP34XP}t3-XPh8SSj <Ĝ_^[à 5@ PhSSj 뾃 5@ PhSSj 뇐USVxuuu} 6t 6,6J6>hu h +QS6tZ6hhP^ EjdPQ9t!EuPu3 p^[ÐUSVWhV3=@hu؅=@Suu t SruE 33/C t,E0h̡V S3 _^[à h|؃ hj3ҐUSuAtVv.u'PhXSgSj LPh$SCSj h(PhSSj >3[à hߐU hu ¾thj|Pu'|t h製u`PQrPhhP־P/P訾PÐU3ÐUEt/t @u3UEt:t @u3UU 3t/uB uUÐUSVW ]ME ;thPQs.u{/u.u{/ttJE 8u8< u^uQSWh@+QuV覽 ] _^[USVW(u7]˅t,3/u t C/t;t/CAuuu3ۃ uý}h0E0臼u`h4>Pjh0E0M|EhP't\h,E0tCE8tl PKE8,h0PL E0C E0mEK~gÅ3|AE0WVcWVYWVOWVE}ͅ~uhV%Kh,u _^[ÐUSuh,uߺt4jhE0蔼th$E0;t(}3hEDP}[UE8/u3 PQUSuU Su uuE /t 3[ÐUSV utXE SJt^[ÃShh踸耻ݐUSVW}M t2t;:t /u. Read the description of the SQL command CLUSTER for details. --maintenance-db=DBNAME alternate maintenance database -W, --password force password prompt -w, --no-password never prompt for password -U, --username=USERNAME user name to connect as -p, --port=PORT database server port -h, --host=HOSTNAME database server host or socket directory Connection options: -?, --help show this help, then exit -V, --version output version information, then exit -v, --verbose write a lot of output -t, --table=TABLE cluster specific table only -q, --quiet don't write any messages -e, --echo show the commands being sent to the server -d, --dbname=DBNAME database to cluster -a, --all cluster all databases Options: %s [OPTION]... [DBNAME] %s clusters all previously clustered tables in a database. %s: clustering database "%s" SELECT datname FROM pg_database WHERE datallowconn ORDER BY 1;%s: clustering of database "%s" failed: %s%s: clustering of table "%s" in database "%s" failed: %s; VERBOSEPGUSERPGDATABASE%s: cannot cluster a specific table in all databases %s: cannot cluster all databases and a specific one at the same time %s: too many command-line arguments (first is "%s") Try "%s --help" for more information. h:p:U:wWeqd:at:vclusterdbpgscripts-9.2maintenance-dbtabledbnamequietechopasswordno-passwordusernameporthost%s Could not send cancel request: %sCancel request sent Please answer "%s" or "%s". ny%s (%s/%s) out of memory pg_strdup: cannot duplicate null pointer (internal error) %s: query was: %s %s: query failed: %stemplate1postgres%s: could not connect to database %s: %s%s: could not connect to database %s fallback_application_namedbnamepassworduserporthost%s: out of memory Password: %s (PostgreSQL) 9.2.0 -V--version-?--help%s: could not obtain information about current user: %s %s ALL %s IS CONNECTEXECUTETRIGGERout of on_exit_nicely slots %s: %s: [%s] Try "%s --help" for more information. %s: unrecognized section name: "%s" post-datadatapre-data; SECURITY LABEL FOR %s ON %sSELECT provider, label FROM pg_catalog.pg_shseclabel WHERE classoid = '%s'::pg_catalog.regclass AND objoid = %u%s ~ ) OR %s ~ (%s ~ ^(.*)$)$|*+?()[]{}.^$\\$.*^(WHERE AND LARGE OBJECTFOREIGN TABLEFOREIGN SERVERFOREIGN DATA WRAPPERTABLESPACETEMPORARYCREATESCHEMALANGUAGEFUNCTIONSFUNCTIONUPDATE,DELETEUPDATETRUNCATEDELETEREFERENCESINSERTUSAGESELECTSEQUENCESTABLESSEQUENCETABLEIN SCHEMA %s ALTER DEFAULT PRIVILEGES FOR ROLE %s %s%sRESET SESSION AUTHORIZATION; WITH GRANT OPTION; GROUP %sPUBLIC%s; GROUP %s; group PUBLIC; %sGRANT %s ON %s %s TO SET SESSION AUTHORIZATION %s; %sGRANT %s ON %s %s TO %s WITH GRANT OPTION; %sGRANT %s ON %s %s TO %s; ON %s %s FROM %s; %s%sGRANT CONNECT ON %s %s TO PUBLIC; DATABASE ON %s %s FROM PUBLIC; (%s)%sREVOKE ALL%d.%d.%dyesxmlsetrowrefoutoffnotkeyintforenddecdaycsvbitascanyandalladdxmlrootwrapperwithoutversionverbosevaryingvarcharunknowntrustedtriggerstoragesimilarsessionreturnsrestartreplicareplacereleasereindexrecheckprimaryprepareplacingpassingpartialoverlayoptionsnumericnotnullnothingnaturalmappingleadinginvokerintegerinsteadinheritindexeshandlergrantedforwardforeignextractexplainexecuteexcludediscarddisabledefinerdefaultdeclaredecimalcurrentcontentcommentcollateclustercatalogcascadebooleanbetweenanalyzeanalysecurrent_catalogcharacteristicszoneyearxmlserializexmlpixmlparsexmlforestxmlexistsxmlelementxmlconcatxmlattributeswriteworkwithwindowwhitespacewherewhenvolatileviewvariadicvaluesvaluevalidatorvalidatevalidvacuumusinguserupdateuntilunloggedunlistenuniqueunionunencrypteduncommittedunboundedtypestypetruncatetruetrimtreattransactiontrailingtotimestamptimethentexttemporarytemplatetemptablespacetablestablesystemsysidsymmetricsubstringstripstrictstdoutstdinstatisticsstatementstartstandalonestablesomesnapshotsmallintsimpleshowsharesetofsession_userserverserializablesequencessequenceselectsecuritysecondsearchscrollschemasavepointrulerowsrollbackrolerightrevokereturningrestrictresetrepeatablerenamerelativereferencesrecursivereassignrealreadrangequoteprocedureproceduralprivilegespriorpreservepreparedprecisionprecedingpositionplanspasswordpartitionparserownerownedoverlapsoverouterorderoroptionoperatoronlyonoidsoffsetofobjectnullsnullifnullnowaitnotifynonenonextncharnationalnamesnamemovemonthmodeminvalueminutemaxvaluematchlocklocationlocaltimestamplocaltimelocalloadlistenlimitlikelevelleftleastleakprooflc_ctypelc_collatelastlargelanguagelabeljoinisolationisnullisintointervalintersectinsertinsensitiveinputinoutinnerinlineinitiallyinheritsindexincrementincludinginimplicitimmutableimmediateilikeifidentityhourholdheaderhavinggroupgreatestgrantglobalfunctionsfunctionfullfromfreezeforcefollowingfloatfirstfetchfamilyfalseexternalextensionexistsexclusiveexcludingexceptescapeenumencryptedencodingenableelseeachdropdoubledomaindocumentdodistinctdictionarydescdelimitersdelimiterdeletedeferreddeferrabledefaultsdeallocatedatabasedatacyclecursorcurrent_usercurrent_timestampcurrent_timecurrent_schemacurrent_rolecurrent_datecrosscreatecostcopyconversioncontinueconstraintsconstraintconnectionconfigurationconcurrentlycommittedcommitcommentscolumncollationcoalescecloseclasscheckpointcheckcharactercharchaincastcasecascadedcalledcachebybothbinarybigintbeginbeforebackwardauthorizationattributeatasymmetricassignmentassertionasarrayalwaysalteralsoaggregateafteradminactionaccessabsoluteabort"%s" -VPGSYSCONFDIR=%sPGSYSCONFDIRpostgres-9.2child process exited with unrecognized status %dchild process was terminated by signal %dchild process exited with exit code %dpclose failedfgets failureno data was returned by command "%s" popen failurer/%s%scould not read symbolic link "%s"could not change directory to "%s"could not find a "%s" to executecould not read binary "%s"PATHinvalid binary "%s"could not identify current directory: %s..//../usr/local/share/man/usr/local/share/doc//postgresql/usr/local/share/locale/usr/local/lib/postgresql/usr/local/lib/usr/local/include/postgresql/server/usr/local/include/postgresql/usr/local/include/usr/local/etc/postgresql/usr/local/bin/usr/local/share/postgresql%s: out of memory /../..././%s%s wr/dev/ttyUnknown error'''''''((&(6(F(V(f(v((((((((())&)6)F)V)f)v)))))))))**&*6*F*V*f*v*********++&+6+F+V+f+v+++++++++,,&,6,F,V,f,v,,t             & 5 ( x x? ?  ]  ``@ ``(#`ooT!o%$`o``>p,hpUwԋW̋eċqdlatvT!!(# $ % ' , xxxhp ;A  =PV amxx`4 1v 2h mاxx`=@ =- =| mxx".8K  ;W KtX\ RgȨmxx{mxxmxya ,e) Ph mxxs6 rs 4oe o mxxmxx!mxx+mxx4J !I R<_ \(d +jm *(u l@ *q 5Y ^ Hx) k +`)4BP ByThA jq w ]% `+|< r #;n =(k A_B R`+ d@*uC& 0)0+(+) k ),*QT_e `,rp u !++x1 ,80,<j B'Np)[ yj  h> 5 )q xP,)@,uD t X @(/ 9 J Hs X *_ DDr p _! '~ nN ' J ( `> i + 0i ,  p+  +% - * )3 ,; p*N : ] *p +w ) * P* ( p,( ut @+ clusterdbcrti.scrt1.ocrt1.s__get_exit_frame_monitor_ptr__do_exit_code_ptrfsr.strap_tablevalues-Xa.cDdata.dataBbss.bssDrodata.rodataclusterdb.chelpcluster_one_databasecluster_all_databasesTtdata.dataTtbss.bsscommon.cSetCancelConnResetCancelConncancelConnhandle_sigintdumputils.cparseAclItemcopyAclUserNameAddAclon_exit_nicely_indexon_exit_nicely_listkwlookup.ckeywords.cexec.cvalidate_execresolve_symlinkspipe_read_linepath.ctrim_trailing_separatortrim_directorydir_strcmpmake_relative_pathpgstrcasecmp.csprompt.cthread.ccrtn.s_END__START___ctypevwrite_msggeteuidchdirpath_contains_parent_referenceabortPQconnectdbParamspg_ascii_tolowerappendStringLiteralConnlstat64get_locale_pathget_user_nameset_dump_sectionget_prognamepqStrerrorcanonicalize_pathsnprintfparse_versionNumFEScanKeywordsappendStringLiteralDQget_man_pathget_includeserver_pathpg_toupperstrlenpg_strdupgetcwd_GLOBAL_OFFSET_TABLE__edata__environ_lockpg_tolowervfprintf__iobexecuteQuerygetpwuid_environstrerrorPQgetvalueappendPQExpBufferCharemitShSecLabelsstrncpyget_pkginclude_pathgetenvget_html_path_finiPQserverVersionstrcpyappendStringLiteral__fpstart__fsrpclosePQntuplesconnectDatabaseget_etc_pathpqGetpwuidfind_my_execget_include_path_get_exit_frame_monitortermPQExpBufferon_exit_nicelyfirst_path_var_separatorget_lib_pathpath_is_relative_and_below_cwdcreatePQExpBuffer_etextget_share_pathstrncmp_exitinitPQExpBufferPQconnectionNeedsPasswordstrlcpyPQfinishquote_all_identifiersstrstrlast_dir_separator_PROCEDURE_LINKAGE_TABLE_PQstatusappendByteaLiteral_DYNAMICmallocerrnoget_pkglib_pathPQresultStatushas_drive_prefixfind_other_execstrchrPQmblensetup_cancel_handlerbuildShSecLabelQuerypopenyesno_promptget_parent_directoryexecuteMaintenanceCommandjoin_path_componentsScanKeywordLookupPQclientEncodingparsePGArrayPQexecfflushfputcappendPQExpBufferStrmake_native_pathfreefcloseaccessstrerror_r__longdouble_usedget_home_path_end__fsr_init_valuepg_ascii_touppersetlocale_initfilenotcgetattrgetopt_longPQfreeCancel__1cG__CrunMdo_exit_code6F_v_first_dir_separatorfmtIdhandle_help_version_optsPQgetCancelget_doc_path_lib_versionfputsresetPQExpBuffertcsetattr___Argvpg_strncasecmpprocessSQLNamePatternPQerrorMessageconnectMaintenanceDatabasepg_strcasecmpsscanfbuildACLCommandsexit_horriblypath_is_prefix_of_pathatexitbuildDefaultACLCommandsappendPQExpBufferinit_parallel_dump_utilsset_pglocale_pgserviceperrorpclose_check_startfgetsoptargstrcatmainPQcancelfopen64destroyPQExpBufferexecuteCommandenlargePQExpBufferputenvpqsignalprintfPQExpBufferPQescapeStringConnPQclear__posix_getpwuid_rsimple_promptreadlinkoptindanotate anotate0 ,(,,x)-anotate-$1v2h`4-0.0TrBrrrrrrrrrrr&9rrhrrrrrrr^0rrrK 0 [4x5anotate0 ,(-`4.00.0.0.1.1.1. 1.1.1.1.1. 1.$1.(1.,1.01.41.81.<1.@1.D1.H1.L1.P1.T1.X1.\1.`1.d1.h1.l1.p1.t1.x1.|1.anotate55Y56@9T::;n<j|<`=@=-=|L>\6 6D;anotate S>=anotateP`>N"`>h>d?l@hA$BBPC&DDrJ8K WtX\X]%]^<_T_e_!_B$`S`\`f`p`` [ABX].__`anotate anotate`+ `+anotatedaTa`b,e)XgPh0iianotate anotatepjPjj j k  k(kkmdn(nNnV4oeopppqBCFHMQRSUVY[^`b %1,]  <( BKR486 j7s yX4e 4 IXh) H!"6 M!x;xCJ@IP4Ffw6 X@6 h8M7 H/  { 6 0  2:) K@I=3N THZxi@7p w. ~83( Mh4V 0  M 7 <;6 $H,`6 C ]exX 6 HG$0  L0 t;H(}  ;0  H6J8S/ dk2Fr|l8t D0 2 (Mh5 X;  (7 #*H<C6 vacuumlocrti.scrt1.ocrt1.sfsr.svalues-Xa.cvacuumlo.cusagegetopt.cpath.ctrim_trailing_separatortrim_directorydir_strcmpmake_relative_pathsprompt.cthread.ccrtn.s_edataPQfinishstrtoulmainPQresultStatusfputs_environ_get_exit_frame_monitorget_pkglib_pathfprintf_endPQconnectionNeedsPasswordfopen64strtol__iob_GLOBAL_OFFSET_TABLE___fsr_init_valueget_locale_pathPQsetdbLoginget_pkginclude_pathstrlcpymallocatexitoptargget_parent_directorystrlenPQfreememstrcpyfirst_dir_separator__fsrget_doc_pathfirst_path_var_separatorpqStrerrorpath_is_prefix_of_pathabortPQerrorMessageget_home_pathgetoptstrstrtcsetattrpath_is_relative_and_below_cwd__fpstartfgetsopterrfflushget_prognamecanonicalize_pathoptoptstrdupget_man_pathPQgetvalue_initget_etc_path___Argvget_includeserver_path_PROCEDURE_LINKAGE_TABLE_PQclear__posix_getpwuid_rfclosegeteuidget_include_path__environ_lock_DYNAMIClast_dir_separatorPQntuplesjoin_path_components_lib_versionPQserverVersion_exitstrncmppqGetpwuid__1cG__CrunMdo_exit_code6F_v_PQtransactionStatussnprintfhas_drive_prefixfileno_etexttcgetattrstrerror_rsimple_promptmake_native_pathpath_contains_parent_referencePQescapeIdentifieroptindPQstatusstrcatget_share_pathlo_unlink_fini_startget_html_pathPQexec__longdouble_usedstrchrget_lib_pathlibc.so.1SUNW_1.22SUNW_1.19SUNW_1.1SYSVABI_1.3SUNWprivate_1.1libpq.so.5libxslt.so.1libxml2.so.2libpam.so.1libssl.so.0.9.8libcrypto.so.0.9.8libkrb5.so.3libcom_err.so.3libgss.so.1libz.solibreadline.so.6libtermcap.so.1libnsl.so.1libsocket.so.1libm.so.2/usr/local/lib:/usr/local/libPyZyd'= n7wqN Mr2 ;c14UiWDj>7CoJR(Lx&3tG:- h5^IqX$TSKv",AlEHL@IMMY M2M.@F,DF`HFLFHPFTFZXF \F`FFdFbhFlF;pF[tFGxFC|F5FFXFOFFF/F&F]FNF FJF3FFFdFFFIF)F%F>FF F=FQFSF*FF-FTF<F58F%p V9ƅhPCP+-=_}hBPh CPPV VhBPPIVN VIhtBP9h8BP%h BPhAPhAPhAPhAPhdAPhDAPPTVY V3jVd jVQjV7xt WVh AhPI W PWS PSV PVSWQPh@hPPS Pu eW\NF ;v6h@h`I[}S4 V^h@+S0 S+ƅh`@PP P_ 3ۅDž,u 3jW j jP~t/Ph0@hPI:hPI~(CNÅx;| …h @ P h@ P G;Dž oh @VAWF WAVu ~t^~uBu! Suh8?hPI .uSht?hPIuSh?hPI~uu!3uh$Dh`Io,_^[à Wh@h`I=S PhpCh`I!C5S닃P|Ch@h`I PhpCh`I_hx@h`If8 PhpCh`IEgY h?h`I PhpCh`I=DžBh?`ISVY PhpCSjWVHhD@`IS8 PhpCS=hx@`IV PhpCVS7h$A`IS] PhpCSnVGhB`IS7 PhpCSVAhB`IS PhpCSV;htC`ISa PhpCSrVK PuhCh`I* Uuh? uh>h>h>h@>h >h=h=h=hT=h,=h=wh<jh<]h<PEx<@USVWH} 7 33EȉM̉EԉEЉM؉ME]~lhp<whl<woh`<woh\<wTh0<WS)M 9ƃ=$ - 5MvMԉj j5Mg MH= Q9MЉEE 5MMȉjj j5MM}LM܉M؉6Vh<h`Ij jEh0<WSE9Mn=M3;HMċU 4+;~33ۃE3ۃEP6؃EPve؃EPvI؃EPv -؃;}~;}$EP6؃G;}~܋Ã<_^[à V9jv h@<vjQVh;h`Ij MVh;h`Ij^hhx;`IW Vh<Wj(Z$+:+:+:+:++:+:+:+:+:+:+:+:+:+:+:+:+:+:+:+:+:+:+:+:+:+*:+*:+:+:+:+:+:+:+:+:+:+:+:+:+:+:+:+D*:+:+:+*:+*:+_*:+:+:+:+:+1+*USI8tM<M;UE 9-AYu-u yTH I M:Puyx:t#MI8M MI8ueA M9MLI|DE8:t.=Mt5 MhXDh`I?:E MMITDA M MM= M-tEI8uBM=Mt#E8:t5 MhDh`I?9ID(BMIDID[ÐU3ÐUEt/t @u3UEt:t @u3UU 3t/uB uUÐUSVW ]ME ;thPQ.u{/u.u{/ttJE 8uEF ubuUSWhF+QuVZ ] _^[USVW(u7]˅t,3/u t C/t;t/CAuuu3ۃ u}hEE0Ku`hE>P.hEE0|EhDPt\hEE0tCE8tl PKE8,hEP E0C E0mEK~gÅ3|AE0DWVGWV=WV3WV)}ͅ~uhDV KhEu_^[ÐUSuhEut4jhDE0thEE0t(}3hDEDPA[UE8/u3 PQUSuY Su uXuE /t 3[ÐUSV utXE St^[ÃShEh`ILݐUSVW}M t2t;:t /u. -W force password prompt -w never prompt for password -U USERNAME user name to connect as -p PORT database server port -h HOSTNAME database server host or socket directory Connection options: -?, --help show this help, then exit -V, --version output version information, then exit -v write a lot of progress messages -n don't remove large objects, just show what would be done -l LIMIT commit after removing each LIMIT large objects Options: Usage: %s [OPTION]... DBNAME... %s removes unreferenced large objects from databases. Removal from database "%s" failed at object %ld of %ld. Successfully removed %ld large objects from database "%s". Would remove %ld large objects from database "%s". Failed to commit transaction: commit Failed to remove lo %u: Removing lo %6u Failed to read temp table: SELECT lo FROM vacuum_lFailed to start transaction: beginFailed to check %s in table %s.%s: DELETE FROM vacuum_l WHERE lo IN (SELECT %s FROM %s.%s)Out of memory Checking %s in %s.%s Failed to find OID columns: AND s.nspname !~ '^pg_' AND c.relkind = 'r' AND t.typname in ('oid', 'lo') AND c.relnamespace = s.oid AND a.atttypid = t.oid AND a.attrelid = c.oid WHERE a.attnum > 0 AND NOT a.attisdropped FROM pg_class c, pg_attribute a, pg_namespace s, pg_type t SELECT s.nspname, c.relname, a.attname Failed to vacuum temp table: ANALYZE vacuum_lFailed to create temp table: SELECT DISTINCT loid AS lo FROM pg_largeobjectSELECT oid AS lo FROM pg_largeobject_metadataCREATE TEMP TABLE vacuum_l AS %sFailed to set search_path: SET search_path = pg_catalogTest run: no large objects will be removed! Connected to database "%s" Connection to database "%s" failed: %sConnection to database "%s" failed Password: option requires an argument -- %c illegal option -- %c ..//../usr/local/share/man/usr/local/share/doc//postgresql/usr/local/share/locale/usr/local/lib/postgresql/usr/local/lib/usr/local/include/postgresql/server/usr/local/include/postgresql/usr/local/include/usr/local/etc/postgresql/usr/local/bin/usr/local/share/postgresql%s: out of memory /../..././%s%s wr/dev/ttyUnknown errorG.>N^n~.>N^n~.>N^n~)9ETP <; X;^^  || `L````ocoXoX`o``>4FDL| X X    <;X;t;x;4FGHIII@I %M+ H<HOUH `lHw@It;,]  ( IlIw@It;IIlIw@It;I486 7s X4e 4 IlHw@It;I IlHw@It;IIlHw@It;I3I:CXKh) P_fH!n"6 Mxx@I`4F6 X@6 *2h98@MG7 \cHmt/  { 6 0  :) @I3N Hx@7p . 83( 0:@MGhN4V [0 m Mt{ 7 <;6 H`6  X  6 H)G2$0  EOL0 dt;qH( ;0  eH8/ 2F l8t D0 (2 G(ZMahjq5 X;  (7 H6 vacuumlocrti.scrt1.ocrt1.s__get_exit_frame_monitor_ptr__do_exit_code_ptrfsr.strap_tablevalues-Xa.cDdata.dataBbss.bssDrodata.rodatavacuumlo.cusageTtdata.dataTtbss.bssgetopt.cpath.ctrim_trailing_separatortrim_directorydir_strcmpmake_relative_pathsprompt.cthread.ccrtn.s_END__START__edataPQfinishstrtoulmainPQresultStatusfputs_environ_get_exit_frame_monitorget_pkglib_pathfprintf_endPQconnectionNeedsPasswordfopen64strtol__iob_GLOBAL_OFFSET_TABLE___fsr_init_valueget_locale_pathPQsetdbLoginget_pkginclude_pathstrlcpymallocatexitoptargget_parent_directorystrlenPQfreememstrcpyfirst_dir_separator__fsrget_doc_pathfirst_path_var_separatorpqStrerrorpath_is_prefix_of_pathabortPQerrorMessageget_home_pathgetoptstrstrtcsetattrpath_is_relative_and_below_cwd__fpstartfgetsopterrfflushget_prognamecanonicalize_pathoptoptstrdupget_man_pathPQgetvalue_initget_etc_path___Argvget_includeserver_path_PROCEDURE_LINKAGE_TABLE_PQclear__posix_getpwuid_rfclosegeteuidget_include_path__environ_lock_DYNAMIClast_dir_separatorPQntuplesjoin_path_components_lib_versionPQserverVersion_exitstrncmppqGetpwuid__1cG__CrunMdo_exit_code6F_v_PQtransactionStatussnprintfhas_drive_prefixfileno_etexttcgetattrstrerror_rsimple_promptmake_native_pathpath_contains_parent_referencePQescapeIdentifieroptindPQstatusstrcatget_share_pathlo_unlink_fini_startget_html_pathPQexec__longdouble_usedstrchrget_lib_pathanotate anotate0 ,((G6X;HHanotateX,,] (h) -=* -{_"m - c)anotate @* - -$+-:+-:+-:+-:+ -+$-:+(-:+,-:+0-:+4-:+8-:+<-:+@-:+D-:+H-:+L-:+P-:+T-:+X-:+\-:+`-:+d-:+h-:+l-:+p-:+t-:+x-*|-:+-*-:+-:+-:+-:+-:+-:+-:+-:+-:+-:+-:+-:+-:+-:+-:+-:+-D*-:+-:+-:+-*-:+-*-:+-_*-:+-:+-:+-:+-:+-1+.*anotate. .anotate anotatep/P// 0 $0 D0L0023(3N4VX4e456 6@6`666667 7@7p77s486 557anotate anotatel8t l8tanotate anotate(:\:) ;0%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.11 SunOS_i386 2010/08/13iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.11 SunOS_i386 2010/08/13iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.11 SunOS_i386 2010/08/13iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.11 SunOS_i386 2010/08/13iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.11 SunOS_i386 2010/08/13iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ld: Software Generation Utilities - Solaris Link Editors: 5.11-1.1726>vacuumlo.c /var/tmp/postgresql-9.2.0/contrib/vacuumlo /opt/SUNWspro/prod/bin/cc -Xa -v -O -I../../src/interfaces/libpq -I. -I. -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c vacuumlo.cXa;O;R=Sun C 5.11 SunOS_i386 2010/08/13;backend;raw;cd;DBG_GEN 5.3.0)getopt.c /var/tmp/postgresql-9.2.0/src/port /opt/SUNWspro/prod/bin/cc -Xa -v -O -I../../src/port -DFRONTEND -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c getopt.cXa;O;R=Sun C 5.11 SunOS_i386 2010/08/13;backend;raw;cd;DBG_GEN 5.3.0S%,path.c /var/tmp/postgresql-9.2.0/src/port /opt/SUNWspro/prod/bin/cc -Xa -v -O -I../../src/port -DFRONTEND -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c path.cXa;O;R=Sun C 5.11 SunOS_i386 2010/08/13;backend;raw;cd;DBG_GEN 5.3.0+Bsprompt.c /var/tmp/postgresql-9.2.0/src/port /opt/SUNWspro/prod/bin/cc -Xa -v -O -I../../src/port -DFRONTEND -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c sprompt.cXa;O;R=Sun C 5.11 SunOS_i386 2010/08/13;backend;raw;cd;DBG_GEN 5.3.0`Xthread.c /var/tmp/postgresql-9.2.0/src/port /opt/SUNWspro/prod/bin/cc -Xa -v -O -D_REENTRANT -D_THREAD_SAFE -D_POSIX_PTHREAD_SEMANTICS -I../../src/port -DFRONTEND -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c thread.cXa;O;R=Sun C 5.11 SunOS_i386 2010/08/13;backend;raw;cd;DBG_GEN 5.3.0-OI /var/tmp/postgresql-9.2.0/contrib/vacuumlovacuumlo.cE? /var/tmp/postgresql-9.2.0/src/portgetopt.cC= /var/tmp/postgresql-9.2.0/src/portpath.cF@ /var/tmp/postgresql-9.2.0/src/portsprompt.cE? /var/tmp/postgresql-9.2.0/src/portthread.c DD% DD% DD% DD% DD%.interp.SUNW_cap.hash.SUNW_ldynsym.dynsym.dynstr.SUNW_version.SUNW_versym.SUNW_dynsymsort.SUNW_reloc.rel.plt.text.init.fini.rodata.rodata1.got.dynamic.data.bssf.tdata.tbss.bss.symtab.strtab.annotate.comment.debug_info.debug_line.debug_abbrev.shstrtab o4oLL0' ||`/"  |7oXX`EoRoc XX0o B sx   ~<;<;X;X;t;t;x;x; 4F4FGGHHTIIIIII@I@I@I T ToZ`$u+ O{v |n  3}0707010001f5d1000081ed000000000000000000000001504ffcae00011200000000b600010002ffffffffffffffff0000001c00000000root/usr/local/bin/createdbELF,4 4 (! 44ohL XX/usr/lib/ld.so.1 !"#$%&'()*+,-/045679:;<>?@ABCDEFGHJOPSVZ]^_`befghijklmnpqruvxyz|}  .1238=IKLMNQRTUWXY[\acdostw{~ %1<47 AJ=@ X=- h>| vK  $X X\ (b xe) h \s6 rs oe *o =LV_f@ g@ !n(v'_ *n \*(v *@ q 5Y !^ 6h?x) Jl \)eCP sHyA Hr q + ))*p$+'"@(: (5(? !G(P*[)q] *hq (r ' yl',+)? -{ *l+6@ |*(q !x0 ,b 9l,"QHq vPy` bl*up` ,k  q n( |)q L*'' l"(<+Dl(#@M*TLk  g(p\' > XpB (<(q g k 2(oV uB ))> ]% ,L+2r G< T;n ntk r,`B `+ )hC& ,( +<+*)lk (_e +*L, hrp H+T0Au R+\xb ,i,\<j s',)  k  > (6 <)r (y<, l),,$<\uD ,dt ;Y Q|(` : {s <*Dr `! |'nN 'K '>  Dj ' |+. |i ; , B \+H LO +V - [ L)d +l ,* D; ) + \) \( * L( \,# ( vt + Pcreatedbcrti.scrt1.ocrt1.sfsr.svalues-Xa.ccreatedb.chelpcommon.cSetCancelConnResetCancelConnhandle_sigintdumputils.cparseAclItemcopyAclUserNameAddAclkwlookup.ckeywords.cexec.cvalidate_execresolve_symlinkspipe_read_linepath.ctrim_trailing_separatortrim_directorydir_strcmpmake_relative_pathpgstrcasecmp.csprompt.cthread.ccrtn.s__ctypegeteuidpg_char_to_encodingvwrite_msgchdirpath_contains_parent_referenceabortPQconnectdbParamspg_ascii_tolowerlstat64appendStringLiteralConnget_locale_pathget_user_nameset_dump_sectionget_prognamepqStrerrorcanonicalize_pathsnprintfparse_versionNumFEScanKeywordsappendStringLiteralDQget_man_pathget_includeserver_pathpg_toupperpg_strdupstrlengetcwd_edata_GLOBAL_OFFSET_TABLE___environ_lockpg_tolowervfprintf__iobexecuteQuerygetpwuid_environstrerrorPQgetvalueappendPQExpBufferCharemitShSecLabelsstrncpyget_pkginclude_pathget_html_pathgetenv_fini__fpstartstrcpyPQserverVersionappendStringLiteral__fsrpcloseconnectDatabasePQntuplesget_etc_pathpqGetpwuidfind_my_exec_get_exit_frame_monitorget_include_pathtermPQExpBufferon_exit_nicelyfirst_path_var_separatorget_lib_pathpath_is_relative_and_below_cwdcreatePQExpBuffer_etextget_share_pathstrncmp_exitinitPQExpBufferquote_all_identifiersPQconnectionNeedsPasswordstrlcpyPQfinishstrstrlast_dir_separatorPQstatus_PROCEDURE_LINKAGE_TABLE__DYNAMICappendByteaLiteralmallocPQresultStatusget_pkglib_patherrnofind_other_exechas_drive_prefixstrchrPQmblensetup_cancel_handlerbuildShSecLabelQuerypopenget_parent_directoryyesno_promptexecuteMaintenanceCommandjoin_path_componentsScanKeywordLookupPQclientEncodingparsePGArrayPQexecfflushfputcappendPQExpBufferStrmake_native_pathfreefcloseaccessstrerror_rget_home_path__longdouble_used_end__fsr_init_valuepg_ascii_touppersetlocale_initfilenotcgetattrgetopt_longPQfreeCancel__1cG__CrunMdo_exit_code6F_v_first_dir_separatorfmtIdhandle_help_version_optsPQgetCancelget_doc_path_lib_versionfputsresetPQExpBuffertcsetattr___Argvpg_strncasecmpprocessSQLNamePatternPQerrorMessageconnectMaintenanceDatabasepg_strcasecmpsscanfbuildACLCommandsexit_horriblypath_is_prefix_of_pathatexitbuildDefaultACLCommandsappendPQExpBufferinit_parallel_dump_utilsset_pglocale_pgserviceperrorpclose_check_startfgetsoptargstrcatmainPQcancelfopen64destroyPQExpBufferexecuteCommandenlargePQExpBufferputenvpqsignalprintfPQExpBufferPQescapeStringConnPQclear__posix_getpwuid_rsimple_promptreadlinkoptindlibc.so.1SUNW_1.22SUNW_1.19SUNW_1.1SUNW_0.7SYSVABI_1.3SUNWprivate_1.1libpq.so.5libxslt.so.1libxml2.so.2libpam.so.1libssl.so.0.9.8libcrypto.so.0.9.8libkrb5.so.3libcom_err.so.3libgss.so.1libz.solibreadline.so.6libtermcap.so.1libnsl.so.1libsocket.so.1libm.so.2/usr/local/lib:/usr/local/lib y y# '= - (= 6 7? qN K rT.WC S,6u4J/%`[z{ap2'c|fY]L8bx-M7}*1ZO5^>tF?0jBy"DL@"PY@0 H$(!,0.4I8<@$DkHWLPTMX\`%d'hVl pqtQxK|Do)_^2iOĦȦ̦GЦԦ?ئ8ܦ(5 t+nl1m b6{ $L(, 048s<}@~DHLuPT<5 %%h%h%h% h%$h %(h(%,h0%0h8p%4h@`%8hHP%<hP@%@hX0%Dh` %Hhh%Lhp%Phx%Th%Xh%\h%`h%dh%hh%lh%php%th`%xhP%|h@%h0%h %h%h%h%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%Ħh` %Ȧhh%̦hp%Цhx%Ԧh%ئh%ܦh%h%h%h%h%hp%h`%hP%h@%h0%h %h% h%h%h%h%h% h%$h %(h(%,h0%0h8p%4h@`%8hHP%<hP@%@hX0%Dh` %Hhh%Lhp%Phx%ThjjRXth y@tDt PE u T RU <RP~KPvjURQt`|$уL D$td$у`tƒ 3fd$f T$tfd$f L$l$YZ]ÐUSVWh] 3AEЃh3<h4hS}W]EPhph،u W 33EEEEEEEEEEEFM EEEEEEEEE3u 5Lu LEu LE3wu$3LELEyLEoLEeLE[EREIE@LE6LE,LE"uhh`nj$ EPhph،SW9  ]ȋẺEMP3+Et#uM <M h̉1h$hLh hĈh|h@hhhhXh hhht{h4nhaEQUS P؅t[à 5Puhh`j\ŐUS}~_h] stKhst4h|st=hxst&[à 38PUj묃uh`RE[USVW,E jj*"8E G0EFG(EFG 3F GMMNGMMNGFjVW;W@V7 S3E< S'+jjdhT2>MMM MԋMM؋MM܋MMЉE jjia8EԉG0E؉FG(E܉FG EF GEЉFGEF3GFjVW/W4V+  S'u; S&t+}u% S jjdhT#=E Et P Su}  S-3؋Ã,_^[Ãuh@h`Wj uuhЎh`0juh@h` jxuuhЎh`j SPuuhh`jd&USEtjuuuuu P Mju]Suuu ht u'jE0SE0E0E 0hI [USV}tu hau u`؅t S^u^[à E0Puht`VE 0uh`VE09j?뤐USV}tu hu u؅t Su ]^[ E0Puht`VE 0uh`VE0j럐USV}tu h uu u t Và V3^[ÐUS]t S؅t)Ã[Ãh$h`&jŃhh`j붐USVWhhuhhP%jjP9hVtkSVt@ V SWh jjP8WVt믃 VW3 VG _^[ÐU`E3`}t E0X uZ`U`E3`}t E0ÐUS=`tThP5`uPhh`Mhȍh`6[Uh>jUÐUSVdt S ؉d=lunUHv_u[tȍqv Ѓ v<_u@Bu5HyhPyu!t@uE0S<Sj"S<ut-<"uj"S PS FuӃj"S^[ÐUSVW8u u EPuEMA 'CMMMMu<'t <\u }uCCFAuV3҅~(΋Ӊ]uԋڋ3ҋM t } FCB;|;| u!Mq t1+ʍ<;s  CB;|'CE+CX,_^[ÐUSu j\u ti u=8|T]UJv| tj RjE3zE0jPE 03of]PuctLj'E0-jSE 0EAPu M AE 'M[[ÐUSVW j$WEt PW7u )t1E 03ۃ=yPWC7Vuփj$Wf7uIu u;7u.} _^[USVW u ]]Pu*tvEP<'O}uD\O\AxASv3Y>F,y,y Jхw'@M+@A _^[ÐUSVW(}W]SuVhPu |t3kd kd_^[USVW 3ɋu E u$؃E8{|} QWO3}t~ }tM,tHtg"t BC,zJ"ttH\uGt7 GC"uW }t,uC ,uB F}u3(3$3 3zu E0 333 _^[ÐUSVWL] u=t;u3ۃEPEPE0uEt P3EzsEkEcE[Euh@uE tPh8uuuh uM H9}ChE0υu& E0E0E0huH ύE8EGEčEEȍEE̍E EЍEE3ME uuVuuuuuȍE48[0~EtShV Exvu$~ExSE0xuS6ft@~wExEx126S/,EE}}hԏE0hԏE0uh@uEЅtPh8u E0=Puuhԓun Exv/ E0 PuuȋE0uhu6 Ex( E0 PuuȋE0uhu ~ 6 PhhuExuuȋE0uhPu E܃xt{ h<6 Ph<E0t# E0 Ph(uND h<MP Ph0uhDuExuuȋE0uhPu E܃xt{ h<q Ph<E0t# E0R PhuD h<'MP! PhuXh uChu0~v)t6S(thܒuE@E؍M;}u؋u}uRtNuh@VE tPh8V SXPuuhԓV uuuu76hԒu$HVoWfu E 03]L_^[ÐUSVn u PhVE t Pw PhVuu6E0uujh"V^[ÐUSVW(uw\ Vuv 8=4 xj/Wt+@Pu E 8t! V3 u g u$Yu(Nhu hE 0h|E 0hpE 0hE 0j%hE 0MhE 00vhE 0hE 08hԑE 0hE 0hE 0hE 0hE 0eY jrWtOx*t#uhhE$0 3E/uhhE(0 E E3ۃjwWtIx*tE$uh00w 3 uh0E(0X EE3jrWLtUx*t&uhhE$0 3EuhhE(0 EkE3]jUWtUx*t&uh`E$0 3Euh`E(0s EE3jUWbtUx*t&uh`E$0$ 3Euh`E(0EE3sjCWtUx*t&uhE$03E5uhE(0E E3jCWxtOx*t#uhE$0:3E/uhE(0E E3ۃjcWtCx*tE$uh03*uhE(0E E3ۃjTWtIx*tE$uh0r3uhE(0SEE3jCWGtOx*t#uhE$0 3E/uhE(0E E3ۃjUWtIx*tE$uh`03,uh`E(0EE3jUWttUx*t&uh`E$063Euh`E(0EE3jXWtUx*t&uhE$03EGuhE(0EE3jrWtOx*t#uhhE$0L3E/uhhE(0)E E3ۃhE 0IthpE 00umjUWtCx*tE$uh`03*uh`E(0E E3ہ}8ojaWtCx*tE$uhX0C3*uhXE(0'E E3ۋEE=8hE 0;hpE 0jwWtIx*tE$uh 03'uh E(0{EE3jxWotCx*tE$uhL013*uhLE(0E E3ۋE.jdWEtCx*tE$uhD03*uhDE(0E E3ۃjtWtGx*tE$M1h0e3,E0hE(0GE E3ہ}:|bjDW:tGx*tE$M1h803,E0h8E(0E E3ۃjwWtCx*tE$uh003*uh0E(0~E E3ۄۍ]$uA}tw E(0hԏ3EtQPh83b< 3hԏE(0EtPh8E(0$ V V33_^[LE6USV] u5tt=toM1<"uIC"u{"u7tS<"uKS"uًCPV"uπ{"tCCPVt=u] E ^[ÐUS]Exvj,Pu h3 Et EE 8M[[USVWHu]J EPEPEhxP& EEE"}t $?A=*?.$}t)Ph`tj\EPWSp )!PEPeCF΋t  u hpEP!C EPE0EPEPhxEPC j.EPC thtEPC Z RPEPC 8}t's{"t Ej"EPfEC 2}7h\]S!hTu }u|Pu u }$tTu hL69 u36 Wh86 u36h460u h,6 u36j 6j}w}( ]h\EP/hTu}}wJ3ۃ}(}t|Pu u(hЏu (h\EPhTu 3ۅt_3ۃ}tW}t|Pu [ uh,u uuu cj u : EPEP@u(3ۅt7}u|Pu VhЏu 8Ã<_^[ÐUUE MMEE UUSVW8u oE }EEEE܋EE3jVSLE؃jVS:Eԃ uQuPhWu4 Ph؏Wm uuWhWPF S;p,_^[US] ;uhuu hE0u ah|E0u CE05hhT`Se 5hh,SQE[[ÐU EPu uÐU=ht=EtP5hh h`5hhh`M EEM E`U EPu ujIÐU=|hjM ňM Ō@ÐUSVW Kxe4ŀ}3|<}vWvWVvWVvWV}˅|}vWK}EE _^[USVWhuE@EH}33|juE3;Pw D=WD;xw DDxw DDxw Dz;~;U:Xw D=G;~ED] Et;wE+ˋ<˃EP4t|w_;v33ǃ\_^[ÐUShSuk|SC%=tBjE0OjE0>ut3 Ĕ[ÐUSVhPn u.E8/tPQu nhPu E ƀ u u u E 0%E 0h<`SISj n h4Dk8bu M Dž3ۉt C SDu SÉ+ÍP+H#…v+PSQD8/t,PPV VVPV VfVqu'Vhh`h`j  tt8 Vo)uh`SSj ^[à 5] PhP`SYSj ~USVWXhP7u V؅t V5toCރXPS(p%=hWS|P=sIƄWVkVhУh`kh`j Sh`S;Sj `SPh]utpPPP34XP t3-XPhУ`SSj Ĝ_^[à 5k PhP`SgSj 뾃 54 PhP`S0Sj U뇐USVxuuu} 6t 6,66hu h+QS6tZ6hhP EjdPQ9t!EuP蓿u3 p^[ÐUSVWhP`V3=hut؅=Suu bt SruE 33/C t,E0hdV肾 S&3 _^[à hT؃ h 3ҐUSutVv.u'Ph`SSj LPh`SӽSj (Ph`S詽Sj 3[à hD?ߐU hu 貽thjPu'|t hCu`PQrPhhPFP/PPÐU3ÐUEt/t @u3UEt:t @u3UU 3t/uB uUÐUSVW ]ME ;thPQ.u{/u.u{/ttJE 8uХԥ uνuSWhإ+QuV ] _^[USVW(u7]˅t,3/u t C/t;t/CAuuu3ۃ u3}hȥE0wu`h̥>PZhȥE0=|EhPt\hĥE0tCE8tl PKE8,hȥPܽ E0C E0mEK~gÅ3|AE0|WVWVWVWV}ͅ~uh|VŽKhĥu譽_^[ÐUSu聻hĥuϹt4jh|E0thE0諻t(}3hEDPm[UE8/u3 PQUSuź Su uTuE /t 3[ÐUSV utXE S躹t^[ÃShh`HݐUSVW}M t2t;:t /u. By default, a database with the same name as the current user is created. --maintenance-db=DBNAME alternate maintenance database -W, --password force password prompt -w, --no-password never prompt for password -U, --username=USERNAME user name to connect as -p, --port=PORT database server port -h, --host=HOSTNAME database server host or socket directory Connection options: -?, --help show this help, then exit -V, --version output version information, then exit -T, --template=TEMPLATE template database to copy -O, --owner=OWNER database user to own the new database --lc-ctype=LOCALE LC_CTYPE setting for the database --lc-collate=LOCALE LC_COLLATE setting for the database -l, --locale=LOCALE locale settings for the database -E, --encoding=ENCODING encoding for the database -e, --echo show the commands being sent to the server -D, --tablespace=TABLESPACE default tablespace for the database Options: %s [OPTION]... [DBNAME] [DESCRIPTION] %s creates a PostgreSQL database. %s: comment creation failed (database was created): %sCOMMENT ON DATABASE %s IS %s: database creation failed: %s%stemplate1postgres; LC_CTYPE '%s' LC_COLLATE '%s' TEMPLATE %s ENCODING '%s' TABLESPACE %s OWNER %sCREATE DATABASE %sPGUSERPGDATABASE%s: "%s" is not a valid encoding name %s: only one of --locale and --lc-collate can be specified %s: only one of --locale and --lc-ctype can be specified %s: too many command-line arguments (first is "%s") Try "%s --help" for more information. h:p:U:wWeO:D:T:E:l:createdbpgscripts-9.2maintenance-dblocalelc-ctypelc-collateencodingtemplatetablespaceownerechopasswordno-passwordusernameporthost%s Could not send cancel request: %sCancel request sent Please answer "%s" or "%s". ny%s (%s/%s) out of memory pg_strdup: cannot duplicate null pointer (internal error) %s: query was: %s %s: query failed: %stemplate1postgres%s: could not connect to database %s: %s%s: could not connect to database %s fallback_application_namedbnamepassworduserporthost%s: out of memory Password: %s (PostgreSQL) 9.2.0 -V--version-?--help%s: could not obtain information about current user: %s %s ALL %s IS CONNECTEXECUTETRIGGERout of on_exit_nicely slots %s: %s: [%s] Try "%s --help" for more information. %s: unrecognized section name: "%s" post-datadatapre-data; SECURITY LABEL FOR %s ON %sSELECT provider, label FROM pg_catalog.pg_shseclabel WHERE classoid = '%s'::pg_catalog.regclass AND objoid = %u%s ~ ) OR %s ~ (%s ~ ^(.*)$)$|*+?()[]{}.^$\\$.*^(WHERE AND LARGE OBJECTFOREIGN TABLEFOREIGN SERVERFOREIGN DATA WRAPPERTABLESPACETEMPORARYCREATESCHEMALANGUAGEFUNCTIONSFUNCTIONUPDATE,DELETEUPDATETRUNCATEDELETEREFERENCESINSERTUSAGESELECTSEQUENCESTABLESSEQUENCETABLEIN SCHEMA %s ALTER DEFAULT PRIVILEGES FOR ROLE %s %s%sRESET SESSION AUTHORIZATION; WITH GRANT OPTION; GROUP %sPUBLIC%s; GROUP %s; group PUBLIC; %sGRANT %s ON %s %s TO SET SESSION AUTHORIZATION %s; %sGRANT %s ON %s %s TO %s WITH GRANT OPTION; %sGRANT %s ON %s %s TO %s; ON %s %s FROM %s; %s%sGRANT CONNECT ON %s %s TO PUBLIC; DATABASE ON %s %s FROM PUBLIC; (%s)%sREVOKE ALL%d.%d.%dyesxmlsetrowrefoutoffnotkeyintforenddecdaycsvbitascanyandalladdxmlrootwrapperwithoutversionverbosevaryingvarcharunknowntrustedtriggerstoragesimilarsessionreturnsrestartreplicareplacereleasereindexrecheckprimaryprepareplacingpassingpartialoverlayoptionsnumericnotnullnothingnaturalmappingleadinginvokerintegerinsteadinheritindexeshandlergrantedforwardforeignextractexplainexecuteexcludediscarddisabledefinerdefaultdeclaredecimalcurrentcontentcommentcollateclustercatalogcascadebooleanbetweenanalyzeanalysecurrent_catalogcharacteristicszoneyearxmlserializexmlpixmlparsexmlforestxmlexistsxmlelementxmlconcatxmlattributeswriteworkwithwindowwhitespacewherewhenvolatileviewvariadicvaluesvaluevalidatorvalidatevalidvacuumusinguserupdateuntilunloggedunlistenuniqueunionunencrypteduncommittedunboundedtypestypetruncatetruetrimtreattransactiontrailingtotimestamptimethentexttemporarytemplatetemptablespacetablestablesystemsysidsymmetricsubstringstripstrictstdoutstdinstatisticsstatementstartstandalonestablesomesnapshotsmallintsimpleshowsharesetofsession_userserverserializablesequencessequenceselectsecuritysecondsearchscrollschemasavepointrulerowsrollbackrolerightrevokereturningrestrictresetrepeatablerenamerelativereferencesrecursivereassignrealreadrangequoteprocedureproceduralprivilegespriorpreservepreparedprecisionprecedingpositionplanspasswordpartitionparserownerownedoverlapsoverouterorderoroptionoperatoronlyonoidsoffsetofobjectnullsnullifnullnowaitnotifynonenonextncharnationalnamesnamemovemonthmodeminvalueminutemaxvaluematchlocklocationlocaltimestamplocaltimelocalloadlistenlimitlikelevelleftleastleakprooflc_ctypelc_collatelastlargelanguagelabeljoinisolationisnullisintointervalintersectinsertinsensitiveinputinoutinnerinlineinitiallyinheritsindexincrementincludinginimplicitimmutableimmediateilikeifidentityhourholdheaderhavinggroupgreatestgrantglobalfunctionsfunctionfullfromfreezeforcefollowingfloatfirstfetchfamilyfalseexternalextensionexistsexclusiveexcludingexceptescapeenumencryptedencodingenableelseeachdropdoubledomaindocumentdodistinctdictionarydescdelimitersdelimiterdeletedeferreddeferrabledefaultsdeallocatedatabasedatacyclecursorcurrent_usercurrent_timestampcurrent_timecurrent_schemacurrent_rolecurrent_datecrosscreatecostcopyconversioncontinueconstraintsconstraintconnectionconfigurationconcurrentlycommittedcommitcommentscolumncollationcoalescecloseclasscheckpointcheckcharactercharchaincastcasecascadedcalledcachebybothbinarybigintbeginbeforebackwardauthorizationattributeatasymmetricassignmentassertionasarrayalwaysalteralsoaggregateafteradminactionaccessabsoluteabort"%s" -VPGSYSCONFDIR=%sPGSYSCONFDIRpostgres-9.2child process exited with unrecognized status %dchild process was terminated by signal %dchild process exited with exit code %dpclose failedfgets failureno data was returned by command "%s" popen failurer/%s%scould not read symbolic link "%s"could not change directory to "%s"could not find a "%s" to executecould not read binary "%s"PATHinvalid binary "%s"could not identify current directory: %s..//../usr/local/share/man/usr/local/share/doc//postgresql/usr/local/share/locale/usr/local/lib/postgresql/usr/local/lib/usr/local/include/postgresql/server/usr/local/include/postgresql/usr/local/include/usr/local/etc/postgresql/usr/local/bin/usr/local/share/postgresql%s: out of memory /../..././%s%s wr/dev/ttyUnknown errorXr'''''''''(("(2(B(R(b(r((((((((())")2)B)R)b)r)))))))))**"*2*B*R*b*r*********++"+2+B+R+b+r+++++++++,,",2,B,R,b,r,[ f s              x y& &  D  ``0 ``#`o7o,!o$$`o``>l,hpUxwlWde\OPDDT8E, l,!!# $ $ \' , x y(yX ppp T @<DOUL `l w(y47 plpw(yp=@ =- `>| pl`w(ypK  $X X\ p%:ldw,ypNpl w(ypYpl wHypdk(b yxe) h pl w(yp\s6 rs oe o pl w(yppl w(yppl w(yppl w(yp@ @ !$(,'A_ K*Qn p\*v(v *@ q 5Y ^ hx) l )CP )Hy;A QHr ^q x+ ))*p$+'@: (( !(*)'] 7*?hq S(r a'h ynl'x,+)? -{ *l+6@ |*(q x0 b l,"Hq ,Py` l*+p` 7,k  Pq ]n( ||)q L*''l(+l(@* Lk  (&\'  @XIpB \(c<(rq g k (oV uB ))> ]% L+r < ;n $tk (,`B 9`+ K)\hC& i,( +p<+w*})lk (@_e +*L,hrp HTu +x ,,\<j )'5,)B ` k  t> z(6 <)r (y<,l),,<u\uD dt Y  |( : 1 s ? <*F Dr W `! |'e nN | ' K ' > Dj |+ |i , \+ L + -  L) +" ,*5 D; D )W +^ \)g \(y * L( \, ( vt + Pcreatedbcrti.scrt1.ocrt1.s__get_exit_frame_monitor_ptr__do_exit_code_ptrfsr.strap_tablevalues-Xa.cDdata.dataBbss.bssDrodata.rodatacreatedb.chelpTtdata.dataTtbss.bsscommon.cSetCancelConnResetCancelConncancelConnhandle_sigintdumputils.cparseAclItemcopyAclUserNameAddAclon_exit_nicely_indexon_exit_nicely_listkwlookup.ckeywords.cexec.cvalidate_execresolve_symlinkspipe_read_linepath.ctrim_trailing_separatortrim_directorydir_strcmpmake_relative_pathpgstrcasecmp.csprompt.cthread.ccrtn.s_END__START___ctypegeteuidpg_char_to_encodingvwrite_msgchdirpath_contains_parent_referenceabortPQconnectdbParamspg_ascii_tolowerlstat64appendStringLiteralConnget_locale_pathget_user_nameset_dump_sectionget_prognamepqStrerrorcanonicalize_pathsnprintfparse_versionNumFEScanKeywordsappendStringLiteralDQget_man_pathget_includeserver_pathpg_toupperpg_strdupstrlengetcwd_edata_GLOBAL_OFFSET_TABLE___environ_lockpg_tolowervfprintf__iobexecuteQuerygetpwuid_environstrerrorPQgetvalueappendPQExpBufferCharemitShSecLabelsstrncpyget_pkginclude_pathget_html_pathgetenv_fini__fpstartstrcpyPQserverVersionappendStringLiteral__fsrpcloseconnectDatabasePQntuplesget_etc_pathpqGetpwuidfind_my_exec_get_exit_frame_monitorget_include_pathtermPQExpBufferon_exit_nicelyfirst_path_var_separatorget_lib_pathpath_is_relative_and_below_cwdcreatePQExpBuffer_etextget_share_pathstrncmp_exitinitPQExpBufferquote_all_identifiersPQconnectionNeedsPasswordstrlcpyPQfinishstrstrlast_dir_separatorPQstatus_PROCEDURE_LINKAGE_TABLE__DYNAMICappendByteaLiteralmallocPQresultStatusget_pkglib_patherrnofind_other_exechas_drive_prefixstrchrPQmblensetup_cancel_handlerbuildShSecLabelQuerypopenget_parent_directoryyesno_promptexecuteMaintenanceCommandjoin_path_componentsScanKeywordLookupPQclientEncodingparsePGArrayPQexecfflushfputcappendPQExpBufferStrmake_native_pathfreefcloseaccessstrerror_rget_home_path__longdouble_used_end__fsr_init_valuepg_ascii_touppersetlocale_initfilenotcgetattrgetopt_longPQfreeCancel__1cG__CrunMdo_exit_code6F_v_first_dir_separatorfmtIdhandle_help_version_optsPQgetCancelget_doc_path_lib_versionfputsresetPQExpBuffertcsetattr___Argvpg_strncasecmpprocessSQLNamePatternPQerrorMessageconnectMaintenanceDatabasepg_strcasecmpsscanfbuildACLCommandsexit_horriblypath_is_prefix_of_pathatexitbuildDefaultACLCommandsappendPQExpBufferinit_parallel_dump_utilsset_pglocale_pgserviceperrorpclose_check_startfgetsoptargstrcatmainPQcancelfopen64destroyPQExpBufferexecuteCommandenlargePQExpBufferputenvpqsignalprintfPQExpBufferPQescapeStringConnPQclear__posix_getpwuid_rsimple_promptreadlinkoptindanotate anotate0 ,(,X, y-@Danotate$-? 47-3.3(uuuuuuuuu2uuuuWuEuuuuuuuuuuuuu<uukuuuuuuauuuuuuN 3 5anotate -4.33.3.39/39/39/39/39/39/39/39/39/3.39/39/39/49/4.4/ 49/4 /49/49/49/ 49/$49/(49/,49/049/449/849/<49/@49/D49/H4/L49/P49/T4//X49/\49/`49/d4.h49/l49/p49/t4%/x49/|49/49/49/49/49/4/anotate55Y(66@ ::D;;n\<j<=@=->|>6 6;anotate >>anotateP>N">>?@ApBCPhC&DrKK $XX\Y]%]^__e`!,`Bp`````` AkBY]z_``anotate anotate`+ `+anotated(bT(bbxe)gh|iDjanotate anotatepkPk k ,k Lk lktklnn(nN(oVoeoq(qHqhqqqqqr(rHrhrprrs\s6 pqranotate anotateXsHsdt\uDuBuvanotate anotate vt vtanotate anotate(x\x)x0%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.11 SunOS_i386 2010/08/13iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.11 SunOS_i386 2010/08/13iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.11 SunOS_i386 2010/08/13iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.11 SunOS_i386 2010/08/13iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.11 SunOS_i386 2010/08/13iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.11 SunOS_i386 2010/08/13iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.11 SunOS_i386 2010/08/13iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.11 SunOS_i386 2010/08/13iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.11 SunOS_i386 2010/08/13iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.11 SunOS_i386 2010/08/13iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ld: Software Generation Utilities - Solaris Link Editors: 5.11-1.1726ncreatedb.c /var/tmp/postgresql-9.2.0/src/bin/scripts /opt/SUNWspro/prod/bin/cc -Xa -v -O -I../../../src/bin/pg_dump -I../../../src/bin/psql -I../../../src/interfaces/libpq -I../../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c createdb.cXa;O;R=Sun C 5.11 SunOS_i386 2010/08/13;backend;raw;cd;DBG_GEN 5.3.0jcommon.c /var/tmp/postgresql-9.2.0/src/bin/scripts /opt/SUNWspro/prod/bin/cc -Xa -v -O -I../../../src/bin/pg_dump -I../../../src/bin/psql -I../../../src/interfaces/libpq -I../../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c common.cXa;O;R=Sun C 5.11 SunOS_i386 2010/08/13;backend;raw;cd;DBG_GEN 5.3.0Rp,dumputils.c /var/tmp/postgresql-9.2.0/src/bin/scripts /opt/SUNWspro/prod/bin/cc -Xa -v -O -I../../../src/bin/pg_dump -I../../../src/bin/psql -I../../../src/interfaces/libpq -I../../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c dumputils.cXa;O;R=Sun C 5.11 SunOS_i386 2010/08/13;backend;raw;cd;DBG_GEN 5.3.0nBkwlookup.c /var/tmp/postgresql-9.2.0/src/bin/scripts /opt/SUNWspro/prod/bin/cc -Xa -v -O -I../../../src/bin/pg_dump -I../../../src/bin/psql -I../../../src/interfaces/libpq -I../../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c kwlookup.cXa;O;R=Sun C 5.11 SunOS_i386 2010/08/13;backend;raw;cd;DBG_GEN 5.3.0nXkeywords.c /var/tmp/postgresql-9.2.0/src/bin/scripts /opt/SUNWspro/prod/bin/cc -Xa -v -O -I../../../src/bin/pg_dump -I../../../src/bin/psql -I../../../src/interfaces/libpq -I../../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c keywords.cXa;O;R=Sun C 5.11 SunOS_i386 2010/08/13;backend;raw;cd;DBG_GEN 5.3.0G%nexec.c /var/tmp/postgresql-9.2.0/src/port /opt/SUNWspro/prod/bin/cc -Xa -v -O -I../../src/port -DFRONTEND -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c exec.cXa;O;R=Sun C 5.11 SunOS_i386 2010/08/13;backend;raw;cd;DBG_GEN 5.3.0%path.c /var/tmp/postgresql-9.2.0/src/port /opt/SUNWspro/prod/bin/cc -Xa -v -O -I../../src/port -DFRONTEND -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c path.cXa;O;R=Sun C 5.11 SunOS_i386 2010/08/13;backend;raw;cd;DBG_GEN 5.3.05pgstrcasecmp.c /var/tmp/postgresql-9.2.0/src/port /opt/SUNWspro/prod/bin/cc -Xa -v -O -I../../src/port -DFRONTEND -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c pgstrcasecmp.cXa;O;R=Sun C 5.11 SunOS_i386 2010/08/13;backend;raw;cd;DBG_GEN 5.3.0'+sprompt.c /var/tmp/postgresql-9.2.0/src/port /opt/SUNWspro/prod/bin/cc -Xa -v -O -I../../src/port -DFRONTEND -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c sprompt.cXa;O;R=Sun C 5.11 SunOS_i386 2010/08/13;backend;raw;cd;DBG_GEN 5.3.0v`thread.c /var/tmp/postgresql-9.2.0/src/port /opt/SUNWspro/prod/bin/cc -Xa -v -O -D_REENTRANT -D_THREAD_SAFE -D_POSIX_PTHREAD_SEMANTICS -I../../src/port -DFRONTEND -I../../src/include -I/usr/local/include -I/usr/local/include/libxml2 -I/usr/local/include -c thread.cXa;O;R=Sun C 5.11 SunOS_i386 2010/08/13;backend;raw;cd;DBG_GEN 5.3.0NH /var/tmp/postgresql-9.2.0/src/bin/scriptscreatedb.cLF /var/tmp/postgresql-9.2.0/src/bin/scriptscommon.cOI /var/tmp/postgresql-9.2.0/src/bin/scriptsdumputils.cNH /var/tmp/postgresql-9.2.0/src/bin/scriptskwlookup.cNH /var/tmp/postgresql-9.2.0/src/bin/scriptskeywords.cC= /var/tmp/postgresql-9.2.0/src/portexec.cC= /var/tmp/postgresql-9.2.0/src/portpath.cKE /var/tmp/postgresql-9.2.0/src/portpgstrcasecmp.cF@ /var/tmp/postgresql-9.2.0/src/portsprompt.cE? /var/tmp/postgresql-9.2.0/src/portthread.c DD% DD% DD% DD% DD% DD% DD% DD% DD% DD%.interp.SUNW_cap.hash.SUNW_ldynsym.dynsym.dynstr.SUNW_version.SUNW_versym.SUNW_dynsymsort.SUNW_reloc.rel.plt.text.init.fini.rodata.rodata1.got.dynamic.data.bssf.tdata.tbss.bss.symtab.strtab.annotate.comment.debug_info.debug_line.debug_abbrev.shstrtab oo ' 0 /"D 7o,!,!pEo!!fRo##c $$0o B$$ s\'\' x,,pL~xx y y(y(y V PXX  Ppppppp@p} ` o(j)V       0707010001f5d4000081ed000000000000000000000001504ffcae00010a18000000b600010002ffffffffffffffff0000001a00000000root/usr/local/bin/dropdbELF@,44 (! 44o^^``  /usr/lib/ld.so.1  !"#$%&'()*+,./345689:;=>?@ABCDEFGINORUY\]^_adefghijklmopqtuwxy{|~ -0127<HJKLMPQSTVWXZ[`bcnrsvz}#/8(1 =F9@ T4:- dd:| r~G  lT U\ p^ a) d o6 0os ke &0l 9HR[c@ !b@ k[ u$(}*dj *d(Lr = T*0n 2Y [ x't) 2\h D(M`?P [um= n m +D)(t*`|+' @6 '4('x!/D(84*C4)YDZ i*qm *pn Tu)*; 4',{ D*$+$*(3@ pm u0 ^ !m 2$,"^u` J*]\ itg  m j( )^Pm )d'' @(d+(|5)<g  O$' i(r> &xT(n 'Lg c pkV qB t)d): Z% +9 ' o <48n Vg Zt\B kD]+ })?& '***$)g t(+d*j[e ,np T),r :D+D8uJ+Q+8j [t'g(t Tg  : p2 (Pn pu+)+ qD p #dU 9(Hh6 co q)x@r P\! D' kN T'LG ': f  4+ e # @, * +0 L7 t+> L- C (L +T )g 7 v T) T+ ( ) ) ' ,' hrt * Pdropdbcrti.scrt1.ocrt1.sfsr.svalues-Xa.cdropdb.chelpcommon.cSetCancelConnResetCancelConnhandle_sigintdumputils.cparseAclItemcopyAclUserNameAddAclkwlookup.ckeywords.cexec.cvalidate_execresolve_symlinkspipe_read_linepath.ctrim_trailing_separatortrim_directorydir_strcmpmake_relative_pathpgstrcasecmp.csprompt.cthread.ccrtn.s__ctypevwrite_msggeteuidchdirpath_contains_parent_referenceabortPQconnectdbParamspg_ascii_tolowerappendStringLiteralConnlstat64get_locale_pathget_user_nameset_dump_sectionget_prognamepqStrerrorcanonicalize_pathsnprintfparse_versionNumFEScanKeywordsappendStringLiteralDQget_man_pathget_includeserver_pathpg_toupperstrlenpg_strdupgetcwd_GLOBAL_OFFSET_TABLE__edata__environ_lockpg_tolowervfprintf__iobexecuteQuerygetpwuid_environstrerrorPQgetvalueappendPQExpBufferCharemitShSecLabelsstrncpyget_pkginclude_pathgetenvget_html_path_finiPQserverVersionstrcpyappendStringLiteral__fpstart__fsrpclosePQntuplesconnectDatabaseget_etc_pathpqGetpwuidfind_my_execget_include_path_get_exit_frame_monitortermPQExpBufferon_exit_nicelyfirst_path_var_separatorget_lib_pathpath_is_relative_and_below_cwdcreatePQExpBuffer_etextget_share_pathstrncmp_exitinitPQExpBufferPQconnectionNeedsPasswordstrlcpyPQfinishquote_all_identifiersstrstrlast_dir_separator_PROCEDURE_LINKAGE_TABLE_PQstatusappendByteaLiteral_DYNAMICmallocerrnoget_pkglib_pathPQresultStatushas_drive_prefixfind_other_execstrchrPQmblensetup_cancel_handlerbuildShSecLabelQuerypopenyesno_promptget_parent_directoryexecuteMaintenanceCommandjoin_path_componentsScanKeywordLookupPQclientEncodingparsePGArrayPQexecfflushfputcappendPQExpBufferStrmake_native_pathfreefcloseaccessstrerror_r__longdouble_usedget_home_path_end__fsr_init_valuepg_ascii_touppersetlocale_initfilenotcgetattrgetopt_longPQfreeCancel__1cG__CrunMdo_exit_code6F_v_first_dir_separatorfmtIdhandle_help_version_optsPQgetCancelget_doc_path_lib_versionfputsresetPQExpBuffertcsetattr___Argvpg_strncasecmpprocessSQLNamePatternPQerrorMessageconnectMaintenanceDatabasepg_strcasecmpsscanfbuildACLCommandsexit_horriblypath_is_prefix_of_pathatexitbuildDefaultACLCommandsappendPQExpBufferinit_parallel_dump_utilsset_pglocale_pgserviceperrorpclose_check_startfgetsoptargstrcatmainPQcancelfopen64destroyPQExpBufferexecuteCommandenlargePQExpBufferputenvpqsignalprintfPQExpBufferPQescapeStringConnPQclear__posix_getpwuid_rsimple_promptreadlinkoptindlibc.so.1SUNW_1.22SUNW_1.19SUNW_1.1SUNW_0.7SYSVABI_1.3SUNWprivate_1.1libpq.so.5libxslt.so.1libxml2.so.2libpam.so.1libssl.so.0.9.8libcrypto.so.0.9.8libkrb5.so.3libcom_err.so.3libgss.so.1libz.solibreadline.so.6libtermcap.so.1libnsl.so.1libsocket.so.1libm.so.2/usr/local/lib:/usr/local/lib y y '=  (=  7' qN 3 pS-WB Q*5r3I.#_Zzy`o1&b{eX[K7aw,M6|)0YN4]<sE>/mAv!L@!PV@l2ptxG| #HjXL$&UpQğJȟ̟Пԟ؟ܟCn(^]/h NF $>(6,'044 8r<@*DmH,LPkTX0\l`adh5lpztxK|q|}t<5d%h%lh%ph%th%xh%|h %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h%h%h%h%h%ğh%ȟhp%̟h`%ПhP%ԟh@%؟h0%ܟh %h%h%h%h%h%h%h%h %h(%h0%h8p% h@`%hHP%hP@%hX0%h` % hh%$hp%(hx%,h%0h%4h%8h%<h%@h%Dh%Hhp%Lh`%PhP%Th@%Xh0%\h %`h%dh%hh%lh%ph%th%xh%|h %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hxjjRthTutt PExu TxRU RPHP~jURQt`|$у D$td$у`tƒ 3fd$f T$tfd$f L$l$YZ]ÐUSVWX] E3 >Eh39h(1h|S}WEPhТhpu W 33ۃEEEEM MM3Eu5Ls"wI$0E[EREIE@LE6LE,LE"uhHh`j EPhТhpSW T]̋EȉEE+PfPM .R.R.R.R.R.R.+.UuhYhLuh<h/h"hlh(h܃hhhDhh؂hhlh0EUS P ؅t[à 5Puhh`&jŐUS}~_h] s4tKhst4hԈst=hЈst&[à 38PUjG묃uhE[USVW,E jj*"E GEFGEFG t3F GlMMNGPMMNGFjVWWV SE< Sw+jjdh2>MMM MԋMM؋MM܋MMЉE jjiaEԉGE؉FGE܉FG tEF GlEЉFGPEF3GFjVWWV{  Swu; Svt+}u% S jjdh#=E Et P Su}  S}3؋Ã,_^[Ãuhh`juuh(h`jfuhh`j?xuuh(h`bj SPuuhh`.j&USEtjuuuuu P Mju]Suuu ht u'jE0SE0E0E 0hI [USV}tu hu u؅t Su^[à E0Puḣ`V,E 0uhVE0j뤐USV}tu hu u؅t Su ]^[ E0*Puḣ`VE 0uhVmE0j럐USV}tu hE uu uit Vbà V`3^[ÐUS]t S؅t)Ã[Ãh|h`j\Ńhlh`j;붐USVWhXh\uh`hPujjP9h\VbtkX\SVGt@ V SWh8 jjP8WV t믃 V3 V _^[ÐUpE3p}t E0 upUpE3p}t E0hÐUS=ptThP5pMuPhh`h h`[Uhd:jUÐUSVtt S ؉t=|unUHv_u[tȍqv Ѓ v<_u@Bu5uhuu!t@uE0SSj"Sut-<"uj"SpPS]FuӃj"SG^[ÐUSVW8u ;u EPu2EMA 'CMMMMu<'t <\u }uCCFAuV3҅~(΋Ӊ]uԋڋ3ҋM t } FCB;|;| u!Mq t1+ʍ<;s  CB;|'CE+CX,_^[ÐUSu 5j\u Vti uT=8|T]UJv| tj RjE3E0jPE 03of]PutLj'E0}jSE 0EAPu M AE 'M[@[ÐUSVW j$WEt PW7u yt1E 03ۃuPWC7VHuփj$W7uu u7u~} _^[ USVW u ]]PuztvEP<'O}uD\O\AxASv3Y>Ftutu Jхw'@M+@A _^[ÐUSVW(}W]SuVhuR |t3kd kd_^[USVW 3ɋu E ut؃E8{|} QOWO3}t~ }tM,tHtg"t BC,zJ"ttH\uGt7 GC"uW }t,uC ,uB F}u3(3$3 3zu E0 333 _^[ÐUSVWL] uU=t;u3ۃEPEPE0uEt PA3EEEEEuhu5E tPhuuuhxuM H9}ChlE0υu& E0E0E0hDu ύE8EGEčEEȍEE̍E EЍEE3ME uuVuuuuuȍE48[0~EtSh@VJExvu$~ExSE0uS6t@~wExEx126S,EE}}h,E0mh,E0Nuhu EЅtPhu E0=Puuh,u Exv/ E0 PuuȋE0uhu Ex( E0 PuuȋE0uhuj ~ 6 Phu=ExuuȋE0uhu E܃xt{ h PhE0#t# E0 PhuD h<MP PhuhuxExuuȋE0uhuJ E܃xt{ h PhE0^t# E0R Ph@uD hwMP! PhluhxuhTu~v)t6Sth4uqE@E؍M;}u؋u}uRtNuhV5E tPhV SXPuuh,V uuuu76h,u$VWu[E 0D3]L_^[ÐUSV u PhVBE t Pw PhV uu6E0uujh"V^[ÐUSVW(u\ Vuv 8=4 xj/Wdt+@Pu E 8t! V<3 u  u$u(hu Nh܋E 01hԋE 0hȋE 0hlE 0%h`E 0hTE 0vhLE 0hlE 0f8h,E 0IhE 0,hE 0hE 0hE 0Y jrWotOx*t#uhE$0 3E/uhE(0 E E3ۃjwWtIx*tE$uh0w 3 uhE(0X EE3jrWtUx*t&uhE$0 3EuhE(0 EkE3]jUW'tUx*t&uhE$0 3EuhE(0s EE3jUWtUx*t&uhE$0$ 3EuhE(0EE3sjCW=tUx*t&uhDE$03E5uhDE(0E E3jCWtOx*t#uhDE$0:3E/uhDE(0E E3ۃjcW^tCx*tE$uh803*uh8E(0E E3ۃjTWtIx*tE$uh80r3uh8E(0SEE3jCWtOx*t#uhDE$0 3E/uhDE(0E E3ۃjUW-tIx*tE$uh03,uhE(0EE3jUWtUx*t&uhE$063EuhE(0EE3jXWOtUx*t&uh@E$03EGuh@E(0EE3jrWtOx*t#uhE$0L3E/uhE(0)E E3ۃh܋E 0thȋE 0umjUW>tCx*tE$uh03*uhE(0E E3ہ}8ojaWtCx*tE$uh0C3*uhE(0'E E3ۋEE=8h܋E 0hȋE 0jwW(tIx*tE$uhx03'uhxE(0{EE3jxWtCx*tE$uh013*uhE(0E E3ۋE.jdWEStCx*tE$uh03*uhE(0E E3ۃjtWtGx*tE$M1hH0e3,E0hHE(0GE E3ہ}:|bjDWtGx*tE$M1h03,E0hE(0E E3ۃjwW(tCx*tE$uh03*uhE(0~E E3ۄۍ]$uA}tw E(0Kh,3EtQPh3< 3h,E(0EtPhE(0 VH V533_^[E6USV] utt=toM1<"uIC"u{"u7tS<"uKS"uًCPVh"uπ{"tCCPVFt=u] E ^[ÐUS]Exvj,Pu h@3yEt EE M[V[USVWHu]J EPEPEhЊPv EEE"}t $?A=*?.$}t)Ph@tj\EPWSp )!PEPCF΋t  u hȊEPqC EP9E0EPHEPhЊEP+C j.EP!C th̊EPC Z RPEPC 8}t's{"t Ej"EPEC 2}7h]Sqhu }uԊ܊Pu u 5}$tTu h6 u36 Wh6 u36h60u h6U u36j 6}w}( ]hEPhu}}wJ3ۃ}(}t܊ԊPu  u(h(u hEPhuz3ۅt_3ۃ}tW}t܊ԊPu uhu ( uuu cj u  EPVEPJ@u(3ۅt7}uԊ܊Pu . Vh(u Ã<_^[ÐUUE MMEE UsUSVW8u E }EEEE܋EE3jVSE؃jVSEԃ uQuPhWu4 Ph0W uuWhWF S#;p,_^[US] ;uhuu hE0ju ahԉE0Lu CE05xh`S 5xhSE[[ÐU EPu uÐU=xt=EtP5xhxh`p5xhph`SM EEM E`U EPu ujIÐU=|hPjM ňM Ō@ÐUSVW Kxe4ŀ}3|<}vWvWVvWVvWV}˅|}vWK}EE _^[USVWhuE@EH}33|juE3;Pw D=WD;xw DDxw DDxw Dz;~;U:Xw D=G;~ED] Et;wE+ˋ<˃EP4~t|w_;v33ǃ\_^[ÐUShSu|SC%=tBjE0jE0ut3 Ĕ[ÐUSVhPdn u.E8/tPQu nhPu E ƀ u u u E 0%E 0h`SSj  hk8bu M Dž3ۉt C SDu SÉ+ÍP+H#…v+PSQD8/t,PPV VVPV VfVqu'Vhph`jh`j k tt8 Vo)uhL`SSj ^[à 5 Ph`SSj USVWXhPu V؅t VtoCރXPSp%=hWSv|P=sIƄWVfkVh(h`h`j Sh`SSj SPh]uptpPPP34XP}t3-XPh(`S'Sj ,Ĝ_^[à 5 Ph`SSj 뾃 5 Ph`SSj 뇐USVxuuu} 6t 6,6 6hu h+QSN6tZ6h؛hP EjdPQ9t!EuPu3 p^[ÐUSVWhP`V3=hu؅=Suu t SruE 33/C t,E0hV S3 _^[à h؃ hz3ҐUSuQtVv.u'PhH`SwSj |LPh`SSSj X(Pht`S)Sj .3[à hߐU hu "thjPu'|t hu`PQrPhhPP/PhPÐU3ÐUEt/t @u3UEt:t @u3UU 3t/uB uUÐUSVW ]ME ;thPQ.u{/u.u{/ttJE 8u(, uuSWh0+QuVf ] _^[USVW(u7]˅t,3/u t C/t;t/CAuuu3ۃ u}h E0u`h$>Pʾh E0譾|Eh؝P臾t\hE0ntCE8tl PKE8,h PL E0C E0mEK~gÅ3|AE0ԝWVsWViWV_WVU}ͅ~uhԝV5Khu_^[ÐUSuѾhu?t4jhԝE0TthE0t(}3h؝EDPݼ[UE8/u3 PQUSu Su u贾uE /t 3[ÐUSV utXE S t^[ÃShh`Ȼ@ݐUSVW}M t2t;:t /uEtWP:W1VS>u S[~zD taVhhPt: hP~g uċDD D< u D}u8 VE 8QhTPPWh8RWI@t VW3ۋÁ_^[U uu utPE ÐUuuuu u E8t3UWVS[*[^_UWVS[*[^_0123456789abcdef_XXXXXXXЛěxth\PL@0$ ؏ܚԚ̚ЏĚȏtl`XL<, ؙЙ|ld\TH<0$xؘԘȘxphp\PhH`<0X( ܍PHܗЗė@8tph\PD@4( 0(ܖԖ ؍ȖԍxpdXLD<4,$ ܕԕȕxpldЍ\TLD<40̍( ؎ȍؔЎДȔȎ|pd\PD80(  čԓ̓xptld\TH@4(h`ԒȒ|Xtl`TLD<4( ԑȑPH|ph`@TH@80(  80( ܐАȐxl`TH@0( Usage: Report bugs to . --maintenance-db=DBNAME alternate maintenance database -W, --password force password prompt -w, --no-password never prompt for password -U, --username=USERNAME user name to connect as -p, --port=PORT database server port -h, --host=HOSTNAME database server host or socket directory Connection options: -?, --help show this help, then exit --if-exists don't report error if database doesn't exist -V, --version output version information, then exit -i, --interactive prompt before deleting anything -e, --echo show the commands being sent to the server Options: %s [OPTION]... DBNAME %s removes a PostgreSQL database. %s: database removal failed: %s%stemplate1postgresIF EXISTS DROP DATABASE %s%s; Are you sure?Database "%s" will be permanently removed. %s: too many command-line arguments (first is "%s") %s: missing required argument database name Try "%s --help" for more information. h:p:U:wWeidropdbpgscripts-9.2maintenance-dbif-existsinteractiveechopasswordno-passwordusernameporthost%s Could not send cancel request: %sCancel request sent Please answer "%s" or "%s". ny%s (%s/%s) out of memory pg_strdup: cannot duplicate null pointer (internal error) %s: query was: %s %s: query failed: %stemplate1postgres%s: could not connect to database %s: %s%s: could not connect to database %s fallback_application_namedbnamepassworduserporthost%s: out of memory Password: %s (PostgreSQL) 9.2.0 -V--version-?--help%s: could not obtain information about current user: %s %s ALL %s IS CONNECTEXECUTETRIGGERout of on_exit_nicely slots %s: %s: [%s] Try "%s --help" for more information. %s: unrecognized section name: "%s" post-datadatapre-data; SECURITY LABEL FOR %s ON %sSELECT provider, label FROM pg_catalog.pg_shseclabel WHERE classoid = '%s'::pg_catalog.regclass AND objoid = %u%s ~ ) OR %s ~ (%s ~ ^(.*)$)$|*+?()[]{}.^$\\$.*^(WHERE AND LARGE OBJECTFOREIGN TABLEFOREIGN SERVERFOREIGN DATA WRAPPERTABLESPACETEMPORARYCREATESCHEMALANGUAGEFUNCTIONSFUNCTIONUPDATE,DELETEUPDATETRUNCATEDELETEREFERENCESINSERTUSAGESELECTSEQUENCESTABLESSEQUENCETABLEIN SCHEMA %s ALTER DEFAULT PRIVILEGES FOR ROLE %s %s%sRESET SESSION AUTHORIZATION; WITH GRANT OPTION; GROUP %sPUBLIC%s; GROUP %s; group PUBLIC; %sGRANT %s ON %s %s TO SET SESSION AUTHORIZATION %s; %sGRANT %s ON %s %s TO %s WITH GRANT OPTION; %sGRANT %s ON %s %s TO %s; ON %s %s FROM %s; %s%sGRANT CONNECT ON %s %s TO PUBLIC; DATABASE ON %s %s FROM PUBLIC; (%s)%sREVOKE ALL%d.%d.%dyesxmlsetrowrefoutoffnotkeyintforenddecdaycsvbitascanyandalladdxmlrootwrapperwithoutversionverbosevaryingvarcharunknowntrustedtriggerstoragesimilarsessionreturnsrestartreplicareplacereleasereindexrecheckprimaryprepareplacingpassingpartialoverlayoptionsnumericnotnullnothingnaturalmappingleadinginvokerintegerinsteadinheritindexeshandlergrantedforwardforeignextractexplainexecuteexcludediscarddisabledefinerdefaultdeclaredecimalcurrentcontentcommentcollateclustercatalogcascadebooleanbetweenanalyzeanalysecurrent_catalogcharacteristicszoneyearxmlserializexmlpixmlparsexmlforestxmlexistsxmlelementxmlconcatxmlattributeswriteworkwithwindowwhitespacewherewhenvolatileviewvariadicvaluesvaluevalidatorvalidatevalidvacuumusinguserupdateuntilunloggedunlistenuniqueunionunencrypteduncommittedunboundedtypestypetruncatetruetrimtreattransactiontrailingtotimestamptimethentexttemporarytemplatetemptablespacetablestablesystemsysidsymmetricsubstringstripstrictstdoutstdinstatisticsstatementstartstandalonestablesomesnapshotsmallintsimpleshowsharesetofsession_userserverserializablesequencessequenceselectsecuritysecondsearchscrollschemasavepointrulerowsrollbackrolerightrevokereturningrestrictresetrepeatablerenamerelativereferencesrecursivereassignrealreadrangequoteprocedureproceduralprivilegespriorpreservepreparedprecisionprecedingpositionplanspasswordpartitionparserownerownedoverlapsoverouterorderoroptionoperatoronlyonoidsoffsetofobjectnullsnullifnullnowaitnotifynonenonextncharnationalnamesnamemovemonthmodeminvalueminutemaxvaluematchlocklocationlocaltimestamplocaltimelocalloadlistenlimitlikelevelleftleastleakprooflc_ctypelc_collatelastlargelanguagelabeljoinisolationisnullisintointervalintersectinsertinsensitiveinputinoutinnerinlineinitiallyinheritsindexincrementincludinginimplicitimmutableimmediateilikeifidentityhourholdheaderhavinggroupgreatestgrantglobalfunctionsfunctionfullfromfreezeforcefollowingfloatfirstfetchfamilyfalseexternalextensionexistsexclusiveexcludingexceptescapeenumencryptedencodingenableelseeachdropdoubledomaindocumentdodistinctdictionarydescdelimitersdelimiterdeletedeferreddeferrabledefaultsdeallocatedatabasedatacyclecursorcurrent_usercurrent_timestampcurrent_timecurrent_schemacurrent_rolecurrent_datecrosscreatecostcopyconversioncontinueconstraintsconstraintconnectionconfigurationconcurrentlycommittedcommitcommentscolumncollationcoalescecloseclasscheckpointcheckcharactercharchaincastcasecascadedcalledcachebybothbinarybigintbeginbeforebackwardauthorizationattributeatasymmetricassignmentassertionasarrayalwaysalteralsoaggregateafteradminactionaccessabsoluteabort"%s" -VPGSYSCONFDIR=%sPGSYSCONFDIRpostgres-9.2child process exited with unrecognized status %dchild process was terminated by signal %dchild process exited with exit code %dpclose failedfgets failureno data was returned by command "%s" popen failurer/%s%scould not read symbolic link "%s"could not change directory to "%s"could not find a "%s" to executecould not read binary "%s"PATHinvalid binary "%s"could not identify current directory: %s..//../usr/local/share/man/usr/local/share/doc//postgresql/usr/local/share/locale/usr/local/lib/postgresql/usr/local/lib/usr/local/include/postgresql/server/usr/local/include/postgresql/usr/local/include/usr/local/etc/postgresql/usr/local/bin/usr/local/share/postgresql%s: out of memory /../..././%s%s wr/dev/ttyUnknown error:'J'Z'j'z''''''''' ((*(:(J(Z(j(z((((((((( ))*):)J)Z)j)z))))))))) ****:*J*Z*j*z********* ++*+:+J+Z+j+z+++++++++ ,,*,C N [ h t            8u Tu   ,  `` ``"`oDŽo!o$t$`o``>`$,hp܆UІwĆWeiȢ!p!" t$ $ $' @, 8uTupu`x T:MS ^jxu~pu(1 jȢu~pu9@ 4:- pd:| jpu~puG  lT U\ !6jtu~tuJjxu~puUjxu~u`gp^ ua) d jxu~puo6 0os ke 0l jxu~pujxu~pujxu~pujxu~pu@ !@ ![ +$(3*9dj X*^d(pLr = T*0n 2Y [ xt) \h (`?P u#= 9n Fm `+hD)r(yt*`|+'@6 '4(x!D(4*4)DZ *'m ;*Bpn PTuV)f*m; 4',{ D*$+$*(3@ pm u0 ^ m $,"u` *\ tg  8m Ej( d)v^}Pm )d''@(d+(|)g  $' ((> ;xDT(KQn a'pLg c pkV qB t)d): Z% +9  o 48n g t\B !D]+ 3)D?& Q'*X*_*e$)zg t(+d* [e ,np T,r D+8u++o8j t'(* HTg  \: bp2 {(Pn pu+)+]qD p dU (h6  o ' ). @r ? P\! D'M kN d T'k LG ' : f 4+ e @, + L t+ L- ( + ) 7 , T)? T+F (O )a )t '| ,' hrt * Pdropdbcrti.scrt1.ocrt1.s__get_exit_frame_monitor_ptr__do_exit_code_ptrfsr.strap_tablevalues-Xa.cDdata.dataBbss.bssDrodata.rodatadropdb.chelpTtdata.dataTtbss.bsscommon.cSetCancelConnResetCancelConncancelConnhandle_sigintdumputils.cparseAclItemcopyAclUserNameAddAclon_exit_nicely_indexon_exit_nicely_listkwlookup.ckeywords.cexec.cvalidate_execresolve_symlinkspipe_read_linepath.ctrim_trailing_separatortrim_directorydir_strcmpmake_relative_pathpgstrcasecmp.csprompt.cthread.ccrtn.s_END__START___ctypevwrite_msggeteuidchdirpath_contains_parent_referenceabortPQconnectdbParamspg_ascii_tolowerappendStringLiteralConnlstat64get_locale_pathget_user_nameset_dump_sectionget_prognamepqStrerrorcanonicalize_pathsnprintfparse_versionNumFEScanKeywordsappendStringLiteralDQget_man_pathget_includeserver_pathpg_toupperstrlenpg_strdupgetcwd_GLOBAL_OFFSET_TABLE__edata__environ_lockpg_tolowervfprintf__iobexecuteQuerygetpwuid_environstrerrorPQgetvalueappendPQExpBufferCharemitShSecLabelsstrncpyget_pkginclude_pathgetenvget_html_path_finiPQserverVersionstrcpyappendStringLiteral__fpstart__fsrpclosePQntuplesconnectDatabaseget_etc_pathpqGetpwuidfind_my_execget_include_path_get_exit_frame_monitortermPQExpBufferon_exit_nicelyfirst_path_var_separatorget_lib_pathpath_is_relative_and_below_cwdcreatePQExpBuffer_etextget_share_pathstrncmp_exitinitPQExpBufferPQconnectionNeedsPasswordstrlcpyPQfinishquote_all_identifiersstrstrlast_dir_separator_PROCEDURE_LINKAGE_TABLE_PQstatusappendByteaLiteral_DYNAMICmallocerrnoget_pkglib_pathPQresultStatushas_drive_prefixfind_other_execstrchrPQmblensetup_cancel_handlerbuildShSecLabelQuerypopenyesno_promptget_parent_directoryexecuteMaintenanceCommandjoin_path_componentsScanKeywordLookupPQclientEncodingparsePGArrayPQexecfflushfputcappendPQExpBufferStrmake_native_pathfreefcloseaccessstrerror_r__longdouble_usedget_home_path_end__fsr_init_valuepg_ascii_touppersetlocale_initfilenotcgetattrgetopt_longPQfreeCancel__1cG__CrunMdo_exit_code6F_v_first_dir_separatorfmtIdhandle_help_version_optsPQgetCancelget_doc_path_lib_versionfputsresetPQExpBuffertcsetattr___Argvpg_strncasecmpprocessSQLNamePatternPQerrorMessageconnectMaintenanceDatabasepg_strcasecmpsscanfbuildACLCommandsexit_horriblypath_is_prefix_of_pathatexitbuildDefaultACLCommandsappendPQExpBufferinit_parallel_dump_utilsset_pglocale_pgserviceperrorpclose_check_startfgetsoptargstrcatmainPQcancelfopen64destroyPQExpBufferexecuteCommandenlargePQExpBufferputenvpqsignalprintfPQExpBufferPQescapeStringConnPQclear__posix_getpwuid_rsimple_promptreadlinkoptindanotate anotate0 ,(H,V,Tu,anotateL- (1L-0 .0+IIIIIIIIIIIIIIII?IIIIII5IIIIII" 0  2anotate0 ,(-(1 .004.0R.0".0R.0R.0R.0R.0R.0R.0R.0R.0R.0R.0R.0R.0R.0.0R.0R.0H.0.0R.0R.0R.0R.1R.1R.1>. 1R.1R.1R.1R.1R. 1R.$1+.anotate22Yp2(3@h66748n8j99@4:-d:|:2 !37anotate :d:anotateP:N"::;==>`?P?&@rLGG lTU\dUZ%DZ[[[eP\!t\B\\\\]#] =>YU?CEGLNQSWXZ^bhijoqr#)5D@+ T- g3 u.z ,1 |5 7 8  ; h> A) D  O6 8(Os GKe R(L enw~PiLP> G E 0P0 O `\   $< ,38h<CjKF bhKV ohP|hM LjlG  TohN i`0pi!N 0Pkk"O) -G  @@"XDo_M v{DG @opPN LG  Po+ C J( Np (N &HM K5P <C a0gHon@v p\J  jTH G %@+2M CM PY_ j0s`ypPJg{ KN  HN @PLgM / 6Lopg_resetxlogcrti.scrt1.ocrt1.sfsr.svalues-Xa.cpg_resetxlog.cReadControlFileGuessControlValuesFindEndOfXLOGPrintControlValuesRewriteControlFileKillExistingXLOGKillExistingArchiveStatusWriteEmptyXLOGusagegetopt.cexec.cvalidate_execresolve_symlinkspipe_read_linepath.ctrim_trailing_separatortrim_directorydir_strcmpmake_relative_pathpg_crc.cthread.ccrtn.sstrncmpatexitmemsetchdirperrorstrcat_environ_finifind_my_execmake_native_pathpclose_check__posix_getpwuid_rpqGetpwuidget_parent_directoryreaddir64maingetoptlstat64_DYNAMICstrspn___Argvset_pglocale_pgserviceget_progname_lib_versionget_etc_pathstrerror_edatafirst_path_var_separator_endstrlcpyget_html_pathmemcpy__environ_locksnprintffprintffgetsget_pkglib_pathread_init__iobpclosepqStrerrorlast_dir_separator_get_exit_frame_monitoroptargget_includeserver_pathtimehas_drive_prefix__fpstarterrnopg_crc32_tableget_man_pathfirst_dir_separatoroptopt_exitfind_other_execpath_is_relative_and_below_cwdget_home_pathget_locale_pathget_share_path_startstrdup__1cG__CrunMdo_exit_code6F_v_writeopterrgeteuid_PROCEDURE_LINKAGE_TABLE_putsstrlenpath_contains_parent_referencegetcwdstrstrmallocfputc__longdouble_usedgetenvstrncpycanonicalize_pathsscanfjoin_path_componentsfsyncputenvget_include_pathget_lib_pathclosedirabortstrerror_rreadlinkpopenopen64opendir__fsr_init_valuestrchr_etext__fsrpath_is_prefix_of_pathsetlocalestrtoulaccessget_doc_pathstrcpyfflushgettimeofday_GLOBAL_OFFSET_TABLE_get_pkginclude_pathunlinkoptindlibc.so.1SUNW_1.22SUNW_1.19SUNW_1.1SUNW_0.7SYSVABI_1.3SUNWprivate_1.1libxslt.so.1libxml2.so.2libpam.so.1libssl.so.0.9.8libcrypto.so.0.9.8libkrb5.so.3libcom_err.so.3libgss.so.1libz.solibreadline.so.6libtermcap.so.1libnsl.so.1libsocket.so.1libm.so.2/usr/local/lib:/usr/local/lib=yGyQ'= [(= d7mqN yf`. /'Y)4PU:K(tri[5^7wNxD]=T\,J+F&6S1C?3oGRMdV;jDDo/k)Lor@o4Po8HoFXg3\g<`gdg:hgAlgipg#tgGxg|g"gagLgIggOg'g+g ggng1gqgEgWgbggJggUg[gdggjgMgSgPgRg9g_glgmg`h$h]h hhhChXhh h$hN(h\,h^0h 4h.5Pg%Tg%Xgh%\gh%`gh%dgh%hgh %lgh(%pgh0%tgh8p%xgh@`%|ghHP%ghP@%ghX0%gh` %ghh%ghp%ghx%gh%gh%gh%gh%gh%gh%gh%ghp%gh`%ghP%gh@%gh0%gh %gh%gh%gh%gh%gh%gh%gh%gh %gh(%gh0%gh8p%gh@`%ghHP%hhP@%hhX0%hh` % hhh%hhp%hhx%hh%hh% hh%$hh%(hh%,hh%0hh%4hhpjjR8hthLPjtjt PcEiu TiRU jRPh0P j#URQt`|$у$j D$td$у`tƒ 3fd$f T$tfd$f L$l$YZ]ÐUSVWThtc] 3 &3*ju~lhlcsohhcsThh\cs9dhXcsIh(cSV33ۃDžDžDžDžDžDžDžDžM 9DžDž)\$*jP5Dol;Do8,jQ@P3 A;8,jQ@P A;8jP5Do;Do8rjP5Do_;Do8#jP5Do;Do8 jP5Do;Do8*jP5Dor؍;Do$8uBSDž1Dž%5jhbhk&jh(cWVjXE9Lo6LoM 4 VVVh`hP jjP@oMyu@tjt)jlʈjs lʈj3jtjt=jtj j+H#+ȉ jj;w;u#j9vjjDjt t t> Pt j h_j=jt w& q h_^\3_^[ j h8c=j5jhTahk 5jhbhkjA+5jhTahki 5jhbhkQj5jhTahk 5jhbhkj5jhahk 5jhbhkjk5jhxahkjAp5jhahkq 5jhbhkYj5jhahk/j5jh@ V8{>3F3 pPBЅw;t<5jh@^hk+ hShjDj:hShj5jh]hk3 _^[à 5@o$Ph_5jhl`kS =@ouh_h^Sv j 5@oPh_5jh^hk5jUSVDjhjhjjjM" jEPE3M ȉ jj5j jjj5j jj'j5j j5j jBj j5jj j3əjjjjjj kkd k@k klP$k ,k0k 4k8kuYh0XW8uC VEPEPh XW) E j;w;u j9v jj@o Su@o Sj8k=s@jjj_^[à 5@oPhtT5jhDXhkj PTPhtT5jhWhkjlBUSV htT؅t{3@o StDp Vuh0XVtx@o Sru@o S^[à 5@o}PhtT5jhDXhkjG VhtThWhPPO 5@oPP5jhWhkvj PPhtT5jhWhk=jUSVWhW23@o V%؅tf{h0XW+u1*hWShWSt{@o V؅u@o V_^[à 5@oPhW5jhDXhk9j" WhWhWhP8PL 5@oPPP5jhWhkjf PPhW5jhWhkj-USVW  h h jS fqfCjCjCjC j jCKCC 3C$C(C,C0T8C4C8C9j8jVC3F3 pPBЅwݍs$>3F3 pPBЅwщK 5j5j5jhWhPpP! hhPX)3@oh SV= tN=@ou @o 5@o:PQ5jh@WhkjPh jSM @oh SVl= tN@ou@o PPP5jh@Whk!j r V uT V_^[à 5@oDPQ5jhdWhkjZ 5@oP5jhlXhk{j!sU5jhW5jhVhVhVuhVhh4V[hVNhUAhU4hTU'hUhT hThTÐUSHj8tLo<Lo;UE 9-AYu-u yTH HjPo:Pux:t#DoHj8Lo LoHj8ueA Lo9MLHjcE8:t.=Hot5Pohchk?:E DoDoHjcA LoPoLo=Po-tEHj8uBLo=Hot#E8:t5Pohchk?9Hjc(BLoHjcHjc[ÐUShSu?|SC%=tBjE0#jE0ut3 Ĕ[ÐUSVhPn u.E8/tPQu nhPu E ƀ u u u E 0%E 0hekS}Sj B he8k8bu M Dž3ۉt C SDu S2É+ÍP+H#…v+PSQoD8/t,PPV VVPV VfVqu'Vhtehkhkj  tt8 Vo)uhPekSSj ^[à 5@o PhekSSj RUSVWXhP u V؅t VItoCރXPSp%=hWS|P=sIƄWVkVh,ehkhkj `ShekSoSj 4SPWh]utpPPP34XP!t3-XPh,ekSSj Ĝ_^[à 5@o PhekSSj `뾃 5@o PhekSdSj )뇐USVxuuu} 6t 6,6>62hdu he+QS6tZ6hchP EjdPQ9t!EuPWu3 p^[ÐUSVWhkakVS3=@ohduH؅=@oSuu 6t SruE 33/C t,E0hdV S3 _^[à hd؃ hd3ҐUSutVv.u'PhLdkS+Sj LPhdkSSj (PhxdkSSj 3[à hdߐU hdu vthdjPu'|t hc7u`PQrPhchPJP/P|PÐU3ÐUEt/t @u3UEt:t @u3UU 3t/uB uUÐUSVW ]ME ;thPQ.u{/u.u{/ttJE 8u,g0g uRuESWh4g+QuV ] _^[USVW(u7]˅t,3/u t C/t;t/CAuuu3ۃ u}h$gE0;u`h(g>Ph$gE0|EhePt\h gE0tCE8tl PKE8,h$gP E0C E0mEK~gÅ3|AE0eWVWVWVWV}ͅ~uheVKh gu_^[ÐUSuh gut4jheE0XthgE0Ot(}3heEDP1[UE8/u3 PQUSuI Su uuE /t 3[ÐUSV utXE St^[ÃShghk|TݐUSVW}M t2t;:t /ujm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-offpg_xlog64-bit integers Report bugs to . -?, --help show this help, then exit -x XID set next transaction ID -V, --version output version information, then exit -O OFFSET set next multitransaction offset -o OID set next OID -n no update, just show extracted control values (for testing) -m XID set next multitransaction ID -l TLI,FILE,SEG force minimum WAL starting location for new transaction log -f force update to be done -e XIDEPOCH set next transaction ID epoch Options: Usage: %s [OPTION]... DATADIR %s resets the PostgreSQL transaction log. %s: could not write file "%s": %s %s: could not open file "%s": %s pg_xlog/%08X%08X%08X.done.readypg_xlog/archive_status%s: could not delete file "%s": %s %s/%s%s: could not read from directory "%s": %s %08X%08X%08X0123456789ABCDEF%s: could not open directory "%s": %s %s: fsync error: %s %s: could not write pg_control file: %s %s: could not create pg_control file: %s %s: internal error -- sizeof(ControlFileData) is too large ... fix PG_CONTROL_SIZE Float8 argument passing: %s by referenceby valueFloat4 argument passing: %s floating-point numbersDate/time type storage: %s Maximum size of a TOAST chunk: %u Maximum columns in an index: %u Maximum length of identifiers: %u Bytes per WAL segment: %u WAL block size: %u Blocks per segment of large relation: %u Database block size: %u Maximum data alignment: %u Latest checkpoint's oldestActiveXID: %u Latest checkpoint's oldestXID's DB: %u Latest checkpoint's oldestXID: %u Latest checkpoint's NextMultiOffset: %u Latest checkpoint's NextMultiXactId: %u Latest checkpoint's NextOID: %u Latest checkpoint's NextXID: %u/%u onLatest checkpoint's full_page_writes: %s Latest checkpoint's TimeLineID: %u Database system identifier: %s Catalog version number: %u pg_control version number: %u First log file segment after reset: %u First log file ID after reset: %u %llupg_control values: Guessed pg_control values: %s: pg_control exists but is broken or unknown version; ignoring it %s: pg_control exists but has invalid CRC; proceed with caution %s: could not read file "%s": %s If you are sure the data directory path is correct, execute touch %s and try again. global/pg_controlTransaction log reset The database server was not shut down cleanly. Resetting the transaction log might cause data to be lost. If you want to proceed anyway, use -f to force reset. If these values seem acceptable, use -f to force reset. %s: lock file "%s" exists Is a server running? If not, delete the lock file and try again. %s: could not open file "%s" for reading: %s %s/postmaster.pid%s: could not change directory to "%s": %s You must run %s as the PostgreSQL superuser. %s: cannot be executed by "root" %s: no data directory specified %s: invalid argument for option -l %s: multitransaction offset (-O) must not be -1 %s: invalid argument for option -O %s: multitransaction ID (-m) must not be 0 %s: invalid argument for option -m %s: OID (-o) must not be 0 %s: invalid argument for option -o %s: transaction ID (-x) must not be 0 %s: invalid argument for option -x %s: transaction ID epoch (-e) must not be -1 Try "%s --help" for more information. %s: invalid argument for option -e fl:m:no:O:x:e:pg_resetxlog (PostgreSQL) 9.2.0-V--version-?--helppg_resetxlog-9.2option requires an argument -- %c illegal option -- %c "%s" -VPGSYSCONFDIR=%sPGSYSCONFDIRpostgres-9.2child process exited with unrecognized status %dchild process was terminated by signal %dchild process exited with exit code %dpclose failedfgets failureno data was returned by command "%s" popen failurer/%s%scould not read symbolic link "%s"could not change directory to "%s"could not find a "%s" to executecould not read binary "%s"PATHinvalid binary "%s"could not identify current directory: %s..//../usr/local/share/man/usr/local/share/doc//postgresql/usr/local/share/locale/usr/local/lib/postgresql/usr/local/lib/usr/local/include/postgresql/server/usr/local/include/postgresql/usr/local/include/usr/local/etc/postgresql/usr/local/bin/usr/local/share/postgresql%s: out of memory /../..././%s%sUnknown error8h&6FVfv&6FVfv&6FVfv&6F$0?= 0P LPII  g  `` ```otEo`o`o``>Lg@c `    P 0PLPhPpTLg8hiLjLjLjj To"#j@jSY$j dpi{jhP@+ - 3 Dj.z ,1 |5 7 ,8  ;; ALjQjjZjdjpDj{jlPoLjyALjpHj{jhPoLjh> A) D ALjpi{jhPoLjO6 (Os Ke (L ALjpi{jhPoLjALjpi{jpPoLj ALjpi{jhPoLj*29@PFMTi]LPc> pG E 0P0 O `\   < 8hjF MhKV hPhM (1Lj8lG  QToV^hN lsi`0pUi!N 0PkkO) G  @"DoM DG +5@o;pPJN WLG  kPo rxC sJ( Np (N HM P  0Ho @ /4p;\J Zahou jTH G @M M   0`pP'8?JgF{ LKN cm u|HN @PLgM  Lopg_resetxlogcrti.scrt1.ocrt1.s__get_exit_frame_monitor_ptr__do_exit_code_ptrfsr.strap_tablevalues-Xa.cDdata.dataBbss.bssDrodata.rodatapg_resetxlog.cReadControlFileGuessControlValuesFindEndOfXLOGguessedPrintControlValuesRewriteControlFileKillExistingXLOGKillExistingArchiveStatusWriteEmptyXLOGusageTtdata.dataget_prognamenewXlogIdnewXlogSegTtbss.bssgetopt.cexec.cvalidate_execresolve_symlinkspipe_read_linepath.ctrim_trailing_separatortrim_directorydir_strcmpmake_relative_pathpg_crc.cthread.ccrtn.s_END__START_strncmpatexitmemsetchdirperrorstrcat_environ_finifind_my_execmake_native_pathpclose_check__posix_getpwuid_rpqGetpwuidget_parent_directoryreaddir64maingetoptlstat64_DYNAMICstrspn___Argvset_pglocale_pgservice_lib_versionget_etc_pathstrerror_edatafirst_path_var_separator_endstrlcpyget_html_pathmemcpy__environ_locksnprintffprintffgetsget_pkglib_pathread_init__iobpclosepqStrerrorlast_dir_separator_get_exit_frame_monitoroptargget_includeserver_pathtimehas_drive_prefix__fpstarterrnopg_crc32_tableget_man_pathfirst_dir_separatoroptopt_exitfind_other_execpath_is_relative_and_below_cwdget_home_pathget_locale_pathget_share_path_startstrdup__1cG__CrunMdo_exit_code6F_v_writeopterrgeteuid_PROCEDURE_LINKAGE_TABLE_putsstrlenpath_contains_parent_referencegetcwdstrstrmallocfputc__longdouble_usedgetenvstrncpycanonicalize_pathsscanfjoin_path_componentsfsyncputenvget_include_pathget_lib_pathclosedirabortstrerror_rreadlinkpopenopen64opendir__fsr_init_valuestrchr_etext__fsrpath_is_prefix_of_pathsetlocalestrtoulaccessget_doc_pathstrcpyfflushgettimeofday_GLOBAL_OFFSET_TABLE_get_pkginclude_pathunlinkoptindanotate anotate0 ,(X8hfLPjjanotateT\ 3l@+-.z,13|578 ;\  *!*\\\\\\\\\\\\\\\\\\\\\P\\\\\Dc\\\\\\\\ *anotate` \X!**["*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#+#+#+# +!+"+#+"+# +#$+#(+#,+#0+#4+#8+#<+H#anotate< <anotate anotatedh>Th>>A)CDEFanotate anotatepDGPDGLG lG G GGTH\JJ(KNhKVKe(LHMhMMMMMN(NHNhNNNpO(OsO6 M@M%Oanotate anotate(O\O)P0%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI@(#)math.h 2.26 08/09/11 SMI@(#)math_iso.h 1.10 05/10/06 SMI@(#)math_c99.h 1.12 07/01/21 SMI@(#)floatingpoint.h 2.12 07/05/17 SMI@(#)ieeefp.h 2.13 05/10/06 SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.11 SunOS_i386 2010/08/13iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.11 SunOS_i386 2010/08/13iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMIacomp: Sun C 5.11 SunOS_i386 2010/08/13iropt: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ir2hf: Sun Compiler Common 12.2 SunOS_i386 2010/08/13ube: Sun Compiler (0x10|0x8|0x2) 12.2 SunOS_i386 2010/08/13as: Sun Compiler Common 12.2 SunOS_i386 2010/08/13%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E% SMI%Z%%M% %I% %E