# PaCkAgE DaTaStReAm librsvg 1 2997 # end of header 07070100039c6e000081a40000000000000000000000014c847b7d0000010f0000010000010036ffffffffffffffff0000001000000000librsvg/pkginfoPKG=librsvg NAME=librsvg 2.31.0 SPARC 64bit Solaris 10 VERSION=2.31.0 PSTAMP=6th September 2010 VENDOR=The Gnome Project EMAIL=http://librsvg.sourceforge.net/ DESC=SVG imaging library ARCH=sparc CATEGORY=utility CLASSES=none BASEDIR=/ ISTATES=S s 1 2 3 RSTATES=S s 1 2 3 07070100039c6d000081a40000000000000000000000014c847b7d000013110000010000010036ffffffffffffffff0000000f00000000librsvg/pkgmap: 1 2997 1 d none /usr ? ? ? 1 d none /usr/local ? ? ? 1 d none /usr/local/bin 0755 root root 1 f none /usr/local/bin/rsvg-convert 0755 root root 25176 15301 1283748998 1 d none /usr/local/include 0755 root root 1 d none /usr/local/include/librsvg-2.0 0755 root root 1 d none /usr/local/include/librsvg-2.0/librsvg 0755 root root 1 f none /usr/local/include/librsvg-2.0/librsvg/librsvg-enum-types.h 0644 root root 382 31641 1283748998 1 f none /usr/local/include/librsvg-2.0/librsvg/librsvg-features.h 0644 root root 875 3458 1283748998 1 f none /usr/local/include/librsvg-2.0/librsvg/rsvg-cairo.h 0644 root root 1289 40195 1283748998 1 f none /usr/local/include/librsvg-2.0/librsvg/rsvg.h 0644 root root 7478 52611 1283748998 1 d none /usr/local/lib 0755 root root 1 d none /usr/local/lib/gtk-2.0 0755 root root 1 d none /usr/local/lib/gtk-2.0/engines 0755 root root 1 d none /usr/local/lib/gtk-3.0 0755 root root 1 d none /usr/local/lib/gtk-3.0/engines 0755 root root 1 f none /usr/local/lib/librsvg-2.a 0644 root root 655192 34803 1283748998 1 f none /usr/local/lib/librsvg-2.la 0755 root root 1726 20782 1283748998 1 s none /usr/local/lib/librsvg-2.so=librsvg-2.so.2.31.0 1 s none /usr/local/lib/librsvg-2.so.2=librsvg-2.so.2.31.0 1 f none /usr/local/lib/librsvg-2.so.2.31.0 0755 root root 457544 63284 1283748998 1 d none /usr/local/lib/pkgconfig 0755 root root 1 f none /usr/local/lib/pkgconfig/librsvg-2.0.pc 0644 root root 343 31147 1283748999 1 d none /usr/local/share 0755 root root 1 d none /usr/local/share/gtk-doc 0755 root root 1 d none /usr/local/share/gtk-doc/html 0755 root root 1 d none /usr/local/share/gtk-doc/html/rsvg-2.0 0755 root root 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/RsvgHandle.html 0644 root root 60967 4244 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/annotation-glossary.html 0644 root root 2245 55513 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/api-index-2-14.html 0644 root root 3406 28556 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/api-index-2-22.html 0644 root root 2508 14223 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/api-index-2-32.html 0644 root root 2977 55165 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/api-index-2-4.html 0644 root root 2240 56423 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/api-index-2-8.html 0644 root root 3056 59696 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/api-index-2-9.html 0644 root root 2892 41559 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/api-index-deprecated.html 0644 root root 4314 40519 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/api-index-full.html 0644 root root 19788 7988 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/home.png 0644 root root 654 8089 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/index.html 0644 root root 4498 62954 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/index.sgml 0644 root root 9348 42941 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/left.png 0644 root root 459 49669 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/licence.html 0644 root root 2686 36538 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/object-tree.html 0644 root root 1834 22424 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/right.png 0644 root root 472 50613 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/rsvg-2.0.devhelp 0644 root root 8369 6389 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/rsvg-2.0.devhelp2 0644 root root 10349 50471 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/rsvg-Using-RSVG-with-GIO.html 0644 root root 20195 44557 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/rsvg-Using-RSVG-with-GdkPixbuf.html 0644 root root 30189 54060 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/rsvg-Using-RSVG-with-cairo.html 0644 root root 7366 20759 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/rsvg-Version-check-and-feature-tests.html 0644 root root 7942 41841 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/rsvg.html 0644 root root 2634 26642 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/style.css 0644 root root 5064 12839 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/up.png 0644 root root 406 41501 1283749005 1 d none /usr/local/share/man 0755 root root 1 d none /usr/local/share/man/man1 0755 root root 1 d none /usr/local/share/pixmaps 0755 root root 1 f none /usr/local/share/pixmaps/svg-viewer.svg 0644 root root 7174 17375 1283749004 1 d none /usr/local/share/themes 0755 root root 1 d none /usr/local/share/themes/bubble 0755 root root 1 d none /usr/local/share/themes/bubble/gtk-2.0 0755 root root 1 d none /usr/local/share/themes/bubble/gtk-3.0 0755 root root 1 i checkinstall 785 2565 1283750779 1 i pkginfo 271 21089 1283750781 07070100000000000000000000000000000000000000010000000000000000000000000000000000000000000000000000000b00000000TRAILER!!!07070100039c6e000081a40000000000000000000000014c847b7d0000010f0000010000010036ffffffffffffffff0000000800000000pkginfoPKG=librsvg NAME=librsvg 2.31.0 SPARC 64bit Solaris 10 VERSION=2.31.0 PSTAMP=6th September 2010 VENDOR=The Gnome Project EMAIL=http://librsvg.sourceforge.net/ DESC=SVG imaging library ARCH=sparc CATEGORY=utility CLASSES=none BASEDIR=/ ISTATES=S s 1 2 3 RSTATES=S s 1 2 3 07070100039c6d000081a40000000000000000000000014c847b7d000013110000010000010036ffffffffffffffff0000000700000000pkgmap: 1 2997 1 d none /usr ? ? ? 1 d none /usr/local ? ? ? 1 d none /usr/local/bin 0755 root root 1 f none /usr/local/bin/rsvg-convert 0755 root root 25176 15301 1283748998 1 d none /usr/local/include 0755 root root 1 d none /usr/local/include/librsvg-2.0 0755 root root 1 d none /usr/local/include/librsvg-2.0/librsvg 0755 root root 1 f none /usr/local/include/librsvg-2.0/librsvg/librsvg-enum-types.h 0644 root root 382 31641 1283748998 1 f none /usr/local/include/librsvg-2.0/librsvg/librsvg-features.h 0644 root root 875 3458 1283748998 1 f none /usr/local/include/librsvg-2.0/librsvg/rsvg-cairo.h 0644 root root 1289 40195 1283748998 1 f none /usr/local/include/librsvg-2.0/librsvg/rsvg.h 0644 root root 7478 52611 1283748998 1 d none /usr/local/lib 0755 root root 1 d none /usr/local/lib/gtk-2.0 0755 root root 1 d none /usr/local/lib/gtk-2.0/engines 0755 root root 1 d none /usr/local/lib/gtk-3.0 0755 root root 1 d none /usr/local/lib/gtk-3.0/engines 0755 root root 1 f none /usr/local/lib/librsvg-2.a 0644 root root 655192 34803 1283748998 1 f none /usr/local/lib/librsvg-2.la 0755 root root 1726 20782 1283748998 1 s none /usr/local/lib/librsvg-2.so=librsvg-2.so.2.31.0 1 s none /usr/local/lib/librsvg-2.so.2=librsvg-2.so.2.31.0 1 f none /usr/local/lib/librsvg-2.so.2.31.0 0755 root root 457544 63284 1283748998 1 d none /usr/local/lib/pkgconfig 0755 root root 1 f none /usr/local/lib/pkgconfig/librsvg-2.0.pc 0644 root root 343 31147 1283748999 1 d none /usr/local/share 0755 root root 1 d none /usr/local/share/gtk-doc 0755 root root 1 d none /usr/local/share/gtk-doc/html 0755 root root 1 d none /usr/local/share/gtk-doc/html/rsvg-2.0 0755 root root 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/RsvgHandle.html 0644 root root 60967 4244 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/annotation-glossary.html 0644 root root 2245 55513 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/api-index-2-14.html 0644 root root 3406 28556 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/api-index-2-22.html 0644 root root 2508 14223 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/api-index-2-32.html 0644 root root 2977 55165 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/api-index-2-4.html 0644 root root 2240 56423 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/api-index-2-8.html 0644 root root 3056 59696 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/api-index-2-9.html 0644 root root 2892 41559 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/api-index-deprecated.html 0644 root root 4314 40519 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/api-index-full.html 0644 root root 19788 7988 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/home.png 0644 root root 654 8089 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/index.html 0644 root root 4498 62954 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/index.sgml 0644 root root 9348 42941 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/left.png 0644 root root 459 49669 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/licence.html 0644 root root 2686 36538 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/object-tree.html 0644 root root 1834 22424 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/right.png 0644 root root 472 50613 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/rsvg-2.0.devhelp 0644 root root 8369 6389 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/rsvg-2.0.devhelp2 0644 root root 10349 50471 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/rsvg-Using-RSVG-with-GIO.html 0644 root root 20195 44557 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/rsvg-Using-RSVG-with-GdkPixbuf.html 0644 root root 30189 54060 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/rsvg-Using-RSVG-with-cairo.html 0644 root root 7366 20759 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/rsvg-Version-check-and-feature-tests.html 0644 root root 7942 41841 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/rsvg.html 0644 root root 2634 26642 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/style.css 0644 root root 5064 12839 1283749005 1 f none /usr/local/share/gtk-doc/html/rsvg-2.0/up.png 0644 root root 406 41501 1283749005 1 d none /usr/local/share/man 0755 root root 1 d none /usr/local/share/man/man1 0755 root root 1 d none /usr/local/share/pixmaps 0755 root root 1 f none /usr/local/share/pixmaps/svg-viewer.svg 0644 root root 7174 17375 1283749004 1 d none /usr/local/share/themes 0755 root root 1 d none /usr/local/share/themes/bubble 0755 root root 1 d none /usr/local/share/themes/bubble/gtk-2.0 0755 root root 1 d none /usr/local/share/themes/bubble/gtk-3.0 0755 root root 1 i checkinstall 785 2565 1283750779 1 i pkginfo 271 21089 1283750781 07070100039ca1000041ed0000000000000000000000024c847b7d000000000000010000010036ffffffffffffffff0000000800000000install07070100039ca2000081ed0000000000000000000000014c847b7b000003110000010000010036ffffffffffffffff0000001500000000install/checkinstall#!/bin/sh # expected_bits="64" expected_release="5.10" expected_platform="sparc" # release=`uname -r` platform=`uname -p` bits=`isainfo -b` # if [ ${platform} != ${expected_platform} ]; then echo "\n\n\n\tThis package must be installed on a ${expected_platform} architecture\n" echo "\tAborting installation.\n\n\n" exit 1 fi if [ ${release} != ${expected_release} ]; then echo "\n\n\n\tThis package must be installed on a ${expected_release} machine\n" echo "\tAborting installation.\n\n\n" exit 1 fi if [ ${bits} != ${expected_bits} ]; then echo "\n\n\n\tThis package must be installed on a ${expected_bits} bit machine\n" echo "\tYour machine is running a ${bits} bit O.S. currently\n" echo "\tAborting installation.\n\n\n" exit 1 fi exit 0 07070100039c6f000041ed0000000000000000000000034c847b7d000000000000010000010036ffffffffffffffff0000000500000000root07070100039c70000041ed0000000000000000000000034c847b7d000000000000010000010036ffffffffffffffff0000000900000000root/usr07070100039c71000041ed0000000000000000000000064c847b7d000000000000010000010036ffffffffffffffff0000000f00000000root/usr/local07070100039c81000041ed0000000000000000000000044c847b7d000000000000010000010036ffffffffffffffff0000001500000000root/usr/local/share07070100039c9f000041ed0000000000000000000000024c847b7d000000000000010000010036ffffffffffffffff0000001d00000000root/usr/local/share/pixmaps07070100039ca0000081a40000000000000000000000014c84748c00001c060000010000010036ffffffffffffffff0000002c00000000root/usr/local/share/pixmaps/svg-viewer.svg 07070100039c82000041ed0000000000000000000000034c847b7d000000000000010000010036ffffffffffffffff0000001d00000000root/usr/local/share/gtk-doc07070100039c83000041ed0000000000000000000000034c847b7d000000000000010000010036ffffffffffffffff0000002200000000root/usr/local/share/gtk-doc/html07070100039c84000041ed0000000000000000000000024c847b7d000000000000010000010036ffffffffffffffff0000002b00000000root/usr/local/share/gtk-doc/html/rsvg-2.007070100039c8b000081a40000000000000000000000014c84748d00000bf00000010000010036ffffffffffffffff0000003e00000000root/usr/local/share/gtk-doc/html/rsvg-2.0/api-index-2-8.html Index of new symbols in 2.8

Index of new symbols in 2.8

H

rsvg_handle_get_base_uri, function in RsvgHandle
rsvg_handle_set_dpi, function in RsvgHandle
rsvg_handle_set_dpi_x_y, function in RsvgHandle

S

rsvg_set_default_dpi, function in RsvgHandle
rsvg_set_default_dpi_x_y, function in RsvgHandle
07070100039c9b000081a40000000000000000000000014c84748d00001f060000010000010036ffffffffffffffff0000005500000000root/usr/local/share/gtk-doc/html/rsvg-2.0/rsvg-Version-check-and-feature-tests.html Version check and feature tests

Version check and feature tests

Version check and feature tests

Synopsis

#define             LIBRSVG_MAJOR_VERSION
#define             LIBRSVG_MINOR_VERSION
#define             LIBRSVG_MICRO_VERSION
#define             LIBRSVG_VERSION
#define             LIBRSVG_CHECK_VERSION               (major,
                                                         minor,
                                                         micro)
#define             LIBRSVG_HAVE_SVGZ
#define             LIBRSVG_HAVE_CSS
#define             LIBRSVG_CHECK_FEATURE               (FEATURE)
extern              const char *librsvg_version;
void                librsvg_preinit                     (void *app,
                                                         void *modinfo);
void                librsvg_postinit                    (void *app,
                                                         void *modinfo);

Description

Details

LIBRSVG_MAJOR_VERSION

#define             LIBRSVG_MAJOR_VERSION

LIBRSVG_MINOR_VERSION

#define             LIBRSVG_MINOR_VERSION

LIBRSVG_MICRO_VERSION

#define             LIBRSVG_MICRO_VERSION

LIBRSVG_VERSION

#define             LIBRSVG_VERSION

LIBRSVG_CHECK_VERSION()

#define             LIBRSVG_CHECK_VERSION(major,minor,micro)

LIBRSVG_HAVE_SVGZ

#define             LIBRSVG_HAVE_SVGZ

LIBRSVG_HAVE_CSS

#define             LIBRSVG_HAVE_CSS

LIBRSVG_CHECK_FEATURE()

#define             LIBRSVG_CHECK_FEATURE(FEATURE)

librsvg_version

extern const char *librsvg_version;

librsvg_preinit ()

void                librsvg_preinit                     (void *app,
                                                         void *modinfo);

librsvg_postinit ()

void                librsvg_postinit                    (void *app,
                                                         void *modinfo);
07070100039c9c000081a40000000000000000000000014c84748d00000a4a0000010000010036ffffffffffffffff0000003500000000root/usr/local/share/gtk-doc/html/rsvg-2.0/rsvg.html Part I. API Reference

Part I. API Reference

The GNOME SVG Library (RSVG) is library for rendering SVG and SVGZ files.

Table of Contents

RsvgHandle — Create and manipulate SVG objects
Using RSVG with GIO
Using RSVG with cairo
Using RSVG with GdkPixbuf — How to render SVGs into GdkPixbufs, for easy use in GTK+ applications
Version check and feature tests
07070100039c95000081a40000000000000000000000014c84748d000001d80000010000010036ffffffffffffffff0000003500000000root/usr/local/share/gtk-doc/html/rsvg-2.0/right.pngPNG  IHDRw=bKGD pHYs  ~tIME2 I%=eIDATx!o@.'**M0$$?1~vIeEuLl&4䝠Bݛ|>$ݶoc Index of new symbols in 2.4

Index of new symbols in 2.4

H

rsvg_handle_get_desc, function in RsvgHandle
rsvg_handle_get_title, function in RsvgHandle
07070100039c85000081a40000000000000000000000014c84748d0000ee270000010000010036ffffffffffffffff0000003b00000000root/usr/local/share/gtk-doc/html/rsvg-2.0/RsvgHandle.html RsvgHandle

RsvgHandle

RsvgHandle — Create and manipulate SVG objects

Synopsis

enum                RsvgError;
#define             RSVG_ERROR
GQuark              rsvg_error_quark                    (void);
                    RsvgHandle;
typedef             RsvgHandlePrivate;
                    RsvgHandleClass;
                    RsvgDimensionData;
                    RsvgPositionData;
void                rsvg_init                           (void);
void                rsvg_term                           (void);
void                rsvg_set_default_dpi                (double dpi);
void                rsvg_set_default_dpi_x_y            (double dpi_x,
                                                         double dpi_y);
void                rsvg_handle_set_dpi                 (RsvgHandle *handle,
                                                         double dpi);
void                rsvg_handle_set_dpi_x_y             (RsvgHandle *handle,
                                                         double dpi_x,
                                                         double dpi_y);
RsvgHandle *        rsvg_handle_new                     (void);
gboolean            rsvg_handle_write                   (RsvgHandle *handle,
                                                         const guchar *buf,
                                                         gsize count,
                                                         GError **error);
gboolean            rsvg_handle_close                   (RsvgHandle *handle,
                                                         GError **error);
const char *        rsvg_handle_get_base_uri            (RsvgHandle *handle);
void                rsvg_handle_set_base_uri            (RsvgHandle *handle,
                                                         const char *base_uri);
void                rsvg_handle_get_dimensions          (RsvgHandle *handle,
                                                         RsvgDimensionData *dimension_data);
gboolean            rsvg_handle_get_dimensions_sub      (RsvgHandle *handle,
                                                         RsvgDimensionData *dimension_data,
                                                         const char *id);
gboolean            rsvg_handle_get_position_sub        (RsvgHandle *handle,
                                                         RsvgPositionData *position_data,
                                                         const char *id);
gboolean            rsvg_handle_has_sub                 (RsvgHandle *handle,
                                                         const char *id);
const char *        rsvg_handle_get_title               (RsvgHandle *handle);
const char *        rsvg_handle_get_desc                (RsvgHandle *handle);
const char *        rsvg_handle_get_metadata            (RsvgHandle *handle);
RsvgHandle *        rsvg_handle_new_from_data           (const guint8 *data,
                                                         gsize data_len,
                                                         GError **error);
RsvgHandle *        rsvg_handle_new_from_file           (const gchar *file_name,
                                                         GError **error);
void                rsvg_handle_free                    (RsvgHandle *handle);
void                (*RsvgSizeFunc)                     (gint *width,
                                                         gint *height,
                                                         gpointer user_data);
void                rsvg_handle_set_size_callback       (RsvgHandle *handle,
                                                         RsvgSizeFunc size_func,
                                                         gpointer user_data,
                                                         GDestroyNotify user_data_destroy);
GType               rsvg_error_get_type                 (void);
#define             RSVG_TYPE_ERROR

Object Hierarchy

  GObject
   +----RsvgHandle

Properties

  "base-uri"                 gchar*                : Read / Write / Construct
  "desc"                     gchar*                : Read
  "dpi-x"                    gdouble               : Read / Write / Construct
  "dpi-y"                    gdouble               : Read / Write / Construct
  "em"                       gdouble               : Read
  "ex"                       gdouble               : Read
  "height"                   gint                  : Read
  "metadata"                 gchar*                : Read
  "title"                    gchar*                : Read
  "width"                    gint                  : Read

Description

librsvg is a component used within software applications to enable support for SVG-format scalable graphics. In contrast to raster formats, scalable vector graphics provide users and artists a way to create, view, and provide imagery that is not limited to the pixel or dot density that an output device is capable of.

Many software developers use the librsvg library to render SVG graphics. It is lightweight and portable.

Details

enum RsvgError

typedef enum {
    RSVG_ERROR_FAILED
} RsvgError;

RSVG_ERROR

#define             RSVG_ERROR

rsvg_error_quark ()

GQuark              rsvg_error_quark                    (void);

The error domain for RSVG

Returns :

The error domain

RsvgHandle

typedef struct _RsvgHandle RsvgHandle;

RsvgHandlePrivate


RsvgHandleClass

typedef struct {
    GObjectClass parent;

    gpointer _abi_padding[15];
} RsvgHandleClass;

RsvgDimensionData

typedef struct {
    /**
     * SVG's width, in pixels
     */
    int width;

    /**
     * SVG's height, in pixels
     */
    int height;

    /**
     * em
     */
    gdouble em;

    /**
     * ex
     */
    gdouble ex;
} RsvgDimensionData;

RsvgPositionData

typedef struct {
    int x;
    int y;
} RsvgPositionData;

rsvg_init ()

void                rsvg_init                           (void);

Initializes librsvg

Since 2.9


rsvg_term ()

void                rsvg_term                           (void);

De-initializes librsvg

Since 2.9


rsvg_set_default_dpi ()

void                rsvg_set_default_dpi                (double dpi);

Sets the DPI for the all future outgoing pixbufs. Common values are 75, 90, and 300 DPI. Passing a number <= 0 to dpi will reset the DPI to whatever the default value happens to be.

dpi :

Dots Per Inch (aka Pixels Per Inch)

Since 2.8


rsvg_set_default_dpi_x_y ()

void                rsvg_set_default_dpi_x_y            (double dpi_x,
                                                         double dpi_y);

Sets the DPI for the all future outgoing pixbufs. Common values are 75, 90, and 300 DPI. Passing a number <= 0 to dpi will reset the DPI to whatever the default value happens to be.

dpi_x :

Dots Per Inch (aka Pixels Per Inch)

dpi_y :

Dots Per Inch (aka Pixels Per Inch)

Since 2.8


rsvg_handle_set_dpi ()

void                rsvg_handle_set_dpi                 (RsvgHandle *handle,
                                                         double dpi);

Sets the DPI for the outgoing pixbuf. Common values are 75, 90, and 300 DPI. Passing a number <= 0 to dpi will reset the DPI to whatever the default value happens to be.

handle :

An RsvgHandle

dpi :

Dots Per Inch (aka Pixels Per Inch)

Since 2.8


rsvg_handle_set_dpi_x_y ()

void                rsvg_handle_set_dpi_x_y             (RsvgHandle *handle,
                                                         double dpi_x,
                                                         double dpi_y);

Sets the DPI for the outgoing pixbuf. Common values are 75, 90, and 300 DPI. Passing a number <= 0 to dpi_x or dpi_y will reset the DPI to whatever the default value happens to be.

handle :

An RsvgHandle

dpi_x :

Dots Per Inch (aka Pixels Per Inch)

dpi_y :

Dots Per Inch (aka Pixels Per Inch)

Since 2.8


rsvg_handle_new ()

RsvgHandle *        rsvg_handle_new                     (void);

Returns a new rsvg handle. Must be freed with g_object_unref. This handle can be used for dynamically loading an image. You need to feed it data using rsvg_handle_write, then call rsvg_handle_close when done. Afterwords, you can render it using Cairo or get a GdkPixbuf from it. When finished, free with g_object_unref(). No more than one image can be loaded with one handle.

Returns :

A new RsvgHandle

rsvg_handle_write ()

gboolean            rsvg_handle_write                   (RsvgHandle *handle,
                                                         const guchar *buf,
                                                         gsize count,
                                                         GError **error);

Loads the next count bytes of the image. This will return TRUE if the data was loaded successful, and FALSE if an error occurred. In the latter case, the loader will be closed, and will not accept further writes. If FALSE is returned, error will be set to an error from the RsvgError domain. Errors from GIOErrorEnum are also possible.

handle :

an RsvgHandle

buf :

pointer to svg data. array length=count. element-type uint8.

count :

length of the buf buffer in bytes

error :

a location to store a GError, or NULL. allow-none.

Returns :

TRUE on success, or FALSE on error

rsvg_handle_close ()

gboolean            rsvg_handle_close                   (RsvgHandle *handle,
                                                         GError **error);

Closes handle, to indicate that loading the image is complete. This will return TRUE if the loader closed successfully. Note that handle isn't freed until g_object_unref is called.

handle :

a RsvgHandle

error :

a location to store a GError, or NULL. allow-none.

Returns :

TRUE on success, or FALSE on error

rsvg_handle_get_base_uri ()

const char *        rsvg_handle_get_base_uri            (RsvgHandle *handle);

Gets the base uri for this RsvgHandle.

handle :

A RsvgHandle

Returns :

the base uri, possibly null

Since 2.8


rsvg_handle_set_base_uri ()

void                rsvg_handle_set_base_uri            (RsvgHandle *handle,
                                                         const char *base_uri);

Set the base URI for this SVG. This can only be called before rsvg_handle_write() has been called.

handle :

A RsvgHandle

base_uri :

The base uri

Since 2.9


rsvg_handle_get_dimensions ()

void                rsvg_handle_get_dimensions          (RsvgHandle *handle,
                                                         RsvgDimensionData *dimension_data);

Get the SVG's size. Do not call from within the size_func callback, because an infinite loop will occur.

handle :

A RsvgHandle

dimension_data :

A place to store the SVG's size

Since 2.14


rsvg_handle_get_dimensions_sub ()

gboolean            rsvg_handle_get_dimensions_sub      (RsvgHandle *handle,
                                                         RsvgDimensionData *dimension_data,
                                                         const char *id);

Get the size of a subelement of the SVG file. Do not call from within the size_func callback, because an infinite loop will occur.

handle :

A RsvgHandle

dimension_data :

A place to store the SVG's size

id :

An element's id within the SVG, or NULL to get the dimension of the whole SVG. For example, if you have a layer called "layer1" for that you want to get the dimension, pass "layer1" as the id.

Since 2.22


rsvg_handle_get_position_sub ()

gboolean            rsvg_handle_get_position_sub        (RsvgHandle *handle,
                                                         RsvgPositionData *position_data,
                                                         const char *id);

Get the position of a subelement of the SVG file. Do not call from within the size_func callback, because an infinite loop will occur.

handle :

A RsvgHandle

position_data :

A place to store the SVG fragment's position.

id :

An element's id within the SVG. For example, if you have a layer called "layer1" for that you want to get the position, pass "layer1" as the id.

Since 2.22


rsvg_handle_has_sub ()

gboolean            rsvg_handle_has_sub                 (RsvgHandle *handle,
                                                         const char *id);

Checks whether the element id exists in the SVG document.

handle :

a RsvgHandle

id :

an element's id within the SVG

Returns :

TRUE if id exists in the SVG document

Since 2.22


rsvg_handle_get_title ()

const char *        rsvg_handle_get_title               (RsvgHandle *handle);

Returns the SVG's title in UTF-8 or NULL. You must make a copy of this title if you wish to use it after handle has been freed.

handle :

An RsvgHandle

Returns :

The SVG's title

Since 2.4


rsvg_handle_get_desc ()

const char *        rsvg_handle_get_desc                (RsvgHandle *handle);

Returns the SVG's description in UTF-8 or NULL. You must make a copy of this description if you wish to use it after handle has been freed.

handle :

An RsvgHandle

Returns :

The SVG's description

Since 2.4


rsvg_handle_get_metadata ()

const char *        rsvg_handle_get_metadata            (RsvgHandle *handle);

Returns the SVG's metadata in UTF-8 or NULL. You must make a copy of this metadata if you wish to use it after handle has been freed.

handle :

An RsvgHandle

Returns :

The SVG's title

Since 2.9


rsvg_handle_new_from_data ()

RsvgHandle *        rsvg_handle_new_from_data           (const guint8 *data,
                                                         gsize data_len,
                                                         GError **error);

Loads the SVG specified by data.

data :

The SVG data

data_len :

The length of data, in bytes

error :

return location for errors

Returns :

A RsvgHandle or NULL if an error occurs.

Since 2.14


rsvg_handle_new_from_file ()

RsvgHandle *        rsvg_handle_new_from_file           (const gchar *file_name,
                                                         GError **error);

Loads the SVG specified by file_name.

file_name :

The file name to load. If built with gnome-vfs, can be a URI.

error :

return location for errors

Returns :

A RsvgHandle or NULL if an error occurs.

Since 2.14


rsvg_handle_free ()

void                rsvg_handle_free                    (RsvgHandle *handle);

Warning

rsvg_handle_free is deprecated and should not be used in newly-written code. Use g_object_unref() instead.

Frees handle.

handle :

An RsvgHandle

RsvgSizeFunc ()

void                (*RsvgSizeFunc)                     (gint *width,
                                                         gint *height,
                                                         gpointer user_data);

Warning

RsvgSizeFunc is deprecated and should not be used in newly-written code.


rsvg_handle_set_size_callback ()

void                rsvg_handle_set_size_callback       (RsvgHandle *handle,
                                                         RsvgSizeFunc size_func,
                                                         gpointer user_data,
                                                         GDestroyNotify user_data_destroy);

Warning

rsvg_handle_set_size_callback is deprecated and should not be used in newly-written code. Set up a cairo matrix and use rsvg_handle_render_cairo() instead.

Sets the sizing function for the handle. This function is called right after the size of the image has been loaded. The size of the image is passed in to the function, which may then modify these values to set the real size of the generated pixbuf. If the image has no associated size, then the size arguments are set to -1.

handle :

An RsvgHandle

size_func :

A sizing function, or NULL

user_data :

User data to pass to size_func, or NULL

user_data_destroy :

Destroy function for user_data, or NULL

rsvg_error_get_type ()

GType               rsvg_error_get_type                 (void);

RSVG_TYPE_ERROR

#define             RSVG_TYPE_ERROR

Property Details

The "base-uri" property

  "base-uri"                 gchar*                : Read / Write / Construct

Base URI.

Default value: NULL


The "desc" property

  "desc"                     gchar*                : Read

SVG file description.

Default value: NULL


The "dpi-x" property

  "dpi-x"                    gdouble               : Read / Write / Construct

Horizontal resolution.

Allowed values: >= 0

Default value: 90


The "dpi-y" property

  "dpi-y"                    gdouble               : Read / Write / Construct

Vertical resolution.

Allowed values: >= 0

Default value: 90


The "em" property

  "em"                       gdouble               : Read

em.

Allowed values: >= 0

Default value: 0


The "ex" property

  "ex"                       gdouble               : Read

ex.

Allowed values: >= 0

Default value: 0


The "height" property

  "height"                   gint                  : Read

Image height.

Allowed values: >= 0

Default value: 0


The "metadata" property

  "metadata"                 gchar*                : Read

SVG file metadata.

Default value: NULL


The "title" property

  "title"                    gchar*                : Read

SVG file title.

Default value: NULL


The "width" property

  "width"                    gint                  : Read

Image width.

Allowed values: >= 0

Default value: 0

07070100039c8d000081a40000000000000000000000014c84748d000010da0000010000010036ffffffffffffffff0000004500000000root/usr/local/share/gtk-doc/html/rsvg-2.0/api-index-deprecated.html Index of deprecated symbols

Index of deprecated symbols

H

rsvg_handle_free, function in RsvgHandle
rsvg_handle_set_size_callback, function in RsvgHandle

P

rsvg_pixbuf_from_file, function in Using RSVG with GdkPixbuf
rsvg_pixbuf_from_file_at_max_size, function in Using RSVG with GdkPixbuf
rsvg_pixbuf_from_file_at_size, function in Using RSVG with GdkPixbuf
rsvg_pixbuf_from_file_at_zoom, function in Using RSVG with GdkPixbuf
rsvg_pixbuf_from_file_at_zoom_with_max, function in Using RSVG with GdkPixbuf

S

RsvgSizeFunc, user_function in RsvgHandle
07070100039c9a000081a40000000000000000000000014c84748d00001cc60000010000010036ffffffffffffffff0000004b00000000root/usr/local/share/gtk-doc/html/rsvg-2.0/rsvg-Using-RSVG-with-cairo.html Using RSVG with cairo

Using RSVG with cairo

Using RSVG with cairo

Description

Details

rsvg_handle_render_cairo ()

gboolean            rsvg_handle_render_cairo            (RsvgHandle *handle,
                                                         cairo_t *cr);

Draws a SVG to a Cairo surface

handle :

A RsvgHandle

cr :

A Cairo renderer

Returns :

TRUE if drawing succeeded.

Since 2.14


rsvg_handle_render_cairo_sub ()

gboolean            rsvg_handle_render_cairo_sub        (RsvgHandle *handle,
                                                         cairo_t *cr,
                                                         const char *id);

Draws a subset of a SVG to a Cairo surface

handle :

A RsvgHandle

cr :

A Cairo renderer

id :

An element's id within the SVG, or NULL to render the whole SVG. For example, if you have a layer called "layer1" that you wish to render, pass "#layer1" as the id.

Returns :

TRUE if drawing succeeded.

Since 2.14

07070100039c92000081a40000000000000000000000014c84748d000001cb0000010000010036ffffffffffffffff0000003400000000root/usr/local/share/gtk-doc/html/rsvg-2.0/left.pngPNG  IHDRw=bKGD pHYs  ~tIME1&[(XIDATx!OPE*ID%~ꊯ"p'ŏ`sܖrKf hmiIz}ܯI.p\`x l?l[,Hk<#c%\AUx[S7n6rzEs1j@NL$ݤi0 5/}\EKIo͓$a0jdFbkIAh>WlC'?tk;|/t*INZ^`y4Nr]׮ J<ڐt`X1@p䀸dZ')hK $V?%]+LsgUK"w53OIENDB`07070100039c87000081a40000000000000000000000014c84748d00000d4e0000010000010036ffffffffffffffff0000003f00000000root/usr/local/share/gtk-doc/html/rsvg-2.0/api-index-2-14.html Index of new symbols in 2.14

Index of new symbols in 2.14

H

rsvg_handle_get_dimensions, function in RsvgHandle
rsvg_handle_get_pixbuf_sub, function in Using RSVG with GdkPixbuf
rsvg_handle_new_from_data, function in RsvgHandle
rsvg_handle_new_from_file, function in RsvgHandle
rsvg_handle_render_cairo, function in Using RSVG with cairo
rsvg_handle_render_cairo_sub, function in Using RSVG with cairo
07070100039c8c000081a40000000000000000000000014c84748d00000b4c0000010000010036ffffffffffffffff0000003e00000000root/usr/local/share/gtk-doc/html/rsvg-2.0/api-index-2-9.html Index of new symbols in 2.9

Index of new symbols in 2.9

H

rsvg_handle_get_metadata, function in RsvgHandle
rsvg_handle_set_base_uri, function in RsvgHandle

I

rsvg_init, function in RsvgHandle

T

rsvg_term, function in RsvgHandle
07070100039c8e000081a40000000000000000000000014c84748d00004d4c0000010000010036ffffffffffffffff0000003f00000000root/usr/local/share/gtk-doc/html/rsvg-2.0/api-index-full.html API Index

API Index

D

RsvgDimensionData, struct in RsvgHandle

E

RsvgError, enum in RsvgHandle
RSVG_ERROR, macro in RsvgHandle
rsvg_error_get_type, function in RsvgHandle
rsvg_error_quark, function in RsvgHandle

H

RsvgHandle, struct in RsvgHandle
RsvgHandle:base-uri, object property in RsvgHandle
RsvgHandle:desc, object property in RsvgHandle
RsvgHandle:dpi-x, object property in RsvgHandle
RsvgHandle:dpi-y, object property in RsvgHandle
RsvgHandle:em, object property in RsvgHandle
RsvgHandle:ex, object property in RsvgHandle
RsvgHandle:height, object property in RsvgHandle
RsvgHandle:metadata, object property in RsvgHandle
RsvgHandle:title, object property in RsvgHandle
RsvgHandle:width, object property in RsvgHandle
RsvgHandleClass, struct in RsvgHandle
RsvgHandleFlags, enum in Using RSVG with GIO
RsvgHandlePrivate, typedef in RsvgHandle
rsvg_handle_close, function in RsvgHandle
rsvg_handle_free, function in RsvgHandle
rsvg_handle_get_base_uri, function in RsvgHandle
rsvg_handle_get_desc, function in RsvgHandle
rsvg_handle_get_dimensions, function in RsvgHandle
rsvg_handle_get_dimensions_sub, function in RsvgHandle
rsvg_handle_get_metadata, function in RsvgHandle
rsvg_handle_get_pixbuf, function in Using RSVG with GdkPixbuf
rsvg_handle_get_pixbuf_sub, function in Using RSVG with GdkPixbuf
rsvg_handle_get_position_sub, function in RsvgHandle
rsvg_handle_get_title, function in RsvgHandle
rsvg_handle_has_sub, function in RsvgHandle
rsvg_handle_new, function in RsvgHandle
rsvg_handle_new_from_data, function in RsvgHandle
rsvg_handle_new_from_file, function in RsvgHandle
rsvg_handle_new_from_gfile_sync, function in Using RSVG with GIO
rsvg_handle_new_from_stream_sync, function in Using RSVG with GIO
rsvg_handle_read_stream_sync, function in Using RSVG with GIO
rsvg_handle_render_cairo, function in Using RSVG with cairo
rsvg_handle_render_cairo_sub, function in Using RSVG with cairo
rsvg_handle_set_base_gfile, function in Using RSVG with GIO
rsvg_handle_set_base_uri, function in RsvgHandle
rsvg_handle_set_dpi, function in RsvgHandle
rsvg_handle_set_dpi_x_y, function in RsvgHandle
rsvg_handle_set_size_callback, function in RsvgHandle
rsvg_handle_write, function in RsvgHandle

I

rsvg_init, function in RsvgHandle

L

LIBRSVG_CHECK_FEATURE, macro in Version check and feature tests
LIBRSVG_CHECK_VERSION, macro in Version check and feature tests
LIBRSVG_HAVE_CSS, macro in Version check and feature tests
LIBRSVG_HAVE_SVGZ, macro in Version check and feature tests
LIBRSVG_MAJOR_VERSION, macro in Version check and feature tests
LIBRSVG_MICRO_VERSION, macro in Version check and feature tests
LIBRSVG_MINOR_VERSION, macro in Version check and feature tests
librsvg_postinit, function in Version check and feature tests
librsvg_preinit, function in Version check and feature tests
LIBRSVG_VERSION, macro in Version check and feature tests
librsvg_version, variable in Version check and feature tests

P

rsvg_pixbuf_from_file, function in Using RSVG with GdkPixbuf
rsvg_pixbuf_from_file_at_max_size, function in Using RSVG with GdkPixbuf
rsvg_pixbuf_from_file_at_size, function in Using RSVG with GdkPixbuf
rsvg_pixbuf_from_file_at_zoom, function in Using RSVG with GdkPixbuf
rsvg_pixbuf_from_file_at_zoom_with_max, function in Using RSVG with GdkPixbuf
RsvgPositionData, struct in RsvgHandle

S

rsvg_set_default_dpi, function in RsvgHandle
rsvg_set_default_dpi_x_y, function in RsvgHandle
RsvgSizeFunc, user_function in RsvgHandle

T

rsvg_term, function in RsvgHandle
RSVG_TYPE_ERROR, macro in RsvgHandle
07070100039c99000081a40000000000000000000000014c84748d000075ed0000010000010036ffffffffffffffff0000004f00000000root/usr/local/share/gtk-doc/html/rsvg-2.0/rsvg-Using-RSVG-with-GdkPixbuf.html Using RSVG with GdkPixbuf

Using RSVG with GdkPixbuf

Using RSVG with GdkPixbuf — How to render SVGs into GdkPixbufs, for easy use in GTK+ applications

Synopsis

GdkPixbuf *         rsvg_handle_get_pixbuf              (RsvgHandle *handle);
GdkPixbuf *         rsvg_handle_get_pixbuf_sub          (RsvgHandle *handle,
                                                         const char *id);
GdkPixbuf *         rsvg_pixbuf_from_file               (const gchar *file_name,
                                                         GError **error);
GdkPixbuf *         rsvg_pixbuf_from_file_at_zoom       (const gchar *file_name,
                                                         double x_zoom,
                                                         double y_zoom,
                                                         GError **error);
GdkPixbuf *         rsvg_pixbuf_from_file_at_size       (const gchar *file_name,
                                                         gint width,
                                                         gint height,
                                                         GError **error);
GdkPixbuf *         rsvg_pixbuf_from_file_at_max_size   (const gchar *file_name,
                                                         gint max_width,
                                                         gint max_height,
                                                         GError **error);
GdkPixbuf *         rsvg_pixbuf_from_file_at_zoom_with_max
                                                        (const gchar *file_name,
                                                         double x_zoom,
                                                         double y_zoom,
                                                         gint max_width,
                                                         gint max_height,
                                                         GError **error);

Description

GdkPixbuf is a library for image loading and manipulation. It is part of the cross-platform GTK+ widget toolkit.

Details

rsvg_handle_get_pixbuf ()

GdkPixbuf *         rsvg_handle_get_pixbuf              (RsvgHandle *handle);

Returns the pixbuf loaded by handle. The pixbuf returned will be reffed, so the caller of this function must assume that ref. If insufficient data has been read to create the pixbuf, or an error occurred in loading, then NULL will be returned. Note that the pixbuf may not be complete until rsvg_handle_close has been called.

handle :

An RsvgHandle

Returns :

the pixbuf loaded by handle, or NULL.

rsvg_handle_get_pixbuf_sub ()

GdkPixbuf *         rsvg_handle_get_pixbuf_sub          (RsvgHandle *handle,
                                                         const char *id);

Returns the pixbuf loaded by handle. The pixbuf returned will be reffed, so the caller of this function must assume that ref. If insufficient data has been read to create the pixbuf, or an error occurred in loading, then NULL will be returned. Note that the pixbuf may not be complete until rsvg_handle_close has been called.

handle :

An RsvgHandle

id :

The id of an element inside the SVG, or NULL to render the whole SVG. For example, if you have a layer called "layer1" that you wish to render, pass "#layer1" as the id.

Returns :

the pixbuf loaded by handle, or NULL.

Since 2.14


rsvg_pixbuf_from_file ()

GdkPixbuf *         rsvg_pixbuf_from_file               (const gchar *file_name,
                                                         GError **error);

Warning

rsvg_pixbuf_from_file is deprecated and should not be used in newly-written code. Set up a cairo matrix and use rsvg_handle_new_from_file() + rsvg_handle_render_cairo() instead.

Loads a new GdkPixbuf from file_name and returns it. The caller must assume the reference to the reurned pixbuf. If an error occurred, error is set and NULL is returned.

file_name :

A file name

error :

return location for errors

Returns :

A newly allocated GdkPixbuf, or NULL

rsvg_pixbuf_from_file_at_zoom ()

GdkPixbuf *         rsvg_pixbuf_from_file_at_zoom       (const gchar *file_name,
                                                         double x_zoom,
                                                         double y_zoom,
                                                         GError **error);

Warning

rsvg_pixbuf_from_file_at_zoom is deprecated and should not be used in newly-written code. Set up a cairo matrix and use rsvg_handle_new_from_file() + rsvg_handle_render_cairo() instead.

Loads a new GdkPixbuf from file_name and returns it. This pixbuf is scaled from the size indicated by the file by a factor of x_zoom and y_zoom. The caller must assume the reference to the returned pixbuf. If an error occurred, error is set and NULL is returned.

file_name :

A file name

x_zoom :

The horizontal zoom factor

y_zoom :

The vertical zoom factor

error :

return location for errors

Returns :

A newly allocated GdkPixbuf, or NULL

rsvg_pixbuf_from_file_at_size ()

GdkPixbuf *         rsvg_pixbuf_from_file_at_size       (const gchar *file_name,
                                                         gint width,
                                                         gint height,
                                                         GError **error);

Warning

rsvg_pixbuf_from_file_at_size is deprecated and should not be used in newly-written code. Set up a cairo matrix and use rsvg_handle_new_from_file() + rsvg_handle_render_cairo() instead.

Loads a new GdkPixbuf from file_name and returns it. This pixbuf is scaled from the size indicated to the new size indicated by width and height. If either of these are -1, then the default size of the image being loaded is used. The caller must assume the reference to the returned pixbuf. If an error occurred, error is set and NULL is returned.

file_name :

A file name

width :

The new width, or -1

height :

The new height, or -1

error :

return location for errors

Returns :

A newly allocated GdkPixbuf, or NULL

rsvg_pixbuf_from_file_at_max_size ()

GdkPixbuf *         rsvg_pixbuf_from_file_at_max_size   (const gchar *file_name,
                                                         gint max_width,
                                                         gint max_height,
                                                         GError **error);

Warning

rsvg_pixbuf_from_file_at_max_size is deprecated and should not be used in newly-written code. Set up a cairo matrix and use rsvg_handle_new_from_file() + rsvg_handle_render_cairo() instead.

Loads a new GdkPixbuf from file_name and returns it. This pixbuf is uniformly scaled so that the it fits into a rectangle of size max_width * max_height. The caller must assume the reference to the returned pixbuf. If an error occurred, error is set and NULL is returned.

file_name :

A file name

max_width :

The requested max width

max_height :

The requested max heigh

error :

return location for errors

Returns :

A newly allocated GdkPixbuf, or NULL

rsvg_pixbuf_from_file_at_zoom_with_max ()

GdkPixbuf *         rsvg_pixbuf_from_file_at_zoom_with_max
                                                        (const gchar *file_name,
                                                         double x_zoom,
                                                         double y_zoom,
                                                         gint max_width,
                                                         gint max_height,
                                                         GError **error);

Warning

rsvg_pixbuf_from_file_at_zoom_with_max is deprecated and should not be used in newly-written code. Set up a cairo matrix and use rsvg_handle_new_from_file() + rsvg_handle_render_cairo() instead.

Loads a new GdkPixbuf from file_name and returns it. This pixbuf is scaled from the size indicated by the file by a factor of x_zoom and y_zoom. If the resulting pixbuf would be larger than max_width/max_heigh it is uniformly scaled down to fit in that rectangle. The caller must assume the reference to the returned pixbuf. If an error occurred, error is set and NULL is returned.

file_name :

A file name

x_zoom :

The horizontal zoom factor

y_zoom :

The vertical zoom factor

max_width :

The requested max width

max_height :

The requested max heigh

error :

return location for errors

Returns :

A newly allocated GdkPixbuf, or NULL
07070100039c96000081a40000000000000000000000014c84748d000020b10000010000010036ffffffffffffffff0000003c00000000root/usr/local/share/gtk-doc/html/rsvg-2.0/rsvg-2.0.devhelp 07070100039c90000081a40000000000000000000000014c84748d000011920000010000010036ffffffffffffffff0000003600000000root/usr/local/share/gtk-doc/html/rsvg-2.0/index.html RSVG Libary Reference Manual

For RSVG version 2.31.0 . The latest version of this documentation can be found on-line at the GNOME Library.

Permission is granted to copy, distribute and/or modify this document under the terms of the GNU General Public Licence published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. You may obtain a copy of the GNU General Public Licence from the Free Software Foundation at GNU Licences web site or by writing to:


          The Free Software Foundation, Inc.,
          51 Franklin St – Fifth Floor,
          BostonMA 02110-1301,
          USA
        


07070100039c91000081a40000000000000000000000014c84748d000024840000010000010036ffffffffffffffff0000003600000000root/usr/local/share/gtk-doc/html/rsvg-2.0/index.sgml 07070100039c8f000081a40000000000000000000000014c84748d0000028e0000010000010036ffffffffffffffff0000003400000000root/usr/local/share/gtk-doc/html/rsvg-2.0/home.pngPNG  IHDRw=bKGD pHYs  ~tIME1KvIDATxՕkq?rCp ~CnpCAAJ .B-\'G]:ܠC -(8 Ԁ!fDғklbRoyxwpðIJ<of_-@RHf֟t^ښ$Q|pgv;X^^&s(bwwZF9&3඙ ^IRZUE.0Z]]U PYM8HGIekqqҀ! $۬3n e{-/seeeÌXOͷ$8==USQRR'9-s+B^ Cەs+%<7W :2IENDB`07070100039c89000081a40000000000000000000000014c84748d00000ba10000010000010036ffffffffffffffff0000003f00000000root/usr/local/share/gtk-doc/html/rsvg-2.0/api-index-2-32.html Index of new symbols in 2.32 07070100039c97000081a40000000000000000000000014c84748d0000286d0000010000010036ffffffffffffffff0000003d00000000root/usr/local/share/gtk-doc/html/rsvg-2.0/rsvg-2.0.devhelp2 07070100039c88000081a40000000000000000000000014c84748d000009cc0000010000010036ffffffffffffffff0000003f00000000root/usr/local/share/gtk-doc/html/rsvg-2.0/api-index-2-22.html Index of new symbols in 2.22

Index of new symbols in 2.22

H

rsvg_handle_get_dimensions_sub, function in RsvgHandle
rsvg_handle_get_position_sub, function in RsvgHandle
rsvg_handle_has_sub, function in RsvgHandle
07070100039c9e000081a40000000000000000000000014c84748d000001960000010000010036ffffffffffffffff0000003200000000root/usr/local/share/gtk-doc/html/rsvg-2.0/up.pngPNG  IHDRw=bKGD pHYs  ~tIME2.E#IDATx=J@Fo] !+2[Z<@/9|t$D9nnBjBRIsI:H8UPN1fcsN95M㧖ɵ 束1~pEe$I 7nrDf!;`'ykI䲤sI_]y^^I>O>?YBIENDB`07070100039c86000081a40000000000000000000000014c84748d000008c50000010000010036ffffffffffffffff0000004400000000root/usr/local/share/gtk-doc/html/rsvg-2.0/annotation-glossary.html Annotation Glossary

Annotation Glossary

A

array

Parameter points to an array of items.

allow-none

NULL is ok, both for passing and for returning.

E

element-type

Generics and defining elements of containers and arrays.

07070100039c93000081a40000000000000000000000014c84748d00000a7e0000010000010036ffffffffffffffff0000003800000000root/usr/local/share/gtk-doc/html/rsvg-2.0/licence.html Appendix A. Licence

Appendix A. Licence

This library is free software; you can redistribute it and/or modify it under the terms of the GNU General Public Licence as published by the Free Software Foundation; either version 2 of the Licence, or (at your option) any later version.

This library is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public Licence for more details.

You may obtain a copy of the GNU General Public Licence from the Free Software Foundation at GNU Licences web site or by writing to:


        The Free Software Foundation, Inc.,
        51 Franklin St – Fifth Floor,
        BostonMA 02110-1301,
        USA
      

07070100039c9d000081a40000000000000000000000014c84748d000013c80000010000010036ffffffffffffffff0000003500000000root/usr/local/share/gtk-doc/html/rsvg-2.0/style.css.synopsis, .classsynopsis { /* tango:aluminium 1/2 */ background: #eeeeec; border: solid 1px #d3d7cf; padding: 0.5em; } .programlisting { /* tango:sky blue 0/1 */ background: #e6f3ff; border: solid 1px #729fcf; padding: 0.5em; } .variablelist { padding: 4px; margin-left: 3em; } .variablelist td:first-child { vertical-align: top; } @media screen { sup a.footnote { position: relative; top: 0em ! important; } /* this is needed so that the local anchors are displayed below the naviagtion */ div.footnote a[name], div.refnamediv a[name], div.refsect1 a[name], div.refsect2 a[name], div.index a[name], div.glossary a[name], div.sect1 a[name] { position: relative; padding-top:4.5em; } /* this seems to be a bug in the xsl style sheets when generating indexes */ div.index div.index { top: 0em; } /* make space for the fixed navigation bar and add space at the bottom so that * link targets appear somewhat close to top */ body { padding-top: 3.2em; padding-bottom: 20em; } /* style and size the navigation bar */ table.navigation#top { position: fixed; /* tango:scarlet red 0/1 */ background: #ffe6e6; border: solid 1px #ef2929; margin-top: 0; margin-bottom: 0; top: 0; left: 0; height: 3em; z-index: 10; } .navigation a, .navigation a:visited { /* tango:scarlet red 3 */ color: #a40000; } .navigation a:hover { /* tango:scarlet red 1 */ color: #ef2929; } td.shortcuts { /* tango:scarlet red 1 */ color: #ef2929; font-size: 80%; white-space: nowrap; } } @media print { table.navigation { visibility: collapse; display: none; } div.titlepage table.navigation { visibility: visible; display: table; /* tango:scarlet red 0/1 */ background: #ffe6e6; border: solid 1px #ef2929; margin-top: 0; margin-bottom: 0; top: 0; left: 0; height: 3em; } } .navigation .title { font-size: 200%; } div.gallery-float { float: left; padding: 10px; } div.gallery-float img { border-style: none; } div.gallery-spacer { clear: both; } a, a:visited { text-decoration: none; /* tango:sky blue 2 */ color: #3465a4; } a:hover { text-decoration: underline; /* tango:sky blue 1 */ color: #729fcf; } div.table table { border-collapse: collapse; border-spacing: 0px; /* tango:aluminium 3 */ border: solid 1px #babdb6; } div.table table td, div.table table th { /* tango:aluminium 3 */ border: solid 1px #babdb6; padding: 3px; vertical-align: top; } div.table table th { /* tango:aluminium 2 */ background-color: #d3d7cf; } hr { /* tango:aluminium 3 */ color: #babdb6; background: #babdb6; border: none 0px; height: 1px; clear: both; } .footer { padding-top: 3.5em; /* tango:aluminium 3 */ color: #babdb6; text-align: center; font-size: 80%; } .warning { /* tango:orange 0/1 */ background: #ffeed9; border-color: #ffb04f; } .note { /* tango:chameleon 0/0.5 */ background: #d8ffb2; border-color: #abf562; } .note, .warning { padding: 0.5em; border-width: 1px; border-style: solid; } .note h3, .warning h3 { margin-top: 0.0em } .note p, .warning p { margin-bottom: 0.0em } /* blob links */ h2 .extralinks, h3 .extralinks { float: right; /* tango:aluminium 3 */ color: #babdb6; font-size: 80%; font-weight: normal; } /* code listings */ .listing_code .programlisting .cbracket { color: #a40000; } /* tango: scarlet red 3 */ .listing_code .programlisting .comment { color: #a1a39d; } /* tango: aluminium 4 */ .listing_code .programlisting .function { color: #000000; font-weight: bold; } .listing_code .programlisting .function a { color: #11326b; font-weight: bold; } /* tango: sky blue 4 */ .listing_code .programlisting .keyword { color: #4e9a06; } /* tango: chameleon 3 */ .listing_code .programlisting .linenum { color: #babdb6; } /* tango: aluminium 3 */ .listing_code .programlisting .normal { color: #000000; } .listing_code .programlisting .number { color: #75507b; } /* tango: plum 2 */ .listing_code .programlisting .preproc { color: #204a87; } /* tango: sky blue 3 */ .listing_code .programlisting .string { color: #c17d11; } /* tango: chocolate 2 */ .listing_code .programlisting .type { color: #000000; } .listing_code .programlisting .type a { color: #11326b; } /* tango: sky blue 4 */ .listing_code .programlisting .symbol { color: #ce5c00; } /* tango: orange 3 */ .listing_frame { /* tango:sky blue 1 */ border: solid 1px #729fcf; padding: 0px; } .listing_lines, .listing_code { margin-top: 0px; margin-bottom: 0px; padding: 0.5em; } .listing_lines { /* tango:sky blue 0.5 */ background: #a6c5e3; /* tango:aluminium 6 */ color: #2e3436; } .listing_code { /* tango:sky blue 0 */ background: #e6f3ff; } .listing_code .programlisting { /* override from previous */ border: none 0px; padding: 0px; } .listing_lines pre, .listing_code pre { margin: 0px; } 07070100039c94000081a40000000000000000000000014c84748d0000072a0000010000010036ffffffffffffffff0000003c00000000root/usr/local/share/gtk-doc/html/rsvg-2.0/object-tree.html Object Hierarchy

Object Hierarchy

    GObject
        RsvgHandle
07070100039c98000081a40000000000000000000000014c84748d00004ee30000010000010036ffffffffffffffff0000004900000000root/usr/local/share/gtk-doc/html/rsvg-2.0/rsvg-Using-RSVG-with-GIO.html Using RSVG with GIO

Using RSVG with GIO

Using RSVG with GIO

Synopsis

enum                RsvgHandleFlags;
void                rsvg_handle_set_base_gfile          (RsvgHandle *handle,
                                                         GFile *base_file);
gboolean            rsvg_handle_read_stream_sync        (RsvgHandle *handle,
                                                         GInputStream *stream,
                                                         GCancellable *cancellable,
                                                         GError **error);
RsvgHandle *        rsvg_handle_new_from_gfile_sync     (GFile *file,
                                                         RsvgHandleFlags flags,
                                                         GCancellable *cancellable,
                                                         GError **error);
RsvgHandle *        rsvg_handle_new_from_stream_sync    (GInputStream *input_stream,
                                                         GFile *base_file,
                                                         RsvgHandleFlags flags,
                                                         GCancellable *cancellable,
                                                         GError **error);

Description

Details

enum RsvgHandleFlags

typedef enum {
    RSVG_HANDLE_FLAGS_NONE        = 0,
} RsvgHandleFlags;

rsvg_handle_set_base_gfile ()

void                rsvg_handle_set_base_gfile          (RsvgHandle *handle,
                                                         GFile *base_file);

Set the base URI for handle from file. Note: This function may only be called before rsvg_handle_write() or rsvg_handle_read_stream_sync() has been called.

handle :

a RsvgHandle

file :

a GFile

Since 2.32


rsvg_handle_read_stream_sync ()

gboolean            rsvg_handle_read_stream_sync        (RsvgHandle *handle,
                                                         GInputStream *stream,
                                                         GCancellable *cancellable,
                                                         GError **error);

Reads stream and writes the data from it to handle.

If cancellable is not NULL, then the operation can be cancelled by triggering the cancellable object from another thread. If the operation was cancelled, the error G_IO_ERROR_CANCELLED will be returned.

handle :

a RsvgHandle

stream :

a GInputStream

cancellable :

a GCancellable, or NULL. allow-none.

error :

a location to store a GError, or NULL. allow-none.

Returns :

TRUE if reading stream succeeded, or FALSE otherwise with error filled in

Since 2.32


rsvg_handle_new_from_gfile_sync ()

RsvgHandle *        rsvg_handle_new_from_gfile_sync     (GFile *file,
                                                         RsvgHandleFlags flags,
                                                         GCancellable *cancellable,
                                                         GError **error);

Creates a new RsvgHandle for file.

If cancellable is not NULL, then the operation can be cancelled by triggering the cancellable object from another thread. If the operation was cancelled, the error G_IO_ERROR_CANCELLED will be returned.

file :

a GFile

flags :

flags from RsvgHandleFlags

cancellable :

a GCancellable, or NULL. allow-none.

error :

a location to store a GError, or NULL. allow-none.

Returns :

a new RsvgHandle on success, or NULL with error filled in

Since 2.32


rsvg_handle_new_from_stream_sync ()

RsvgHandle *        rsvg_handle_new_from_stream_sync    (GInputStream *input_stream,
                                                         GFile *base_file,
                                                         RsvgHandleFlags flags,
                                                         GCancellable *cancellable,
                                                         GError **error);

Creates a new RsvgHandle for stream.

If cancellable is not NULL, then the operation can be cancelled by triggering the cancellable object from another thread. If the operation was cancelled, the error G_IO_ERROR_CANCELLED will be returned.

stream :

a GInputStream

base_file :

a GFile, or NULL. allow-none.

flags :

flags from RsvgHandleFlags

cancellable :

a GCancellable, or NULL. allow-none.

error :

a location to store a GError, or NULL. allow-none.

Returns :

a new RsvgHandle on success, or NULL with error filled in

Since 2.32

07070100039c74000041ed0000000000000000000000034c847b7d000000000000010000010036ffffffffffffffff0000001700000000root/usr/local/include07070100039c75000041ed0000000000000000000000034c847b7d000000000000010000010036ffffffffffffffff0000002300000000root/usr/local/include/librsvg-2.007070100039c76000041ed0000000000000000000000024c847b7d000000000000010000010036ffffffffffffffff0000002b00000000root/usr/local/include/librsvg-2.0/librsvg07070100039c7a000081a40000000000000000000000014c84748600001d360000010000010036ffffffffffffffff0000003200000000root/usr/local/include/librsvg-2.0/librsvg/rsvg.h/* -*- Mode: C; tab-width: 4; indent-tabs-mode: nil; c-basic-offset: 4 -*- */ /* vim: set sw=4 sts=4 ts=4 expandtab: */ /* rsvg.h: SAX-based renderer for SVG files into a GdkPixbuf. Copyright (C) 2000 Eazel, Inc. This program is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. You should have received a copy of the GNU Library General Public License along with this program; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA. Author: Raph Levien */ #ifndef RSVG_H #define RSVG_H #include #include #include G_BEGIN_DECLS #define RSVG_TYPE_HANDLE (rsvg_handle_get_type ()) #define RSVG_HANDLE(obj) (G_TYPE_CHECK_INSTANCE_CAST ((obj), RSVG_TYPE_HANDLE, RsvgHandle)) #define RSVG_HANDLE_CLASS(klass) (G_TYPE_CHECK_CLASS_CAST ((klass), RSVG_TYPE_HANDLE, RsvgHandleClass)) #define RSVG_IS_HANDLE(obj) (G_TYPE_CHECK_INSTANCE_TYPE ((obj), RSVG_TYPE_HANDLE)) #define RSVG_IS_HANDLE_CLASS(klass) (G_TYPE_CHECK_CLASS_TYPE ((klass), RSVG_TYPE_HANDLE)) #define RSVG_HANDLE_GET_CLASS(obj) (G_TYPE_INSTANCE_GET_CLASS ((obj), RSVG_TYPE_HANDLE, RsvgHandleClass)) GType rsvg_handle_get_type (void); /** * An enumeration representing possible error domains */ typedef enum { RSVG_ERROR_FAILED } RsvgError; /** * */ #define RSVG_ERROR (rsvg_error_quark ()) GQuark rsvg_error_quark (void) G_GNUC_CONST; /** * The RsvgHandle is an object representing the parsed form of a SVG */ typedef struct _RsvgHandle RsvgHandle; typedef struct RsvgHandlePrivate RsvgHandlePrivate; typedef struct _RsvgHandleClass RsvgHandleClass; typedef struct _RsvgDimensionData RsvgDimensionData; typedef struct _RsvgPositionData RsvgPositionData; struct _RsvgHandleClass { GObjectClass parent; gpointer _abi_padding[15]; }; struct _RsvgHandle { GObject parent; RsvgHandlePrivate *priv; gpointer _abi_padding[15]; }; /* RsvgDimensionData */ struct _RsvgDimensionData { /** * SVG's width, in pixels */ int width; /** * SVG's height, in pixels */ int height; /** * em */ gdouble em; /** * ex */ gdouble ex; }; /** * Position of an SVG fragment. **/ struct _RsvgPositionData { int x; int y; }; void rsvg_init (void); void rsvg_term (void); void rsvg_set_default_dpi (double dpi); void rsvg_set_default_dpi_x_y (double dpi_x, double dpi_y); void rsvg_handle_set_dpi (RsvgHandle * handle, double dpi); void rsvg_handle_set_dpi_x_y (RsvgHandle * handle, double dpi_x, double dpi_y); RsvgHandle *rsvg_handle_new (void); gboolean rsvg_handle_write (RsvgHandle * handle, const guchar * buf, gsize count, GError ** error); gboolean rsvg_handle_close (RsvgHandle * handle, GError ** error); GdkPixbuf *rsvg_handle_get_pixbuf (RsvgHandle * handle); GdkPixbuf *rsvg_handle_get_pixbuf_sub (RsvgHandle * handle, const char *id); G_CONST_RETURN char *rsvg_handle_get_base_uri (RsvgHandle * handle); void rsvg_handle_set_base_uri (RsvgHandle * handle, const char *base_uri); void rsvg_handle_get_dimensions (RsvgHandle * handle, RsvgDimensionData * dimension_data); gboolean rsvg_handle_get_dimensions_sub (RsvgHandle * handle, RsvgDimensionData * dimension_data, const char *id); gboolean rsvg_handle_get_position_sub (RsvgHandle * handle, RsvgPositionData * position_data, const char *id); gboolean rsvg_handle_has_sub (RsvgHandle * handle, const char *id); /* GIO APIs */ typedef enum { RSVG_HANDLE_FLAGS_NONE = 0, } RsvgHandleFlags; void rsvg_handle_set_base_gfile (RsvgHandle *handle, GFile *base_file); gboolean rsvg_handle_read_stream_sync (RsvgHandle *handle, GInputStream *stream, GCancellable *cancellable, GError **error); RsvgHandle *rsvg_handle_new_from_gfile_sync (GFile *file, RsvgHandleFlags flags, GCancellable *cancellable, GError **error); RsvgHandle *rsvg_handle_new_from_stream_sync (GInputStream *input_stream, GFile *base_file, RsvgHandleFlags flags, GCancellable *cancellable, GError **error); /* Accessibility API */ G_CONST_RETURN char *rsvg_handle_get_title (RsvgHandle * handle); G_CONST_RETURN char *rsvg_handle_get_desc (RsvgHandle * handle); G_CONST_RETURN char *rsvg_handle_get_metadata (RsvgHandle * handle); RsvgHandle *rsvg_handle_new_from_data (const guint8 * data, gsize data_len, GError ** error); RsvgHandle *rsvg_handle_new_from_file (const gchar * file_name, GError ** error); #ifndef RSVG_DISABLE_DEPRECATED void rsvg_handle_free (RsvgHandle * handle); /** * RsvgSizeFunc (): * @width: Pointer to where to set/store the width * @height: Pointer to where to set/store the height * @user_data: User data pointer * * Function to let a user of the library specify the SVG's dimensions * @width: the ouput width the SVG should be * @height: the output height the SVG should be * @user_data: user data * * Deprecated: Set up a cairo matrix and use rsvg_handle_render_cairo() instead. */ typedef void (*RsvgSizeFunc) (gint * width, gint * height, gpointer user_data); void rsvg_handle_set_size_callback (RsvgHandle * handle, RsvgSizeFunc size_func, gpointer user_data, GDestroyNotify user_data_destroy); /* GdkPixbuf convenience API */ GdkPixbuf *rsvg_pixbuf_from_file (const gchar * file_name, GError ** error); GdkPixbuf *rsvg_pixbuf_from_file_at_zoom (const gchar * file_name, double x_zoom, double y_zoom, GError ** error); GdkPixbuf *rsvg_pixbuf_from_file_at_size (const gchar * file_name, gint width, gint height, GError ** error); GdkPixbuf *rsvg_pixbuf_from_file_at_max_size (const gchar * file_name, gint max_width, gint max_height, GError ** error); GdkPixbuf *rsvg_pixbuf_from_file_at_zoom_with_max (const gchar * file_name, double x_zoom, double y_zoom, gint max_width, gint max_height, GError ** error); #endif /* RSVG_DISABLE_DEPRECATED */ G_END_DECLS #endif /* RSVG_H */ 07070100039c79000081a40000000000000000000000014c847486000005090000010000010036ffffffffffffffff0000003800000000root/usr/local/include/librsvg-2.0/librsvg/rsvg-cairo.h/* -*- Mode: C; tab-width: 4; indent-tabs-mode: nil; c-basic-offset: 4 -*- */ /* vim: set sw=4 sts=4 ts=4 expandtab: */ /* rsvg-cairo.h: SAX-based renderer for SVG files using cairo Copyright (C) 2005 Red Hat, Inc. This program is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. You should have received a copy of the GNU Library General Public License along with this program; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA. Author: Carl Worth */ #ifndef RSVG_CAIRO_H #define RSVG_CAIRO_H #include G_BEGIN_DECLS gboolean rsvg_handle_render_cairo (RsvgHandle * handle, cairo_t * cr); gboolean rsvg_handle_render_cairo_sub (RsvgHandle * handle, cairo_t * cr, const char *id); G_END_DECLS #endif 07070100039c77000081a40000000000000000000000014c8474860000017e0000010000010036ffffffffffffffff0000004000000000root/usr/local/include/librsvg-2.0/librsvg/librsvg-enum-types.h #ifndef __LIBRSVG_ENUM_TYPES_H__ #define __LIBRSVG_ENUM_TYPES_H__ #include G_BEGIN_DECLS /* enumerations from "rsvg.h" */ GType rsvg_error_get_type (void); #define RSVG_TYPE_ERROR (rsvg_error_get_type()) GType rsvg_handle_flags_get_type (void); #define RSVG_TYPE_HANDLE_FLAGS (rsvg_handle_flags_get_type()) G_END_DECLS #endif /* __LIBRSVG_ENUM_TYPES_H__ */ 07070100039c78000081a40000000000000000000000014c8474860000036b0000010000010036ffffffffffffffff0000003e00000000root/usr/local/include/librsvg-2.0/librsvg/librsvg-features.h#ifndef LIBRSVG_FEATURES_H #define LIBRSVG_FEATURES_H 1 #define LIBRSVG_MAJOR_VERSION (2) #define LIBRSVG_MINOR_VERSION (31) #define LIBRSVG_MICRO_VERSION (0) #define LIBRSVG_VERSION "2.31.0" #define LIBRSVG_CHECK_VERSION(major,minor,micro) \ (LIBRSVG_MAJOR_VERSION > (major) || \ (LIBRSVG_MAJOR_VERSION == (major) && LIBRSVG_MINOR_VERSION > (minor)) || \ (LIBRSVG_MAJOR_VERSION == (major) && LIBRSVG_MINOR_VERSION == (minor) && LIBRSVG_MICRO_VERSION >= (micro))) #define LIBRSVG_HAVE_SVGZ (1) #define LIBRSVG_HAVE_CSS (1) #define LIBRSVG_CHECK_FEATURE(FEATURE) (defined(LIBRSVG_HAVE_##FEATURE) && LIBRSVG_HAVE_##FEATURE) extern const unsigned int librsvg_major_version, librsvg_minor_version, librsvg_micro_version; extern const char *librsvg_version; void librsvg_preinit(void *app, void *modinfo); void librsvg_postinit(void *app, void *modinfo); #endif 07070100039c7b000041ed0000000000000000000000034c847b7d000000000000010000010036ffffffffffffffff0000001300000000root/usr/local/lib07070100039c7c000081a40000000000000000000000014c8474860009ff580000010000010036ffffffffffffffff0000001f00000000root/usr/local/lib/librsvg-2.a! / 1283748965 0 0 0 6408 ` |||||||||||FFFFRRRRRRRR}D}D}D}D}D}D}D}D}D}D}D}D}D}D}D}D}D}D}D}D}D | | | | | | | | |DDDDDDDDDDDDDDD?T?TZ Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z ,,,,, \ \ \ \ \ \ \4444444444444444444444444444;Ddldldldldldldldldldldldldldldldldldldldldldldldldldldldldldldldldldldldldldldldldldlp4p4\\\\\\\\\\     1L S$ S$ l l l l l _rsvg_affine_equal_rsvg_affine_rectilinear_rsvg_affine_expansion_rsvg_affine_translate_rsvg_affine_shear_rsvg_affine_rotate_rsvg_affine_scale_rsvg_affine_identity_rsvg_affine_multiply_rsvg_affine_flip_rsvg_affine_invertlibrsvg_versionlibrsvg_micro_versionlibrsvg_minor_versionlibrsvg_major_versionrsvg_bpath_def_art_finishrsvg_bpath_def_closepathrsvg_bpath_def_curvetorsvg_bpath_def_linetorsvg_bpath_def_movetorsvg_bpath_def_freersvg_bpath_def_new_fromrsvg_bpath_def_newrsvg_css_parse_xml_attribute_stringrsvg_css_parse_overflowrsvg_css_parse_aspect_ratiorsvg_css_parse_number_optional_numberrsvg_css_parse_font_familyrsvg_css_parse_font_stretchrsvg_css_parse_font_weightrsvg_css_parse_font_variantrsvg_css_parse_font_stylersvg_css_parse_timersvg_css_parse_frequencyrsvg_css_parse_anglersvg_css_parse_opacityrsvg_css_parse_listrsvg_css_parse_color_rsvg_css_hand_normalize_length_rsvg_css_normalize_length_rsvg_css_normalize_font_size_rsvg_css_parse_lengthrsvg_css_parse_number_listrsvg_css_parse_vboxrsvg_defs_resolve_allrsvg_defs_add_resolverrsvg_defs_freersvg_defs_register_memoryrsvg_defs_register_namersvg_defs_setrsvg_defs_lookuprsvg_defs_set_base_urirsvg_defs_newrsvg_new_imagersvg_preserve_aspect_ratiorsvg_pixbuf_new_from_href_rsvg_acquire_xlink_href_resourcersvg_get_file_pathrsvg_radial_gradient_fix_fallbackrsvg_linear_gradient_fix_fallbackrsvg_new_patternrsvg_new_radial_gradientrsvg_new_linear_gradientrsvg_new_stoprsvg_paint_server_unrefrsvg_paint_server_refrsvg_paint_server_parsersvg_pattern_fix_fallbackrsvg_parse_pathrsvg_handle_new_from_filersvg_handle_new_from_datarsvg_new_filter_primitive_tilersvg_new_filter_primitive_specular_lightingrsvg_new_filter_primitive_diffuse_lightingrsvg_new_filter_primitive_light_sourcersvg_new_filter_primitive_imagersvg_new_filter_primitive_turbulencersvg_new_filter_primitive_displacement_maprsvg_new_filter_primitive_floodrsvg_new_filter_primitive_compositersvg_new_filter_primitive_erodersvg_new_node_component_transfer_functionrsvg_new_filter_primitive_component_transferrsvg_new_filter_primitive_colour_matrixrsvg_new_filter_primitive_merge_nodersvg_new_filter_primitive_mergersvg_new_filter_primitive_offsetrsvg_new_filter_primitive_gaussian_blurrsvg_new_filter_primitive_convolve_matrixrsvg_new_filter_primitive_blendrsvg_new_filterrsvg_filter_parsersvg_filter_renderrsvg_art_affine_imagersvg_alpha_blt_rsvg_pixbuf_new_clearedrsvg_render_markersrsvg_marker_parsersvg_marker_renderrsvg_new_markerrsvg_new_clip_pathrsvg_clip_path_parsersvg_mask_parsersvg_get_url_stringrsvg_new_maskrsvg_new_ellipsersvg_new_circlersvg_new_rectrsvg_new_linersvg_new_polylinersvg_new_polygonrsvg_new_pathrsvg_new_switchrsvg_new_defsrsvg_new_symbolrsvg_new_usersvg_new_svg_rsvg_node_svg_apply_attsrsvg_node_group_packrsvg_pop_def_grouprsvg_new_group_rsvg_node_finalize_rsvg_node_free_rsvg_node_init_rsvg_node_draw_childrenrsvg_node_drawrsvg_state_reconstructrsvg_state_reinherit_toprsvg_state_poprsvg_state_pushrsvg_property_bag_enumeratersvg_property_bag_freersvg_property_bag_refrsvg_property_bag_newrsvg_state_free_allrsvg_state_parentrsvg_current_statersvg_property_bag_sizersvg_parse_style_attrsrsvg_parse_transformrsvg_parse_cssbufferrsvg_parse_stylersvg_parse_style_pairsrsvg_property_bag_lookuprsvg_state_inheritrsvg_state_overridersvg_state_dominatersvg_state_reinheritrsvg_state_clonersvg_state_finalizersvg_state_reinitrsvg_state_initrsvg_dpi_percentagersvg_viewport_percentagersvg_new_trefrsvg_new_tspanrsvg_new_textrsvg_text_render_textrsvg_make_valid_utf8rsvg_eval_switch_attributes_rsvg_pop_view_box_rsvg_push_view_boxrsvg_bbox_cliprsvg_bbox_insertrsvg_bbox_initrsvg_get_image_of_nodersvg_add_clipping_rectrsvg_render_imagersvg_render_pathrsvg_push_discrete_layerrsvg_pop_discrete_layerrsvg_termrsvg_initrsvg_handle_new_from_stream_syncrsvg_handle_new_from_gfile_syncrsvg_handle_read_stream_syncrsvg_handle_closersvg_handle_writersvg_handle_set_size_callbackrsvg_handle_set_dpi_x_yrsvg_handle_set_dpirsvg_set_default_dpi_x_yrsvg_set_default_dpirsvg_handle_has_subrsvg_handle_get_position_subrsvg_handle_get_dimensions_subrsvg_handle_get_dimensionsrsvg_handle_get_descrsvg_handle_get_titlersvg_handle_get_metadatarsvg_render_freersvg_drawing_ctx_freersvg_return_if_fail_warningrsvg_error_quarkrsvg_handle_set_base_gfilersvg_handle_set_base_urirsvg_get_base_uri_from_filenamersvg_SAX_handler_struct_initrsvg_handle_get_base_urirsvg_node_set_attsrsvg_internal_dpi_yrsvg_internal_dpi_xrsvg_handle_flags_get_typersvg_error_get_typersvg_pixbuf_to_cairorsvg_cairo_to_pixbufrsvg_cairo_get_image_of_nodersvg_cairo_add_clipping_rectrsvg_cairo_render_imagersvg_cairo_pop_discrete_layerrsvg_cairo_push_discrete_layerrsvg_cairo_render_pathrsvg_cairo_render_pango_layoutrsvg_cairo_create_pango_contextrsvg_handle_render_cairorsvg_handle_render_cairo_subrsvg_cairo_new_drawing_ctxrsvg_cairo_render_newrsvg_cairo_cliprsvg_handle_get_pixbufrsvg_handle_get_pixbuf_subrsvg_handle_newrsvg_handle_free_rsvg_register_typesrsvg_type_inforsvg_handle_get_typersvg_pixbuf_from_file_at_max_sizersvg_pixbuf_from_file_at_zoom_with_maxrsvg_pixbuf_from_file_at_zoomrsvg_pixbuf_from_file_at_sizersvg_pixbuf_from_filersvg_pixbuf_from_data_with_size_data_rsvg_size_callback_rsvg_xml_input_buffer_new_from_stream// 1283748965 0 0 0 756 ` librsvg_2_la-rsvg-affine.o/ librsvg_2_la-librsvg-features.o/ librsvg_2_la-rsvg-bpath-util.o/ librsvg_2_la-rsvg-css.o/ librsvg_2_la-rsvg-defs.o/ librsvg_2_la-rsvg-image.o/ librsvg_2_la-rsvg-paint-server.o/ librsvg_2_la-rsvg-path.o/ librsvg_2_la-rsvg-base-file-util.o/ librsvg_2_la-rsvg-filter.o/ librsvg_2_la-rsvg-marker.o/ librsvg_2_la-rsvg-mask.o/ librsvg_2_la-rsvg-shapes.o/ librsvg_2_la-rsvg-structure.o/ librsvg_2_la-rsvg-styles.o/ librsvg_2_la-rsvg-text.o/ librsvg_2_la-rsvg-cond.o/ librsvg_2_la-rsvg-base.o/ librsvg_2_la-librsvg-enum-types.o/ librsvg_2_la-rsvg-cairo-draw.o/ librsvg_2_la-rsvg-cairo-render.o/ librsvg_2_la-rsvg-cairo-clip.o/ librsvg_2_la-rsvg.o/ librsvg_2_la-rsvg-gobject.o/ librsvg_2_la-rsvg-file-util.o/ librsvg_2_la-rsvg-xml.o/ /0 1283748888 0 0 100644 10748 ` ELF+%@@.shstrtab.text.rodata.bss.data.picdata.comment.debug_loc.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_info0A@`www`] _ H`Hȕ? J_< `ȑ J ; ȑ J :  J ;` ` H( H< ` H`H< (ww''G뀢H_ H?_ ?_: G뀢H_ H?_ ?_: G瀢H_ H?_ ?_: G瀢H_ H?_ ?_: G뀢H_ H?_ ?_: G瀢H_ (H?_ (?_: (www__ H  HH?  H  `HH?א  H`HH?  H``HH?ǐ   H(`HH H?  H``HH (H?_: : : : : : (@A@`ww`] _:``] :``] :``] :``] :` `] :`(0A@`ww??_:``] :``] :`:``] :` `] :`( A@`ww?`] H`] @?`] H`] @?_<`<`<`<``] <` `] <`(0A@`ww?`] H`] @?`] _<``] <`<``] <``] <` `] <`(0A@`ww??`] _:``] :``] :``] :`:` :`(@w_  H  H@@@?HH0A@`ww_@ `] H _@ `] H_@ `] H_@ `] HH  '< < 0A@`www_ _ @`] HE_ _ @`] H8_ _ @`] H+_ _ @`] H_ _ @`] H_ (_ (@`] HH  '< < ?@ !TD-@f>@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)ieeefp.h 2.12 04/10/23 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03rsvg-affine.c /var/tmp/librsvg-2.31.0 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -xc99 -DHAVE_CONFIG_H -I. -I. -I. -DG_LOG_DOMAIN='"librsvg"' -DLIBRSVG_DATADIR='"/usr/local/share"' -I/usr/local/include -D_REENTRANT -D_PTHREADS -D_POSIX_PTHREAD_SEMANTICS -I/usr/local/include/gdk-pixbuf-2.0 -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include/libxml2 -I/usr/local/include/pango-1.0 -I/usr/local/include/freetype2 -I/usr/local/include -I/usr/local/include/cairo -I/usr/local/include/pixman-1 -I/usr/local/include/libpng14 -I/usr/local/include/libcroco-0.6 -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include/libxml2 -DHAVE_LIBCROCO='1' -L/usr/local/lib -I/usr/local/include -c -o librsvg_2_la-rsvg-affine.o rsvg-affine.cXa;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7C9 /var/tmp/librsvg-2.31.0rsvg-affine.c DD%rsvg-affine.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodata.L_cseg0.L_cseg1.L_cseg2.L_cseg3.L_cseg4_rsvg_affine_equal_rsvg_affine_rectilinearfabssqrt_rsvg_affine_expansion_rsvg_affine_translatetan_rsvg_affine_shearcossin_rsvg_affine_rotate_rsvg_affine_scale_rsvg_affine_identity_rsvg_affine_multiply_rsvg_affine_flip_rsvg_affine_invert_GLOBAL_OFFSET_TABLE_  #4(CLU^g p HT804F@X l $8< @DTX l p        ( , < @ X \ l p         ,T X h l        04 D H X \       lt     ( 0  4 P X  \      $  ( P X  \       66@  @ ( @ @$ @- @86xAxM OYXgno w  %0  /28 1283748888 0 0 100644 3012 ` ELF+@@.shstrtab.text.bss.data.rodata.picdata.rodata1.comment.debug_loc.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.data.rela.debug_info2.31.0acomp: Sun C 5.10 SunOS_sparc 2009/06/03librsvg-features.c /var/tmp/librsvg-2.31.0 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -xc99 -DHAVE_CONFIG_H -I. -I. -I. -DG_LOG_DOMAIN='"librsvg"' -DLIBRSVG_DATADIR='"/usr/local/share"' -I/usr/local/include -D_REENTRANT -D_PTHREADS -D_POSIX_PTHREAD_SEMANTICS -I/usr/local/include/gdk-pixbuf-2.0 -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include/libxml2 -I/usr/local/include/pango-1.0 -I/usr/local/include/freetype2 -I/usr/local/include -I/usr/local/include/cairo -I/usr/local/include/pixman-1 -I/usr/local/include/libpng14 -I/usr/local/include/libcroco-0.6 -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include/libxml2 -DHAVE_LIBCROCO='1' -L/usr/local/lib -I/usr/local/include -c -o librsvg_2_la-librsvg-features.o librsvg-features.cXa;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7H> /var/tmp/librsvg-2.31.0librsvg-features.c DD%librsvg-features.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodatalibrsvg_versionlibrsvg_micro_versionlibrsvg_minor_versionlibrsvg_major_version_GLOBAL_OFFSET_TABLE_  (9HXn 66@  $-6*?)J)VTbp3xP 8P0  /61 1283748890 0 0 100644 10836 ` ELF+&@@.shstrtab.text.rodata1.bss.data.rodata.picdata.comment.debug_loc.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_info@  @"   $`?" D` 8@@t w A@`ww_@h`]`]`]`] @ :H/ D` H `_?`,p,p$D O`H@H  @" " ?" ?` 8@v^_?`,p,p@$@A@`ww_h`]`]`]`] @ N@\ @_A@`ww??_h`]`]`]`] @ Z] wE `H_ߪ$`=`,p,p$D` H <`(<`0% _ wD'Gˠ $ D`H , '$`] <,p,p@$_t _]`wߨ _ߣ? ,p,p$$ < (< 0%`A@`ww??_h`]`]`]`] @ zE  H`]`]`]`] @ { wD $ D`H , '$`] <,p,p@$_t _\  =,p,p$@$ < (< 0A@`ww??????_h`]`]`]`] @ E  H`]`]`]`] @  wD`$' D`@H , '$`] <,p,p@$_t _\ w _G,p,p$$ < < < < < (< 0 w'_ wD $ D`H , '$`] <,p,p@$_t _\ G,p,p$>,p,p$ 8`]Ot0A@`ww_@h`]`]`]`] @ D`H`]`]`]`] @ D` H`]`]`]`] @ @_]``E $ < ,p,p$'E $ %` A@`ww_h`]`]`]`] @  wD $ D`H , '$`] <,p,p@$_t  _\ >,p,p$$librsvgfile %s: line %d: assertion `%s' failedrsvg-bpath-util.cpath != NULLbpd != NULLbpd->moveto_idx >= 0bpd->n_bpath > 0@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)ieeefp.h 2.12 04/10/23 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03rsvg-bpath-util.c /var/tmp/librsvg-2.31.0 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -xc99 -DHAVE_CONFIG_H -I. -I. -I. -DG_LOG_DOMAIN='"librsvg"' -DLIBRSVG_DATADIR='"/usr/local/share"' -I/usr/local/include -D_REENTRANT -D_PTHREADS -D_POSIX_PTHREAD_SEMANTICS -I/usr/local/include/gdk-pixbuf-2.0 -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include/libxml2 -I/usr/local/include/pango-1.0 -I/usr/local/include/freetype2 -I/usr/local/include -I/usr/local/include/cairo -I/usr/local/include/pixman-1 -I/usr/local/include/libpng14 -I/usr/local/include/libcroco-0.6 -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include/libxml2 -DHAVE_LIBCROCO='1' -L/usr/local/lib -I/usr/local/include -c -o librsvg_2_la-rsvg-bpath-util.o rsvg-bpath-util.cXa;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7G= /var/tmp/librsvg-2.31.0rsvg-bpath-util.c DD%rsvg-bpath-util.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodata.L29.L30.L31.L32.L52.L89rsvg_bpath_def_replicate.L144rsvg_bpath_def_art_finishrsvg_bpath_def_closepathrsvg_bpath_def_curvetorsvg_bpath_def_linetog_reallocrsvg_bpath_def_movetog_freersvg_bpath_def_freememcpyg_logrsvg_bpath_def_new_fromg_malloc_nrsvg_bpath_def_new_GLOBAL_OFFSET_TABLE_  '8GL(Q0VH[X`heh~ @h0h &,0DOdb$P    Pl    $ ( 0 4 @PX       8<dh p t |           D       (HL T X ` d l p |HLlp x |                $ ,  0 8 < H             x66@    ) )% )- )6 )?JV^Sbpxx@  %0  /93 1283748893 0 0 100644 41724 ` ELF+x@@.shstrtab.text.rodata.rodata1.picdata.bss.data.comment.debug_loc.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.picdata.rela.debug_infoA@`ww '`] ??`] ??_@wh@HHǀ`H@H???? '@ǐ@@ (A@`wwwwwww`] ?w_$ _$ _$ _$ _@@?`] ȁHH `] HH@B "H`] HN?_@hHL`HD`]@@ H<_`]@H `] ? _H($`_`]@H _H$`_`]@H `] ? _H$`_`]@H `] ? _H$`_`]@H `] ? _H$`_`]@H _H$`_`]@H _H$`_`]@H  _$``] HH?`] ?_`]@H  _$``] H?_`]@H  _$``] H?_`]@H `] Hd?_`]@H `] HT?_`]@H `] HD?_`]@H`] H5?_`]@H`] H&?_`]@H`] H?_`]@H`] H?`] H?`] @`] H`] ? _$`?ǁw 'ˠ 'Ϡ 'Ӡ 'נ '_ϔۖט_?GۀH pH&/G׀H mH/GӀH xH/GπH iH/Gˀ`H lH /瀤`H sH/ /w  \  A@`wwwH@_w߀@h _@@?_! @H!?H_!_@ vH?_L! pH mOOO xOO`] ?A@`www/_M `H Hu?߀`pH$OhH _ XHHh?߀vH _ `HH_?߀oH  ?_ X@ `I@HR?HK`mH`xH@_@_@?_L` mH` JH;?` J`] H2?߀`iH$OhH _ 0HH%?߀vH _ 8HH?߀oH  ?_ 0@ 8I@H?H`lH`sH`] ?߁ A@`ww???_J`HH,?׀`pH瑢HH$?׀`mHߑHH?׀`xH ߕH`] H?׀`iHHH?`] ?ׁ0A@`w?`] HH `] HH `] H`] `] @H@'G?`@'G`HH `HH @?` ww_w_w@\ '< < A@`www _@h $`_M #HI 'M H4_GL@ 0H 9H$ 0H'_GL@ AH FH$ 7H'_GL@ aH fH$ WH'H.G߶@G '_<`LOG〤 H , , .H`]@hl '۠ 'ߠ '_`]@h: _74L@ (H 7 _74L@ (O7 _74@@Ӣ@@hӀ H\`@']@']@'@H_`]@ۀ H G'G'GH'۠ '۠ 'ߠ 'G, Gߡ, @GH*@_`]@H _h$ H_`]`]  @w߀@h _h$ H `'4  A@`ww_@畠@?_瀤h L %H`] H?`] H`] @H@7@4  A@`ww_@ߕ@?`] ȁHH `] HH@B "H`] H3?_߀@h-`]@@H`] H`] H?_`]@H`] H`] H?? A@`ww_@ߕ@?`] ȁHH `] HH@B "H`] H?_߀@h`]@@H `] HH?? A@`ww_@ߕ@?`] ȁHH `] HH@B "H`] H?_߀@h`]@@H `] HH??0A@`www_@h $`_@h'`]@@HH# _`]@HH _`]@H _h$ H _h$  >0A@`www_@h $`_@h`]@@HH _`]@H _h$ H _h$  ? 0A@`www_@h $`_@h`]@@HH!,_`]@HH"_`]@HH{# _`]@HHp d_`]@HHe _`]@HHZ!,_`]@HHO!_`]@HHD!_`]@HH9"X_`]@HH."_`]@HH## _`]@HH#_`]@H _h$ H!_h$ !? 0A@`www_@h $`_@h|`]@@HHx _`]@HHm _`]@H _`]@HHY _`]@HHN _`]@HHC _`]@H _`]@HH/ _`]@HH$ _`]@HH _`]@H _h_$ H _h$  ? 0A@`www_@h $`_@hH`]@@H _h$ H_@A@`www w@_w`]@ߢ@@h6`]@@ H @@7@ `]@h`]@ H @@7@ `]@o@__@h7@$`h"7@ 4 @w7@4@,0r$`wh_]_7@4@,0u$`]w_o@_w ww_h$ _@ӶhӀHH'4 @ 7@ӀH7@4,0^@7@4,0?7@ 7@Ӏ O@_@h$`@ A@`wwww_@_< _߀h(L `H$`]\ ,p84084,0!H@H_ߢ w`]\ L`,p84084,0!H@O_߀@h L`H @@_< _ _<  A@`ww _@h〤H 7@〤H7@4,0_`]@HH 7@4,0_`]@HHs 7@4,0_`]@HHe 7@4,0_`]@HHW 7@4,0_`]@HHI 7@4,0_`]@HH; 7@4,0_`]@HH- @7@4,0_`]@HH 7@4,0_`]@HH!7@4,0_`]@H!<7@ 7@〤 On@>0A@`www_@h $`_`]@H _`]@HH _`]@H _`]@HH _h$  ? A@`www'wߪ   '_ wH`HG뀢@H __ߑ:`*0r  *  _ Hw`HG뀢@H __ߑ:`*0r  *  _ H w`HG뀢@H __ߑ:`*0r  *  _ Hw`HG뀢@H __ߑ:`*0r  *  H`HG뀢@H _ _ߑ:`*0r   H'Gπ H G뀢@H__ߑ:`*0r H`HG뀢@H _ _ߑ:`*0r   H'Gπ H G뀢@H__ߑ:`*0r HG뀢@H _ߑ:`*0* H@`HH. `H+G뀢@H&_ߑ:`*0J`H_Z`hJ HJ H : `]J@Gπ@H _ߑ=*0@* HU@`HH `H G뀢@H _ߑ:`*0* H?`H'۱; H5H3_J `]J@H" O* : !X_ǐ?Ԑ B HHOOOOOOOO_ Ow; DHD( A@`ww_H_ HAw_ H=w_ H9w_ H5w_"@: '; _J `]J@HH" O* : !P?B OO" O* : !h?B O; $4DTTTTdTA@`ww w`]@_w?  @__)@H@@?  @__@. <  @wǶ H.  >,0@_@_ǡ.< ,0t \ _ϡ>,0W_@: ->,0@@\ _ǡ. < ,0t \ >,0@\`\`$-O@@@__w@R@QR@9ffffff@?zG{@@??333333@(@Y@o?@f@ !TD-@v@y@@    !"# $pxptincmmmpcemex%largersmallerxx-smallx-smallsmallmediumlargex-largexx-largergb rgb ( %d , %d , %d ) inheritradgradkHzsobliqueitalicsmall-capslighterboldbolder100200300400500600700800900ultra-condensedextra-condensedcondensednarrowersemi-condensedsemi-expandedexpandedwiderextra-expandedultra-expanded, xMinYMinxMidYMinxMaxYMinxMinYMidxMidYMidxMaxYMidxMinYMaxxMidYMaxxMaxYMaxslicevisibleautohiddenscroll aliceblueantiquewhiteaquaaquamarineazurebeigebisqueblackblanchedalmondbluebluevioletbrownburlywoodcadetbluechartreusechocolatecoralcornflowerbluecornsilkcrimsoncyandarkbluedarkcyandarkgoldenroddarkgraydarkgreendarkgreydarkkhakidarkmagentadarkolivegreendarkorangedarkorchiddarkreddarksalmondarkseagreendarkslatebluedarkslategraydarkslategreydarkturquoisedarkvioletdeeppinkdeepskybluedimgraydimgreydodgerbluefirebrickfloralwhiteforestgreenfuchsiagainsboroghostwhitegoldgoldenrodgraygreengreenyellowgreyhoneydewhotpinkindianredindigoivorykhakilavenderlavenderblushlawngreenlemonchiffonlightbluelightcorallightcyanlightgoldenrodyellowlightgraylightgreenlightgreylightpinklightsalmonlightseagreenlightskybluelightslategraylightslategreylightsteelbluelightyellowlimelimegreenlinenmagentamaroonmediumaquamarinemediumbluemediumorchidmediumpurplemediumseagreenmediumslatebluemediumspringgreenmediumturquoisemediumvioletredmidnightbluemintcreammistyrosemoccasinnavajowhitenavyoldlaceoliveolivedraborangeorangeredorchidpalegoldenrodpalegreenpaleturquoisepalevioletredpapayawhippeachpuffperupinkplumpowderbluepurpleredrosybrownroyalbluesaddlebrownsalmonsandybrownseagreenseashellsiennasilverskyblueslateblueslategrayslategreysnowspringgreensteelbluetantealthistletomatoturquoisevioletwheatwhitewhitesmokeyellowyellowgreen+**޸_iPd< dkUk/2zH=/OO/OOiiiiii""""ڥ /i\\K|z ww22fͪUpl> t?? @@ AA BB $DCHC PpDtD |EE FF GG  H$H ,LIPI Xx0|0 8J<J DdKhK pLL MM NN  OO 8P<P D\Q`Q hRR SS 00 hl00  $DuPTTT \txU|U usTT tUU  u s T $T 0t H r q!T!r!!"H"L"h"p"p "p"p #D###$ V$V $$DW$HW $P$|X$X $$Y$Y $$Z$Z $%$[%([ %0%\\%`\ %h%]%] %%^%^ %&_&_ &&L&&&`&` &&a&a &' b'b ''0c'4c '<''+ d+$d +d+d ---d-d ...g.g .k.r//$r/Xj/u/u0$0,    0 @ P `  p ( 0 @ H X ` p      0 @ P ` p    ( 8 H X h x    0 @ P ` p      ( 0 @ P ` p x  0 @ P ` p          ( 8  H0 X@ hP x` p           0 @  P0 X@ hP p` xp            0  @0 P@ `P p` xp             0 @ (P 0` @p H P ` p         0 @ P ` p  ( 0 8 @ H X ` h  p   66@ 0X1H2 "= 0+F0F6FW?NJNVQLbQpQbxXX hfh* H0  /118 1283748896 0 0 100644 9244 ` ELF+@@.shstrtab.text.rodata1.bss.data.rodata.picdata.comment.debug_loc.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_info0A@`w  (@`]`]`]@w``]`]`]`]@w`@@t t t w@ww__r ww__@\ __\ @h&@@@w@@@_]@@H@@H _\ @_@@@@ @@ ' <  www_\ @_h__HH_\ @_@h \ \ \ @_HA@`www_`]@w߀hH_h_\ @`H`]@@ _Z Z @@@@0www_@h L` H__@@_@_0www_\ @__@@@ww_\ @_@w_@\  7_\  H_\ \ 74,0\@Z 7 7_\   O_\ @ _@\ @_0www  @_r @_w _\ @_t @w_\ h_Z \ @_ _ t @_ @_\ @@_ t \ o#@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03rsvg-defs.c /var/tmp/librsvg-2.31.0 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -xc99 -DHAVE_CONFIG_H -I. -I. -I. -DG_LOG_DOMAIN='"librsvg"' -DLIBRSVG_DATADIR='"/usr/local/share"' -I/usr/local/include -D_REENTRANT -D_PTHREADS -D_POSIX_PTHREAD_SEMANTICS -I/usr/local/include/gdk-pixbuf-2.0 -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include/libxml2 -I/usr/local/include/pango-1.0 -I/usr/local/include/freetype2 -I/usr/local/include -I/usr/local/include/cairo -I/usr/local/include/pixman-1 -I/usr/local/include/libpng14 -I/usr/local/include/libcroco-0.6 -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include/libxml2 -DHAVE_LIBCROCO='1' -L/usr/local/lib -I/usr/local/include -c -o librsvg_2_la-rsvg-defs.o rsvg-defs.cXa;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7A7 /var/tmp/librsvg-2.31.0rsvg-defs.c DD%rsvg-defs.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodatarsvg_defs_load_externrsvg_defs_extern_lookup.L52g_slist_delete_linkrsvg_defs_resolve_allg_slist_prependrsvg_defs_add_resolverg_ptr_array_freeg_hash_table_destroyrsvg_defs_freeg_ptr_array_addrsvg_defs_register_memoryrsvg_defs_register_namersvg_defs_setg_strfreevg_strsplitg_strrstrrsvg_defs_lookupg_hash_table_lookupg_byte_array_freeg_strdupg_hash_table_insertrsvg_handle_closersvg_handle_writersvg_handle_set_base_urirsvg_get_base_uri_from_filenamersvg_handle_new_rsvg_acquire_xlink_href_resourcersvg_get_file_pathrsvg_defs_set_base_urig_ptr_array_newg_object_unrefg_freeg_str_equalg_str_hashg_hash_table_new_fullg_malloc_nrsvg_defs_new_GLOBAL_OFFSET_TABLE_  !2A@WPotH|` ,$`@<\JU`j{+M`(w .$.8,D*H* P)T) \(`( h+t*x* )) (( '' +&T$l#"! ( (h.., 0 8t   ,x (, p(( 66@ %-6?JV,Mbypxh 0  /144 1283748899 0 0 100644 16436 ` ELF+;@@.shstrtab.text.rodata.rodata1.bss.data.picdata.comment.debug_loc.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_infoA@`www 'ˠ '_h `]`]@_H'L H_L``w@,HL`O@_wף20,p@@< __Z ˘@@wϓ: @ ww_@ H@_H@_H$_h@h @@@HHH@_@@A@`wwwww_@h `]`]@_H$_@@@@hHǔ_@@H@H@__@< @_@@@A@`wwww _h `]`]@_H:@ǖ_@H_h@_@@_w@_@_ǖ_@@H @w__@< @_HH_װ@ A@`wwww_@hL`HH!`]@ @H_@h__;@h__w@@A@`wwww__@_h=@wǺ]``@_'Ð@@ GÀH @@@@H(_@@H@@H@@wǀh@@@_`]_@@ H @@@H_ǬA@`w'??www_w H_ ?_`? H` HȒ -H   "H @H H?? `H  `H `@HH$ `H  `H `H_`_ `] ȑH :`_`_ ȑ:` `H  `H `HH$ `H  `H ` H_`_ `] ȑH :`_`_ ȑ:`_: _: @w_@_`@_`w`_`h@@_ww'_@D`8\`hN`@_@ h?ǐP_@ v?`_@ h?p_@ v?_]@G@_@_B H5@!<@H_@5@@' ?@' Ǡ@]@s_@@_A@`wwwwww_@_瀢H_`]@@@h@@<t\u \u  @] t`] t`_`]@@@h@@<t\u \u  P] t`] t`_`]@@@h@@<t\u \u  `] t`] t`_`]@@@h@@<t\u \u  p] t`] t`_`]@h _`]@h@_@ t \ h_`]@hw_`]@@@h w_\ \ @@_`]@h@' 8__ `]__@_A@`w  @@_`h`]`]`]`]@!hw` '`8`]@<t\u \u @`pw] t] t``w\u \u `Pw] t] t`@\t`\t``]u` `]u`(`]u`0w@@rsvg_acquire_base64_resourcersvg_acquire_file_resourcersvg_acquire_vfs_resource@rsvg_new_imagedata != NULLfilename != NULLdata:Failed to load image '%s': reason not known, probably a corrupt image filexywidthheightpathxlink:hrefclassidpreserveAspectRatioimagelibrsvgrsvg-image.cimage->super.state0@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)ieeefp.h 2.12 04/10/23 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03rsvg-image.c /var/tmp/librsvg-2.31.0 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -xc99 -DHAVE_CONFIG_H -I. -I. -I. -DG_LOG_DOMAIN='"librsvg"' -DLIBRSVG_DATADIR='"/usr/local/share"' -I/usr/local/include -D_REENTRANT -D_PTHREADS -D_POSIX_PTHREAD_SEMANTICS -I/usr/local/include/gdk-pixbuf-2.0 -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include/libxml2 -I/usr/local/include/pango-1.0 -I/usr/local/include/freetype2 -I/usr/local/include -I/usr/local/include/cairo -I/usr/local/include/pixman-1 -I/usr/local/include/libpng14 -I/usr/local/include/libcroco-0.6 -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include/libxml2 -DHAVE_LIBCROCO='1' -L/usr/local/lib -I/usr/local/include -c -o librsvg_2_la-rsvg-image.o rsvg-image.cXa;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7B8 /var/tmp/librsvg-2.31.0rsvg-image.c DD%rsvg-image.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodata.L23.L14rsvg_acquire_base64_resource.L60.L51rsvg_acquire_file_resource.L68rsvg_acquire_vfs_resource.L95.L115.L_cseg0rsvg_node_image_freersvg_node_image_draw.L179.L182.L185.L188.L192.L194.L199.L202.L205.L207rsvg_node_image_set_atts.L220.L221.L222.L223.L211g_assertion_message_expr_rsvg_node_initg_malloc_nrsvg_new_imagersvg_parse_style_attrsrsvg_css_parse_aspect_ratiorsvg_defs_register_namersvg_handle_get_base_uri_rsvg_css_parse_lengthrsvg_property_bag_lookuprsvg_property_bag_sizersvg_pop_discrete_layerrsvg_render_imagegdk_pixbuf_get_heightgdk_pixbuf_get_widthrsvg_add_clipping_rectrsvg_current_statersvg_push_discrete_layerrsvg_state_reinherit_top_rsvg_css_normalize_length_rsvg_node_freersvg_state_finalizersvg_preserve_aspect_ratiog_object_refgdk_pixbuf_error_quarkg_set_errorgdk_pixbuf_loader_get_pixbufgdk_pixbuf_loader_closeg_byte_array_freegdk_pixbuf_loader_writegdk_pixbuf_loader_newrsvg_pixbuf_new_from_hrefstrncmp_rsvg_acquire_xlink_href_resourceg_file_resolve_relative_pathg_object_unrefg_clear_errorg_file_load_contentsg_file_new_for_urig_byte_array_appendg_byte_array_newg_file_get_contentsg_build_filenameg_get_current_dirg_freeg_path_get_dirnameg_filename_from_urig_strdupg_path_is_absoluteg_file_testrsvg_get_file_pathg_byte_array_set_sizeg_base64_decode_stepg_byte_array_sized_newstrlenrsvg_return_if_fail_warning_GLOBAL_OFFSET_TABLE_  "3oBGL ins88HL(0PX P d !' pX@FLRX`^wh5Ldv(<tWd{@@]lz,5HT@g} ]$]\ ` hl t\[ZY XPVdUxTSRQPOQ@]D]p t |  \WNQML QQP]T]   \KJIHKGH0J<HPMdLlQ]] E]]FCBA$@,H@@THd?H= ><H]]@D   : Q H 9 $8 88 L8 `8 t7 |6 5 4 3 2 ; 41 <0 x] |] /   . - $ ( 0. T-   . -   . ,- h l t.   . , D   . $.T+`d l.* )]]' &$ ( 0!4! <$@$ H"L" T%h#l# x-     66@ H(o"'-68?JVxNbpx# %,0;0  /171 1283748902 0 0 100644 27660 ` ELF+g@@.shstrtab.text.rodata1.rodata.bss.data.picdata.comment.debug_loc.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_info0'  @ "  "   @@ t\$`\$ w@  @ "  "   @@t` \`$`w0w  @w $` $`_t`w@@0w  @w $`$`_t`w@@0w  @ "  " @__t wA@`wwww'_@h $`_`]@HHi@_wπh:_@@_Ϡ@hHV\ \ `]@Ht@HH_`\ `]@H@H:_`\ `]@H@H,H*_`]@H _h$  H_`]@HH _@_'@w_@hB` "`@w_@hD`$ ' H $`D` H@\`@_㼐A@`wGwww`] ?ߠ '_@_瀢Hq_`]@wπ@h<O@@<t_\u \u o] t`] t`@_`] `] @@@@?`] H`] H?`] H`] ?=`8_`]@wπ@h__\ @@_`]@wπ@h `]@@H '__\ @__\ \ 0_t`@@_GۀHg', G4 @%`@@0A@`w  H@@`]@t`0`] <`8$`@w@@A@`wwww_@_瀢H6_`]@@@h_\ \ _@@_`]@@@h@@<t\u \u `x] t`] t``%`,$`_`]@@@h@@<t\u \u `] t`] t``%`,$`_`]@@@h@@<t\u \u `] t`] t``%`,$`_`]@@@h@@<t\u \u `] t`] t``%`,$`_`]@@@h'`]@@HH'`p`]@H H '`p`]@H '`p`%`,$`_`]@@@h__\ \ @@h_\ \ `@_`]@@@h `@@@`%`,$`_`]@h@'`_`]@@@h`]@@HH '`8`]@H '`8`%`,$`__\ `]_@A@`w  @@@`@'``]@<t\u \u `w] t] t`w\u \u `x] t`] t``]@<t\u \u @] t`] t`tȠ $8$p`]t0!,@ $!,@ $!,@ $!,@ $!,@ $!,@ $!<,@ $wA@`wwww_@_瀢Ho_`]@@@h_\ \ _@@_`]@@@h%@@<t\u \u @x] u`] u`%`,$``4  H]`t`]`t`_`]@@@h$@@<t\u \u @] u`] u`%`,$``4  H]`t`]`t`_`]@@@h@@<t\u \u `] t`] t``%`,$`_`]@@@h@@<t\u \u `] t`] t``%`,$`_`]@@@h@@<t\u \u `] t`] t``%`,$`_`]@@@h__\ \ @@h_\ \ `@_`]@@@h `@@@`%@`,$`_`]@h@'`_`]@@@h'`]@@HH'`p`]@H H '`p`]@H '`p`%`,$`_`]@@@h`]@@HH '`8`]@H '`8`%`,$`__\ `]_@A@`w  @@@`@'`̠ '`8'`pw``]@<t\u \u @`w] t] t`w\u \u `w] t] t`w\u \u `x] t`] t``]u`0`!@,@ $!,@ $!,@ $!,@ $!,@ $!,@ $!,@ $!<,@ $w@@A@`wwww_@_瀢HC_`]@@@h_\ \ _@@_`]@h@@` (`\@Ot`%`,$`_`]@@@h@@<t\u \u `p] t`] t``%`,$`_`]@@@h@@<t\u \u `] t`] t``%`,$`_`]@@@h@@<t\u \u `] t`] t``%`,$`_`]@@@h@@<t\u \u `] t`] t``%`,$`_`]@@@h__\ \ @@h_\ \ `@_`]@@@h `@@@`% `,$`_`]@@@h`]@@HH '`<`]@H '`<`%@`,$`_`]@@@h`]@@HH '`8`]@H '`8`%`,$`_`]@h@2 '`آ`%`,$`A@`w  @@ '`<'`8`]@<t\u \u `w] t] t`w\u \u `w] t] t`p\t`\t`w` '`'`@`@`]@u 0 ! ,@ $!,@ $!,@ $!,@ $!@,@ $!,@ $!,@ $!,@ $!<,@ $w0A@`ww 7@_ H_\ 7@4,0\@\ \ `]@HH  7@ 7@_  O > A@`ww_\ Ȁh&^\ `]@H@_` 4 H`4  H %,% `x`x\t`\t`_` 4 H`4  H %,% ``\t`\t`_` 4 H`4  H %,% ``\t`\t`_` 4 H`4  H %,% ``\t`\t`_ 4` H 4  H%,@$ >,0 @_< @O_` 4 H`4  H%,% D`p%`p_` 4 H`4  H%,% D`8%`8_\ H  _ H_ _t`Hb_ ^\ `]@HX_  4` HС4  H%,@%  >,0 @_< @O_` 4 H`С4  H%,% D`p%`p_` 4 H`С4  H%,% D`8%`8_\ H _ H_ _t`_ ؀o A@`ww_\ ؀h>^\ `]@H@_` 4 H`С4  H %,% `x`x\t`\t`_` 4 H`С4  H %,% ``\t`\t`_` 4 H`С4  H %,% ``\t`\t`_` 4 H`С4  H %,% ``\t`\t`_` 4 H`С4  H %,% ``\t`\t`_ 4` H С4  H%@,@$ >,0 @_< @O_` 4 H`С4  H%,% D`p%`p_` 4 H`С4  H%,% D`8%`8_\ H _ H_ _t`Hb_ ^\ `]@HX_  4` H4  H%@,@%  >,0 @_< @O_` 4 H`4  H%,% D`p%`p_` 4 H`4  H%,% D`8%`8__\ H Z_ H_ _t`_ Ȁo0w_Z @h_ 2` H@ܑ2  H <*@@"p pZ`rZ`r_ 2` H@ܑ2  H *@@" Z`rZ`r_ 2` H@ܑ2  H *@@" Z`rZ`r_ 2` H@ܑ2  H *@@"ࠔ Z`rZ`r_ 2` H`ܑ2  H *@@" >*0@  @_ : @O_ܑ2  H@`ܑ2  H ` (`ZOr@_ 2` H@ܑ2  H*@@"# _ 2` H@ܑ2  H@*@@"B<# <_ 2` H@ܑ2  H*@@"B8# 8_ Z` H_`Hr`_`@o#nonelinearGradientradialGradientpatterninheritcurrentColoroffsetstylestop-coloridx1y1x2y2spreadMethodpadreflectrepeatxlink:hrefgradientTransformcolorgradientUnitsuserSpaceOnUseobjectBoundingBox01cxcyrfxfy0.5viewBoxxywidthheightpatternTransformpatternUnitspatternContentUnitspreserveAspectRatiostop?@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)ieeefp.h 2.12 04/10/23 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03rsvg-paint-server.c /var/tmp/librsvg-2.31.0 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -xc99 -DHAVE_CONFIG_H -I. -I. -I. -DG_LOG_DOMAIN='"librsvg"' -DLIBRSVG_DATADIR='"/usr/local/share"' -I/usr/local/include -D_REENTRANT -D_PTHREADS -D_POSIX_PTHREAD_SEMANTICS -I/usr/local/include/gdk-pixbuf-2.0 -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include/libxml2 -I/usr/local/include/pango-1.0 -I/usr/local/include/freetype2 -I/usr/local/include -I/usr/local/include/cairo -I/usr/local/include/pixman-1 -I/usr/local/include/libpng14 -I/usr/local/include/libcroco-0.6 -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include/libxml2 -DHAVE_LIBCROCO='1' -L/usr/local/lib -I/usr/local/include -c -o librsvg_2_la-rsvg-paint-server.o rsvg-paint-server.cXa;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7I? /var/tmp/librsvg-2.31.0rsvg-paint-server.c DD%rsvg-paint-server.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodatarsvg_paint_server_solidrsvg_paint_server_solid_current_colourrsvg_paint_server_lin_gradrsvg_paint_server_rad_gradrsvg_paint_server_pattern.L50.L57.L60.L63.L66.L71.L102.L110.L113rsvg_stop_set_atts.L_cseg0.L_cseg1.L134.L137.L140.L143.L146.L149.L152.L156.L160.L163.L168.L171.L174.L177.L181rsvg_linear_gradient_set_atts.L189.L190.L202.L207.L212.L215.L218rsvg_radial_gradient_set_atts.L251.L263.L266.L269.L272.L275.L282.L285.L293.L301rsvg_pattern_set_atts.L320hasstoprsvg_radial_gradient_fix_fallbackrsvg_linear_gradient_fix_fallbackrsvg_new_patternrsvg_css_parse_aspect_ratiorsvg_css_parse_vboxrsvg_new_radial_gradient_rsvg_affine_identityrsvg_new_linear_gradientrsvg_parse_style_attrsrsvg_parse_transformrsvg_defs_add_resolverrsvg_defs_register_name_rsvg_node_initrsvg_new_stoprsvg_state_finalizersvg_state_reconstructrsvg_state_initrsvg_parse_style_pairsrsvg_parse_stylersvg_dpi_percentage_rsvg_css_hand_normalize_length_rsvg_css_parse_lengthrsvg_property_bag_lookuprsvg_property_bag_sizersvg_paint_server_unrefrsvg_paint_server_refrsvg_css_parse_colorg_freersvg_defs_lookuprsvg_get_url_stringstrcmprsvg_paint_server_parsersvg_pattern_fix_fallbackg_malloc_n_GLOBAL_OFFSET_TABLE_  ):Ixal0TP\(08HPXx$-h3p9x?EKQW]ciou{ (08@HPX`hpx #)H?EM$(o( 1F]u| *AZq`4*$(_L___@___4^``  \[ ZY@D L\x| \ \ \48 @\lX@YHY`` U TS<QDH TX hRx|     TP(, 4TPT \\ONML `$`8_DJLP `d ``U T (I 4 8 @T dS   T S @ D LT pS   T S H L TT p t |\  \ ! ! \ " " T @Z dH p# t# |T G $ $ T X % % T $& (& 0\ L' P' X\   F ` `_JD$)() 4S** S(( ``U THIT+X+ `TS ,, T<S-- TSD.H. PTtS// TSL"P" XTZH## TG$$ T0X@D LThl t\  \!! \%%  T(&,& 4\P'T' \\ F``_ JD0141 @S00 ``U  T@IL2P2 XTB33 TSD4H4 PTtS55 TSL6P6 XT|S"" TZ,H87<7 DTdG88 T&& \'' \9 9 (TD&H& P\l'p' x\:: TA0`4`H_TJh)l) xSD;;  `$`p<t< |\``   $\##  #(\$`$`$$ %\(\(` (h\66@ -.0h"0x'0x-0x60x8?7J7V;SUb;p;:x@  >Jg0  /205 1283748905 0 0 100644 19852 ` ELF+I@@.shstrtab.text.rodata.bss.data.picdata.comment.debug_loc.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_info0A@`w_w???????`] N`] @?w?o@w?gߡ`] N?`] `] ?O`] @NOI@??`] @ N?I@?/@/I??@߿@??@I@HIN??@߿@??@I@HNIN??@I@??@I@????@I@INHN????@I@INHN?_\ gIRNoT睦RNITNIRNVΝRNIVNIRNTΝRNIT@N A@`ww???''??_ ? ???PH TH`] P`] @??@?@`] H @`] H _\ @ǁ`] H?`] H?`] ??`] ?7V XP?ԥ VXP? \?_I[Х T硤 PХP?W`] H@RI@??@W硧I@?ﭤ PPP硦 X R RP??`] PHX X `] @P@@??GGۀH???A C繤 ?wҡ G Z ?o \EP`] СP?g\ EPP`] СP?_ܥ ??ũ ?7ڡܡ ?/áš ?'R T@P@@?`] PH? ?`] H`] H?`] H`] ?@@?O7`] H?O? P7 PP/ P' PP@ P@@?`] PH?/P7'PP ?`] H`] H?`] H`] ?@@?G?'P/7P`] H?GG׀HG`] H`] `] PPH?GG׀HG`] H `] `] P?GG`] `] P`] P @@@' G ' H&'_g_OG'  G TG'  ЍP`'   T'  БPJG GO'_< < 0A@`ww'_B0H0B,G@H)@H _": *0@ 8:*0@H: 8H _`:*0@H : 8H_`:*0@: 8`G@OB,G@H`] _?`*0@: 8`G@OA@`w'HN_D , HGH_ _\``8@`@_`8?<`<``@?<` <`$`, l,`(_D , HGH_v _\``8@`@_ 8?< <  @?< < $ ,_D , HGH$_W _ 8? @? H? P? X? `?\ @_< < < < $ ,_D , HGH0_* _``] P`?``] P` ?`8?`@?`H?`P?\`@_< < < < $ ,_D`, H \``8@`_ 8?< < $ ,_D`, H \``@`8_ 8?< < $ ,_D , HGHd_͒ _``8`] PP`] `] Ѕ P?``@`] PP`] `] Љ P?`H?`P?`] PP`] `] Ѝ P?`] PP`] `] Б P?@\`_ 8<  @< < < $ ,_E`, HGHp_``] P`?``] P` ?`] PP`] `] Ѕ P?`] PP`] `] Љ P?`8?`@?`] PP`] `] Ѝ P?`] PP`] `] Б P?@\`_< < < < H~$ ,H| Hd@ _``8`] PP`] `] Ѕ P?``@`] PP`] `] Љ P?`H?`P?`] PP`] `] Ѝ P?`] PP`] `] Б P?@\`_ 8<  @< < H< _ _\``8@`@_ 8?< <  @?< < _$ ,_D , HGH_ 8 @ H PP'G XP'G `Y h_$ ,_$ ,_L ( qH hH  aO cOO lH hOFOO mOO$ q O, < #b$DH @ @A@`@w?'''?G'ÿ?`] GGL@'@I@IH?_D0HcH5_D`,  H`HH ? H`H?HM_D`, H`HH ? H`H?H:_ HH4?_ HH.?L( qH hH  aO cOH lH hOHO mOH$ q H , < #bxD@_ ,wD'GӠ`$,p< 8ݒ PA@`www '`] ?ߺ   'Ӡ 'Ϡ 'ˠ 'Ǭ  '`] ?  '_GL@/p8<80HM9HJH4GπH --$ 0 H&'GӀH`] H?ߠ$0'HHH?`] H'H`] H?H  'Ӡ 'Ϭ  ' 'ˠ$0'?ߠ 'Hh/p8.! L&< @$'_.GGL@Gà@< />.! L&< -@'< .) _>  < &, < ,G׀O'G'GGG@H;G_GG=`@.! L%@< %'< < %@ HG׀H<.+ _- GGL@Gà@< ,G 'GG@OG GۀO#'Gà  O'_wG߀ H 'H_D H_D H_D H_D $HHGÀ H , < #a_DG'GG׀H 'G'GGGߢ@HC_G, GGM@@Gà@< /_G߃=`@.! L%@< ,G@'= < %@HGۀH<.) _L@< ,@G 'GGߢ@OGGۀHFG_GG߃>.! L&< $'_G, GN@Gà@< />.! L&< -@'< .) _= < &L@< ,GۀO'GGGߢ@H;G_GG߃=`@.! L%@< %'< < %@ HGۀH<.+ _G, GM@Gà@< ,G 'GGߢ@OG G׀O''Gà  O'Á$Pdx㾰A@`www''70 ''ۡ7p ''_w`] I((?o`] `] @HoI@`] `] @H@'G`] I((?o`] `] @HoI@`] `] @H@'G@H`HW@$< @$'<  @w___ϖ@`+p `@`#` # (`\Ots___ϐ@@`+p `@`#` # (`\Ots___ϐ@@`+p `@`#` # (`\Ots@_pww__w@ttD$D$D$D $ D$`D$`D$`D $` _\ x_O@ (`\@Ot_@@@@   @@`_ H'` H'âǦ@`+0 ``+p ` @' (`\OtswǢD$`D$`D$`D $` _\ _' (`\@Or@8@@@@w__ @ _ x@ @_A@`wwww_@_瀢H_`]@@@h_ x@@_`]@@@h_ @@_`]@@@h@@<t\u \u  8] t`] t`_`]@@@h@@<t\u \u  H] t`] t`_`]@@@h@@<t\u \u  X] t`] t`_`]@@@h@@<t\u \u  h] t`] t`_`]@h  @_`]@@@h _\ \ @@0A@`w  @@`]@w`x`]@@t` n,`p n,`` n,`P n,`@`] <``] <``]t``]t` `]t`0w@@`ww_w_?)ttOD$D$D$D $ D$`D$`D$`D $` _\ x_@www@_w'@_w'@_w'GGې  @ @ww_ _\ @ w?o_ _\ @ v?g_`o L` @HH';G;'c` L` @HH';G;'_GGӀHIGGπH?Gc&GǀHGπHH.G_'GˀHGӀHH" / H_G_'GߤL@Gc&, < _O.@< ,/ OGπO GӀO_w ' ' ' 'ǢD$`D$`D$`D $` _\ _ (`\@Or@H@_w@_@w__ @ _ x@ @_A@`wwww_@_瀢H_`]@@@h_ x@@_`]@@@h_ @@_`]@@@h@@<t\u \u  8] t`] t`_`]@@@h@@<t\u \u  H] t`] t`_`]@@@h@@<t\u \u  X] t`] t`_`]@@@h@@<t\u \u  h] t`] t`_`]@@@h@@<t\u \u  ] t`] t`_`]@@@h@@<t\u \u  ] t`] t`_`]@@@h _\ \ @@A@`w  @@`]@w`x`]@w` n/`p n/`` n/`P n/`@`]@<t\u \u `] t`] t``]@<t\u \u @] t`] t``]t`]t `]t0wСA@`www__ttD$D$D$D $ D$`D$`D$`D $` _D`D`  @  7@] H,]\ 7@4,0\@]`\ `]@H]`x_wGGG$G$@s@s@_7@ 7@]  O_\ _쾒@@w_w\ @ @_A@`wwww_@_瀢H_`]@@@h_ @@_`]@@@h@@<t\u \u  8] t`] t`_`]@@@h@@<t\u \u  H] t`] t`_`]@@@h@@<t\u \u  X] t`] t`_`]@@@h@@<t\u \u  h] t`] t`_`]@@@h _\ \ @@0A@`w  @@`]@@t` n,`p n,`` n,`P n,`@`]t``]t` `]t`0w@@ A@`wwww@_瀢H_`]@w߀@h_\ x@@@w_w\ x@ @_@ww0A@`w  @@`]@@t`x`]t` `]t``]t`0w@@㾰ww_w_g'ttD$D$D$D $ D$`D$`D$`D $` _\ x_@ww@_'@_'@_'GGא  @ @wwGGπHG'GGˀH_G, G۠N_D @< '{H' _\ /`@ < ,0D H H _G, G۠N_?`,0@D < -``OHs _?`,0@D /  'w_Gw-D '߀H _\ /`@< ,0D_G, G۠NGߠ@< MG{<`@.! H_\ /`@< ,0D_G, G۠NGߠ@< M<  .! Gw  O'w_\ /`@ < ,0D H H _G, G۠N@< ,``O _?`,0D /_G-G۠N<  `D༠< L@<  .! -```OGˀO4'GπO(_\ _2_@_@_@w__`@ _`x@ _`h@@_A@`wwww '_ @_瀢H_`]@@@h_`x@@_`]@@@h_`@@_`]@@@h@@<t\u \u `8] t`] t`_`]@@@h@@<t\u \u `H] t`] t`_`]@@@h@@<t\u \u `X] t`] t`_`]@@@h@@<t\u \u `h] t`] t`_`]@@@h,@@wߒ @w` '߀H_ˡ,0@`] HH'G_`˥,0$@ˠ '߀ O@__`]@@@h+`]@@HH! `]@HH `]@HH  `]@HH  _`]@@@h_\ \ @@@@`H߀ H _`h@  @w``H߀ H `\`D ''@\`H`] 'ː  @`t`] `] H˕(`] HHH'G\$``] `] H˕(`] HȑH'G\$``] `] H˕(`] HȑH'G\$``] `] H˕(`] HȑH'G\$``] `] H˕(`] HHH'G\$``] `] H˕(`] HȑH'G\$``] `] H˕(`] HȑH'G\$`(`] `] H˕(`] HȑH'G\$`,`] `] H˕(`] HHH'G\$`0 \$`H`H2߀ H`\`D '`] ?@\`H`] ?@?@?  @`t`] `] HH`] ȑHH`] HH'G\$``] `] ȑHH`] ȑHH`] HH'G\$``] `] ȑHH`] HH`] HH'G\$``] `] ȑHH`] HH`] HH'G\$``] `] HH`] HH`] HH'G\$``] `] ȑHH`] ȑHH`] HH'G\$``] `] ȑHH`] ȑHH`] HH'G\$`(`] `] ȑHH`] HH`] HH'G\$`,`] `] HH`] HH`] HH'G\$`0 \$`H`H:_`h@  @`t`] `] HH'G\$`<`] `] HH'G\$`@`] `] HH'G\$`D`]`]`]'@0A@`w  @@`]@w`x`]@@t` n,`p n,`` n,`P n,`@t``]t``]t` `]t`0w@@0'wG': :  'w_H@HH)GG2 "`Kr @Z5@3@*0B@Z`2*0B@" K+`" "@: 'ې&J@:  . ? 0'w_H@HHGG2 J r : 'Z@*0B@? 0'w_BLGJ@:  . BP@': : @'' G HGO@:  .; G"  O'@': : A@`w'w_@ X_X HHDTGH'G۠L<  .# _D `H@DT'ۿ?G'ە`] @ ǕI@_D `'ۑHH'G۱>`A@`www_B`'o_wWtt7D$D$D$D $ D$`D$`D$`D $`  `]?`L@/6 '_\  H6_\ \ ߡ,0\@w'_'\ \ `] @H_']\ L O6H]8_?`,0@ D`,0uD`,0H uߠ '_\   O_\  H `]_?`,0@D ,0u``O_\ x_@wGwg@_G'@_G'@_G'GGӐ  @ @wOw_G'GGˀHG'GGǀHw_gGGעL@G, @< ww @Go@H_w<`  H H'3=` ,$< .! '3H_w=` @'3?`,0\@G3\@'ۀ`H H'ۀ`H 'Gۦs?`,``O s_?`,0D Go L<  .) __GGפL@G.< .@``OGo < .@GǀO'G GˀO'_\ _O_@_G@_OA@`wwww_@_瀢H_`]@@@h_ @@_`]@@@h_ x@@_`]@@@h@@<t\u \u  8] t`] t`_`]@@@h@@<t\u \u  H] t`] t`_`]@@@h@@<t\u \u  X] t`] t`_`]@@@h@@<t\u \u  h] t`] t`_`]@@@h _\ \ @@0A@`w  @@`]@w``]@@t`x n,`p n,`` n,`P n,`@`]t``]t`0w@@A@`wwww_@_瀢H_`]@w߀@hF`]@@H`]H9w`8_`]@H`]H+w`8_`]@H`]Hw`8_`]@H`]Hw`8_`]@H`]w`8_`]@w߀@h*`H@@w`H @w`@ '`HH_ӡ-p`] HH'G_`@-p$@`'`H O@__`]@w߀h@`] HH'G'`L_`]@w߀h@`] HH'G'`P_`]@w߀h@`] HH'G'`T_`]@w߀h@?`X_`]@w߀h@`] HH'G'``@w_w`HH@\`@@_0A@`w/  h@@`]@t` `]t`0`]t`8$`Hw@@㾰ww_w_gڳtt{D$D$D$D $ D$`D$`D$`D $` _\ x_@ww@_'@_'@_'__`HH'cGc'`HH'cGc'GGӐ  @ @wwGGˀ@HGGǀH -8408< Hs_D HH  G 'ߢ`HPG 'ۢ`HAGߦ@GӀHH GۨGπH HH%_GעL- @-8408< @< @/_D H .8408< HH .8408< HGۤ 'G OGߤ 'G O.8508_GעO@/ @-84p8<`< ,`-8408< O GǀO`Gˀ@O{_\ __@_@_@w__ @ _ x@ @_A@`wwww_@_瀢H_`]@@@h_`x@@_`]@@@h_`@@_`]@@@h@@<t\u \u `8] t`] t`_`]@@@h@@<t\u \u `H] t`] t`_`]@@@h@@<t\u \u `X] t`] t`_`]@@@h@@<t\u \u `h] t`] t`_`]@h``@_`]@@@h`]@@HH '``]@H '`_`]@@@h _\ \ @@@0A@`w  @@`]@w`x`]@@t` n,`p n,`` n,`P n,`@`] <``] <`$``]t``]t` `]t`0w@@㾐A@`w?ww_w_G،ttD$D$D$D $ D$`D$`D$`D $` _\ xj_@ww_\ c_@ww@_'@_'@_'GGې  @ @ww_D HGGӀ@HGGπH_/ GߠO@ < < 'w_ < 's_D`LL<  .% D`LD`L<  .7 H H _/ GߠO@ < ,HU -8408< HN_/ GߠO@-8408< @< 'o_ < 'kM@_D`L<  .% D`M@D`MD`L@<  .% 'gH'gGg H 'gGg_/ GߠO@-84p8<`< ,`-8408< O GπOo`GӀ@OeHGGӀ@HGGπH_/ GߠO@ < 's_ 'o 'w 'W '[ '_ H''c 'cGs  H0'_Go'c H+'_Go  'c H$'_Go'cGs  H'_Go  'cGs  H'_H_D O, < #c_?DGcGsL@G_GoL@<  .7 H H  -8408< HC_/ GߠO@-8408< @< 'k_ 'gGcL@G_LL@G[L@GW@<  .% 'wH'wGw H 'wGw_/ GߠO@-84p8<`< ,`-8408< O_/ GߠO@ < , GπOJ`GӀ@O@_\ __@_@_@_,H\x@w__`@ _`x@ _`@ @_A@`wwww_@_瀢HJ_`]@@@h:`]@@H H/'``]@H H$'``]@H H'``]@H H'``]@H H'`'`_`]@@@h_`x@@_`]@@@h_`@@_`]@@@h_`@@_`]@@@h@@<t\u \u `8] t`] t`_`]@@@h@@<t\u \u `H] t`] t`_`]@@@h@@<t\u \u `X] t`] t`_`]@@@h@@<t\u \u `h] t`] t`_`]@h@`] HH'G'`_`]@h@`] HH'G'`_`]@h@`] HH'G'`_`]@h@`] HH'G'`_`]@@@h _\ \ @@@0A@`w  @@'``]@w`x`]@w``]@@t` n,`p n,`` n,`P n,`@$`$`$`$``]t``]t` `]t`0w@@㾀ww_Z !'Z !/__ttoD$D$D$D $ D$`D$`D$`D $` _D`'D`'GGې  @ @w'@_w /p8408< H/p848<  < @L@<  .! 4-/p8408< O/GGӀH4G'GGπH( /p8408< H/p86086N@_G, GߠN_,@D < -@ /p8408< OG GπO'GӀO_w ' ' ' 'ǢD$`D$`D$`D $` _\ _7 (`\@Or@;@_@w__ @ _ x@ @_A@`wwwww_@_瀢H_`]@@@h_ @@_`]@@@h@@<t\u \u  8] t`] t`_`]@@@h@@<t\u \u  H] t`] t`_`]@@@h@@<t\u \u  X] t`] t`_`]@@@h@@<t\u \u  h] t`] t`_`]@@@h w_\ \ @@__\ `]__@0A@`w  @@`]@w`x`]@@t` n,`p n,`` n,`P n,`@`]t``]t` `]t`0w@@㾐A@`wWww___DttoD$D$D$D $ D$`D$`D$`D $` _\ x"_@ww]_@ww@_'@_'@_'GGې  @ @wHw H!/ H/ H/ H/ H/M GH  AO BOOO ROOH H!/ H/ H/ H/ H/M GH  AO BOOO ROO_,0@D /,0@D /GGӀHGGπH}퀥 H"'SS_ H_GߢO.@< @wGG`] `] H HHH?'GG?쀤H"'GG_ H_GߢO.@< wGG`] `] H HHH?'GG? / H"_Gߥ4  +0   +p  @ӆs_GߢO.@< ,`/ OGπO GӀO}_\ _L_@_@_@_@w__`@ _`x@ _`@ @_A@`wwww_@_瀢H_`]@@@h_ x@@_`]@@@h_ @@_`]@@@h_ @@_`]@@@h@@<t\u \u  8] t`] t`_`]@@@h@@<t\u \u  H] t`] t`_`]@@@h@@<t\u \u  X] t`] t`_`]@@@h@@<t\u \u  h] t`] t`_`]@hL / _`]@hL / _`]@h@? _`]@@@h _\ \ @@0A@`w  @@`]@w`x`]@w``]@@t` n,`p n,`` n,`P n,`@ ,` ,``] <``]t``]t` `]t`0w@@@'GH#:. J@"  'Gc H'G: w0'G|: . J "!J@: . **@*@* @* @#: @`h#@@wA@`ww_!"!D@'߶  _?`,0$` Gߣ: 'ߡ<` !@ >$@$!'Õ`] _>,p,p ?`,0@>,0@<(Oh Hh H@H?_= ,p,p ?`,0hw < hw < `@aO O$`@H_?`,0@D aGߣ: 'ߡ<` @ ?$@_>,0 E ?`,0$`% '`@O _?`,0@D a< ,0@$`  _=,p,p @<`,0>,0(a< ,0<(OO`aO㾐A@`wGw'ww_``] H?gJ'CGC'Ӑ ''CGC'CC?`] (?``] H?gJ'CGC'˪ 'CGC'CC?`] (?_߀@h$GB`HB`"'G_B`HB`"'G_B` HB`"'˔@_B` HB`"GӒ 'Gϔ 'G˖ '˪ `_:`*0@B 'S:*0@B 'OGS@ : *0@B 'GO : *0@B '@: *0@B ': *0@B ' P`] `] Hȩ H?N`] `] Hȭ H?G*0*0 @@GÑ*0@(w H HH?_G*0@(w H HH?W̑ HH?wG*0@(w H  HH?_G*0@(w H  HH?WΑ HH?oؑHH?ׁHH㾠A@`wgw'w????Ǫ`] (?`] ?_!"!8D@H!"! @`] HH@ Jϑ ?w_!"! @@Hϝ ?o_!"! @ w ̑ȁHH< < _!"!(@`] HH@ JǑ ?w_!"!(@@Hǝ ?o_!"!(@ w ̑ȁHH< < _!"! `H`] (HH'cGc'`H`] H'ccHH'cGc'!"!(`H`] (HH'cGc'`H`] H'ccHH'cGc'__!"! @H?!"!(@H? '!"!0D@HT_!"!4D@H?OG@1@ OHHH??OG@$@@ OHH?`] H?`] H?`] H?@hG, 'G, 0'G, 'G, 0'G '_!"!0D@O?HHPA@`www_\ xր_@'@@'@@'_w_{tt_D$D$D$D $ D$`D$`D$`D $` GG$@'GG$@'GGː  @ @www_@  G׀H GۀHwG'   NG'   NNN?GG'   NG'   NNN?O_G, < @GGӠL@< w? _G'  '  G'  G'  H@@?7_!"!4D@H`] N`] N`] H?7`] N?77`] H`] H?/`] H`] H?'?''?//?7N' G _?_?`,0@D ,``O _?_?`,0D  D L@<  .! ,``OGۀORG׀OH_\ _Ӫ_@@@_@w__ @ _ x@ @_A@`wwww_@_瀢H_`]@@@h_ x@@_`]@@@h_ @@_`]@@@h@@<t\u \u  8] t`] t`_`]@@@h@@<t\u \u  H] t`] t`_`]@@@h@@<t\u \u  X] t`] t`_`]@@@h@@<t\u \u  h] t`] t`_`]@h !"! !"!(@_`]@h@!"!0'_`]@h@!"!'_`]@@@h`]@@`?'G%"8'_`]@@@h`]@@`?'G%"4'_`]@@@h _\ \ @@0A@`w "a@@@`]@w`x`]@w` n/`p n/`` n/`P n/`@`] !"! ?@`] !"!(?@ %"0'@!"!'@!"!8'@!"!4'@@`]@t``]t` `]t`0w@@ww_\ _w\ @hH*_`@\`hH! _>,0@ ?@@>,0< O_D`'ÉD`'Í@@@㾰ww_w\`hHw_o@ʮttD$D$D$D $ D$`D$`D$`D $` _\`\ @\`@wǀhHwGGז$@GGۘ$@  @ __GGנ$@'kk  GG۠$@'kk  @h@_Hfw@_@@L' _? ,0D $@  O@w GHH_ < @/G,@H _< L@<  .' ?`,0E-@``OH  ?`,0D,@``O ?` _@< -``O`GOw_㾐ww_w\`hv_@ttD$D$D$D $ D$`D$`D$`D $` _D`D`  @ __wh__whGGߖ$@GG$@  s@s@_HGGG$G$@s@s@_wߢD$`D$`D$`D $`  'Ǡ 'ˠ 'Ϡ '_\ _W (`\@Or@W@@w__`@ _`x@ _`h@ @_A@`wwww__w @_瀢H_`]@@@h_ x@@_`]@@@h_ @@_`]@h @ t \ @_`]@@@h@@<t\u \u  8] t`] t`_`]@@@h@@<t\u \u  H] t`] t`_`]@@@h@@<t\u \u  X] t`] t`_`]@@@h@@<t\u \u  h] t`] t`_`]@@@h _\ \ @@0A@`w  @@`]@w`x`]@@t` n,`p n,`` n,`P n,`@`]t``]t` `]t`0w@@@w_ H  HH  H@H@?HH0ww_ _`H `HH `HH?灠HH w_\r \r \r ?_` <`` < ` < w```` ``0A@`w'G,p,p`]@w@ 00A@`w'G,p,p`]@w@ 0A@`ww6p ''6 ''''?????G'G'G'וLG$ 'H H'G'G 'H H' 'G'ϕLG$ 'H H''G 'H H' 'G,`@G@@`o 0`\@OtǑ?'w7G,`@G@@j? 0`\@Otg?w/'H?w_7D _G'ׅG'ωGG4 `+0 ``+p ` @Gs*08408< L_7D _G'G'ωGG4 `+0 ``+p ` @(s*08408< L_7D _G'ׅHG'ωGG4 `+0 ``+p ` @s*08408< L_7D _G'ׅG'GG4 `+0 ``+p ` @s*08408< L_7D _G'G'GG4 `+0 ``+p ` @s*08408< L_7D _G'ׅHG'GG4 `+0 ``+p ` @Ǩs*08408< L_7D _G'ׅG'ωHGG4 `+0 ``+p ` @džs*08408< L_7D _G'G'ωHGG4 `+0 ``+p ` @fs*08408< L_7D _G'ׅHG'ωHGG4 `+0 ``+p ` @Ds*08408< L'wIH`] ?H?w_/D _G'ׅG'ωGG4 `+0 ``+p ` @s*08408< L_/D _G'G'ωGG4 `+0 ``+p ` @s*08408< L_/D _G'ׅHG'ωGG4 `+0 ``+p ` @s*08408< L_/D _G'ׅG'GG4 `+0 ``+p ` @Ʊs*08408< L_/D _G'G'GG4 `+0 ``+p ` @Ɠs*08408< L_/D _G'ׅHG'GG4 `+0 ``+p ` @ss*08408< L_/D _G'ׅG'ωHGG4 `+0 ``+p ` @Qs*08408< L_/D _G'G'ωHGG4 `+0 ``+p ` @1s*08408< L_/D _G'ׅHG'ωHGG4 `+0 ``+p ` @s*08408< L'wIH`] ???`] ?\r \r \r = = = ] t] t] t\t`\t`\t`w      㾐w???wwHe_@ @@?G_@ HGI@?_@ @@?G_@ HGI@?_@ HHQ?_  L 瑢 NH H?  L  NH (H?_ P_@ h?_ `_@ v?_ p_@ oߑ?oW\r \r \r  = = = ] t] t] t\t`\t`\H t`_D 8 OOw      СA@`www???w__D`8 H_Hw`P@ h?O_ `@@ v?G_ p@@ o??_ @@ h?7_ @@ v?/_ @@ o?'_ 畢 L ߑ NH H?  L  NH (H?O?oG?w?ב?oߐ\r \r \r = = = ] t] t] to\t`\t`\t`7O?/G?'??ߐ\r \r \r m= = = ] t] t] t\t`\t`\t`o\r \r \r ] r`] r`] -r`@?`] H`] ?`] H_`H`] ?W`] ?_`] ?gWH!w_ ?`@LI@?W_ ?_@ I@?__ ?_@ I@?gWw_      A@`wwww_@_瀢H_`]@h@`] `] H? @_`]@h@`] `] H? H_`]@h@? _`]@@@h@@<t\u \u  w] t`] t`_Ϣ P] t`] t`_`]@@@h@@<t\u \u  w] t`] t`_Ϣ `] t`] t`_`]@@@h@@<t\u \u  w] t`] t`_Ϣ p] t`] t`_`]@@@h@@<t\u \u  ] t`] t`_`]@@@h@@<t\u \u  ] t`] t`_`]@@@h@@<t\u \u  ] t`] t`_`]@h@? 0A@`w/  @@`]@t` `]t`0`] <`OsH H $`8dHH$`8 $`8`] @< wA@`wwww '_\  H6_\ \ ۡ,0\@w_\ \ `]@H_\ \ `]@H _\ \ `]@H_w۠ '_\   O_hb__'\ttD$D$D$D $ D$`D$`D$`D $` _\ x:_@ww@_'@_'@_'GGǐ  @ @ww `w`] ?O `w`] ?W `w`] ?_`] ?``] H `] H`] '`] '`] '`] H'_ P'` P''`'ې_@ G GHG'GGH_GˤOG-`_D`< wP?_''\`<<<\u \u \u ] t`] t`] t`_Gߕ0㙠0ם0ۡ0G_D `*p `@`* ` ;;ss=`=`=`]`t]`t]`tg\t`\t`\t`_OG''Ϛ_\ \r`\r`\r`s== = = ] t] t] t\t`\t`\t`g\r \r \r ] r`] r`] r`?`] ࠥ @P`] P H`] H?w`] P?w`] wH`] H!?o`] PP`] P H`] H?g`] P?gg?ooP'G_GˢOG, @_D @< ,`] PP`] P H`] H?_`] P?_`] _H`] H!?W`] PP`] P H`] H?O`] P?OO?WWP'G_GˢOG, @_D @< ,`] PP`] P H`] H?G`] P?G`] GH`] H!??`] PP`] P H`] H?7`] P?77???P'G_GˤOG. _E @< - E @< - GOS' GOG_\ _$_@_@_@w__ @ _ x@ @_A@`wwww_@_瀢H_`]@@@h_ x@@_`]@@@h_ @@_`]@@@h@@<t\u \u  8] t`] t`_`]@@@h@@<t\u \u  H] t`] t`_`]@@@h@@<t\u \u  X] t`] t`_`]@@@h@@<t\u \u  h] t`] t`_`]@h  @_`]@h@' _`]@h@? _`]@h@? _`]@@@h _\ \ @@0A@`w  @@`]@w`x`]@@t` n,`p n,`` n,`P n,`@`] <``] <``] <``] <`?$``]t``]t` `]t`0w@@ A@`wOwww '_\  H6_\ \ ,0\@w_\ \ `]@H_\ \ `]@H _\ \ `]@H_w '_\   O_h_w_oTttD$D$D$D $ 'D$`D$`D$`D $` _\ x2_@ww@_'@_'@_'GGϐ  @ @ww_ `wGG`] ? `wGG`] ? `wGG`] ?`] ?א7_@ G+G3H?G''GG/H3_GӤOG,` < wGG׍P?_'GG'GG7_\ WD<<<\u \u \u g] t] t] tw`] P?wW/\r \r \r = = = ] t] t] tg\t`\t`\t`_G'//'//ߚ7_\ W/\r`\r`\r`s}= = = ] t] t] t\t`\t`\t`_'G`] `] `] _``] `_ GD`W*p @*  ;;ss= = = ] t] t] tg/\r \r \r ] r`] r`] r`?_ ?@ I@`] P?`] ? H? H? H?P?`] H`] ?`] H`] ? RP'/G/_GӤOG. _E @< - RP'/G/E @< - RP'/G/E @< -R'/G/E @< - G/O' G3O_\ __@_@_@w__ @ _ x@ @_A@`wwww_@_瀢H_`]@@@h_ x@@_`]@@@h_ @@_`]@@@h@@<t\u \u  8] t`] t`_`]@@@h@@<t\u \u  H] t`] t`_`]@@@h@@<t\u \u  X] t`] t`_`]@@@h@@<t\u \u  h] t`] t`_`]@h@' _`]@h@? _`]@h@? _`]@h@? _`]@@@h _\ \ @@0A@`w  @@`]@w`x`]@@t` n,`p n,`` n,`P n,`@`] <``] <``] <`?$``]t``]t` `]t`0w@@@''G H GG@' OGG:. J@"': : pww_wo_O%tt_D$D$D$D $ D$`D$`D$`D $` _\ x_'@0 (`\@Ot_wwD$`D$`D$`D $` @_ww_D`D`  @ @w'@_wGGˀ@H;GGǀH1 / H&_Gϐ'G~$GϠ, GӐ'@Gv$GӢGߠL@< _/ O@@< , / O GǀO`Gˀ@O_\ __@_@w__ @ _ x@ @_A@`wwww_@_瀢H_`]@@@h_ x@@_`]@@@h_ @@_`]@@@h@@<t\u \u  8] t`] t`_`]@@@h@@<t\u \u  H] t`] t`_`]@@@h@@<t\u \u  X] t`] t`_`]@@@h@@<t\u \u  h] t`] t`_`]@@@h _\ \ @@0A@`w  @@`]@w`x`]@@t` n,`p n,`` n,`P n,`@`]t``]t` `]t`0w@@?@@o?@@@@ !TD-rsvg_filter_primitive_colour_matrix_set_attsC?C$?/v?Gz?nO;?=p =?-V?M?Q?1&?333333?䎊qj?u%F L@p@?@??UUUUUU?UUUUUU?UUUUUU????UUUUUU?UUUUUU?UUUUUU?UUUUUU?UUUUUU?UUUUUU????UUUUUU?UUUUUU?UUUUUU@ffeSourceGraphicBackgroundImagenoneSourceAlphaBackgroundAlphalibrsvg%s not found filterfilterUnitsuserSpaceOnUseprimitiveUnitsobjectBoundingBoxxywidthheightid-10%120%modemultiplyscreendarkenlighteninin2resulttargetXtargetYbiaspreserveAlphatruedivisororderkernelUnitLengthkernelMatrixedgeModewrapstdDeviationdxdy0feMergeNodevaluestypematrixsaturatehueRotateluminanceToAlpharsvg-filter.cRGBAfeFuncidentitytablediscretelineargammatableValuesslopeinterceptamplitudeexponentoffsetradiusoperatorerodedilateoutatopxorarithmetick1k2k3k4feFloodxChannelSelectoryChannelSelectorscalebaseFrequencynumOctavesseedstitchTilesstitchfractalNoisexlink:hrefazimuthelevationlimitingConeAnglezpointsAtXpointsAtYpointsAtZspecularExponentfeDistantLightfePointLightfeSpotLightlighting-colordiffuseConstantsurfaceScalespecularConstant@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)ieeefp.h 2.12 04/10/23 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03rsvg-filter.c /var/tmp/librsvg-2.31.0 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -xc99 -DHAVE_CONFIG_H -I. -I. -I. -DG_LOG_DOMAIN='"librsvg"' -DLIBRSVG_DATADIR='"/usr/local/share"' -I/usr/local/include -D_REENTRANT -D_PTHREADS -D_POSIX_PTHREAD_SEMANTICS -I/usr/local/include/gdk-pixbuf-2.0 -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include/libxml2 -I/usr/local/include/pango-1.0 -I/usr/local/include/freetype2 -I/usr/local/include -I/usr/local/include/cairo -I/usr/local/include/pixman-1 -I/usr/local/include/libpng14 -I/usr/local/include/libcroco-0.6 -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include/libxml2 -DHAVE_LIBCROCO='1' -L/usr/local/lib -I/usr/local/include -c -o librsvg_2_la-rsvg-filter.o rsvg-filter.cXa;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7C9 /var/tmp/librsvg-2.31.0rsvg-filter.c DD%rsvg-filter.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodatarsvg_filter_primitive_render.L51rsvg_filter_primitive_get_bounds.L_cseg0.L_cseg1gdk_pixbuf_get_interp_pixel.L105.L113rsvg_filter_fix_coordinate_systemrsvg_filter_free_pairrsvg_filter_context_free.L282.L292rsvg_filter_store_outputrsvg_filter_store_resultpixbuf_get_alpharsvg_compile_bg.L_cseg2rsvg_filter_get_bg.L346.L349.L353.L355.L359.L362.L366.L367rsvg_filter_get_resultrsvg_filter_get_in.L384.L395.L398.L402.L405.L409.L412.L415.L418.L421rsvg_filter_set_args.L429.L430rsvg_filter_blend.L_cseg3.L_cseg4.L_cseg5.L_cseg6rsvg_filter_primitive_blend_renderrsvg_filter_primitive_blend_free.L527.L530.L534.L538.L542.L546.L549.L552rsvg_filter_primitive_blend_set_attsrsvg_filter_primitive_convolve_matrix_renderrsvg_filter_primitive_convolve_matrix_free.L686.L689.L692.L695.L698.L702.L705.L708.L711.L714.L717rsvg_filter_primitive_convolve_matrix_set_attsbox_blurfast_blur.L_cseg7.L_cseg8rsvg_filter_primitive_gaussian_blur_renderrsvg_filter_primitive_gaussian_blur_free.L902rsvg_filter_primitive_gaussian_blur_set_attsrsvg_filter_primitive_offset_renderrsvg_filter_primitive_offset_free.L968.L971rsvg_filter_primitive_offset_set_atts.L981.L993rsvg_filter_primitive_merge_renderrsvg_filter_primitive_merge_freersvg_filter_primitive_merge_set_attsrsvg_filter_primitive_merge_node_set_attsrsvg_filter_primitive_merge_node_freersvg_filter_primitive_merge_node_renderrsvg_filter_primitive_colour_matrix_renderrsvg_filter_primitive_colour_matrix_free.L1135.L1143.L1146.L1150.L1154.L1158.L1190.L1117rsvg_filter_primitive_colour_matrix_set_atts.L_cseg9.L_cseg10.L_cseg11.L_cseg12.L_cseg13.L_cseg14.L_cseg15.L_cseg16.L_cseg17.L_cseg18.L_cseg19.L_cseg20.L_cseg21identity_component_transfer_functable_component_transfer_funcdiscrete_component_transfer_funclinear_component_transfer_funcfixpowgamma_component_transfer_func.L1254.L1260rsvg_filter_primitive_component_transfer_renderrsvg_filter_primitive_component_transfer_set_atts.L1338.L1342.L1346.L1350.L1354.L1357.L1365.L1368.L1371.L1374.L1377rsvg_node_component_transfer_function_set_attsrsvg_component_transfer_function_freersvg_filter_primitive_erode_renderrsvg_filter_primitive_erode_free.L1467.L1470.L1473.L1477rsvg_filter_primitive_erode_set_attsrsvg_filter_primitive_composite_renderrsvg_filter_primitive_composite_free.L1573.L1577.L1581.L1585.L1603.L1606.L1609.L1612rsvg_filter_primitive_composite_set_attsrsvg_filter_primitive_flood_renderrsvg_filter_primitive_flood_free.L1674rsvg_filter_primitive_flood_set_attsrsvg_filter_primitive_displacement_map_render.L_cseg22rsvg_filter_primitive_displacement_map_free.L1753.L1756.L1759rsvg_filter_primitive_displacement_map_set_attsfeTurbulence_setup_seedfeTurbulence_randomfeTurbulence_init.L_cseg23feTurbulence_noise2.L_cseg24.L_cseg25.L_cseg26feTurbulence_turbulence.L_cseg27.L_cseg28rsvg_filter_primitive_turbulence_renderrsvg_filter_primitive_turbulence_free.L1934.L1937.L1940.L1943.L1946.L1952rsvg_filter_primitive_turbulence_set_attsrsvg_filter_primitive_image_render_inrsvg_filter_primitive_image_render_extrsvg_filter_primitive_image_renderrsvg_filter_primitive_image_free.L2052rsvg_filter_primitive_image_set_attsnormdotproductnormalise.L2094get_light_normal_matrix_x.L2101get_light_normal_matrix_yget_surface_normalget_light_directionget_light_colour.L_cseg29.L2152.L2155.L2158.L2165.L2168.L2171.L2174.L2177rsvg_filter_primitive_light_source_set_atts.L2203.L2205.L2207rsvg_filter_primitive_diffuse_lighting_renderrsvg_filter_primitive_diffuse_lighting_free.L2283.L2286.L2289rsvg_filter_primitive_diffuse_lighting_set_attsrsvg_filter_primitive_specular_lighting_renderrsvg_filter_primitive_specular_lighting_free.L2366rsvg_filter_primitive_specular_lighting_set_attsmodrsvg_filter_primitive_tile_renderrsvg_filter_primitive_tile_freersvg_filter_primitive_tile_set_atts__align_cpy_8__dtoul__dtoursvg_new_filter_primitive_tilersvg_new_filter_primitive_specular_lightingrsvg_new_filter_primitive_diffuse_lightingrsvg_css_parse_colorrsvg_new_filter_primitive_light_sourcersvg_css_parse_angleacosrsvg_new_filter_primitive_imagegdk_pixbuf_copy_arearsvg_handle_get_base_urirsvg_pixbuf_new_from_hrefrsvg_get_image_of_nodersvg_new_filter_primitive_turbulencersvg_new_filter_primitive_displacement_maprsvg_new_filter_primitive_floodrsvg_parse_style_attrsrsvg_new_filter_primitive_compositersvg_new_filter_primitive_erodersvg_new_node_component_transfer_functiong_ascii_strtodrsvg_new_filter_primitive_component_transferpowrsvg_new_filter_primitive_colour_matrixg_assertion_messagesincosrsvg_new_filter_primitive_merge_nodersvg_new_filter_primitive_mergersvg_new_filter_primitive_offsetrsvg_new_filter_primitive_gaussian_blurrsvg_new_filter_primitive_convolve_matrixrsvg_css_parse_number_listrsvg_css_parse_number_optional_numberatofatoig_string_newrsvg_new_filter_primitive_blendg_string_assign_rsvg_node_freeg_string_freeabssqrt_rsvg_node_initrsvg_new_filterrsvg_defs_register_name_rsvg_css_parse_lengthrsvg_property_bag_lookuprsvg_property_bag_sizersvg_defs_lookuprsvg_get_url_stringrsvg_filter_parseg_logg_hash_table_lookupcairo_destroycairo_paintcairo_get_targetcairo_set_source_surfaceg_list_lastcairo_surface_destroycairo_createcairo_image_surface_create_for_datagdk_pixbuf_new_from_datag_malloc0_ng_strdupg_hash_table_insertstrcmpg_hash_table_destroystrncmprsvg_current_stateg_object_refg_str_equalg_str_hashg_hash_table_new_fullg_malloc_nrsvg_filter_renderg_freeg_object_unreffabs_rsvg_affine_invertgdk_pixbuf_get_has_alpharsvg_art_affine_imagegdk_pixbuf_get_rowstridersvg_alpha_blt_rsvg_affine_multiplygdk_pixbuf_get_heightgdk_pixbuf_get_widthceilfloorfmodmemsetgdk_pixbuf_get_pixelsgdk_pixbuf_new_rsvg_pixbuf_new_clearedrsvg_bbox_cliprsvg_bbox_insert_rsvg_pop_view_box_rsvg_css_normalize_length_rsvg_push_view_boxrsvg_bbox_init_rsvg_affine_identity_GLOBAL_OFFSET_TABLE_  #4C0`e`4@P 0P0 8p,H6O`hpy @ 08@P`h $$84x "%H7=C* U^gpy5P6xH (08@6;?CDjHpPvX|`pxD$L VPY8+[(<TZ[_0b<c@ h`.j4Oj`xtmnh4notHT@GNU\(c8jPq0xt< (08@H&,GHe8h`0|`h:pAHOV]dkry`x@x|<  ' . 5 <hh a 0H   ( 0 8 H P X ` d ( 1< Rh Yp ~  P H p   H ' ? S eX o ` h p p x | @ h<  " ) 0 7 > E4 ox p ؐ ڨX   , P 1߈\ < F M\ g0 n\  t   0      8 @ P ` pH\.5<C q< <>E(vz<<`(H,s01HLm0=Ly}nlfd'^OK@,y:#(8(XH`w$#<H^k!,BM`gv{h T',27>Tcx|hWlWVUU   TSS4SPStRQU    (TPS` d S  SSPR\PhUx |   P  NMLHWLW  K  K        0JTJxJJ  JJ,IPItJJ  JI(ILIpII  II $J HJ lI I  I  J  W W H 0G   F P T F LH `H pG G H H GG D,D8MDMpWtWHGHGBDDMMA4 8 hFtAHJ`J    \ ` 0 4 l@  @|?>?> W$WL<l:p: x9|9 >>  ;87  ,6|5WW?<,0 84P8d2t38HGHGOMMpWtW 1 > > (0\/d.p-x,    * + () \(!W!W!D!H !P4!h8!! !4!8"" "4"8"< "D4"l8"" "4# # # 4#h'#8#!#! #"#" #&#8$ $W$W$$$#$>$%$% %4%PW%TW%p"%&%& %!%'%' %4%(%( %!& )&) &4&@*&D* &L!&p &+&+ &!& ',', '$!'H '-'- '!' '.'. '!(((`W(dW(x<((0(0 ( (0(0 ( )(1),1 )8 )p1)t1 ) )/)/ *W* W*HG*TH*`D*lD*xD*M*M*M+3+3 +3+3 + + + + , , , ,$ ,3,3 ,3,3 , , - - -, -0 -\ -` -| - - - - - . .$ .D .H .p .t . . . . . . /4/4 /85/<5 /T /X /d5/h5 //5/5 /6/6 /5/5 / / 040 4 0(50,5 0L 0P 0\ 0` 0t50x5 0 0 0 0 0 0 0 0 1 1 1$ 1( 1D 1H 1l 1p 1 1 1 1 1 1 1 1 1 1 1 2 2 2$ 2H42L4 2d52h5 2 2 2 2 2525 2 2 2525 303333 3333 3333 3 3 3 3 4\34`3 5H5G5O68?6@?6H?66666W6W7"7979 7$!7@:7D: 7L47l;7p; 7x47<7< 747=7= 747>7> 8!8$80?84? 8<!8\8h@8l@ 8t!88*8* 8!8 9 +9+ 9!9< 9x,9|, 9!9 9-9- 9!: :P.:T. :\!::W:W:<::: :;;  ;; ;$ ;,;\7;`7 ;l8;p8 ;|A;A ;W;WCDWD WD@"DX>D\> Dd!DD@D@ D!DD*D* D!D E4+E8+ E@!Ed E,E, E!E F -F- F!F< FxDF|D F!FFEFE F!FFFFF G!G G0GG4G G<!GXHG\H Gd4GIGI G!GGJGJ G!GH(KH,K H4!HXHdLHhL Hp!HHMHM H!HNHN H4HH I4I(.I,. I4!I`Ip It J, J0 JH JL JJJJKHWKLWK`<KlKtKx KKK KK K K K K K L L L BL$B L0CL4C L@OLDO LWLWLGLHLMLMMDVXWV\WVRVR V5V5 VSVS VVV V4W4 W JW$RW(R W@5WD5 WPSWTS W`WpWt W4W4 WJW<Y>YHYGZOZ?Z?[8[D[L[W[W["[>[> [![[@[@ \!\$\0*\4* \<!\` \+\+ \!\ ],] , ]!]8 ]t-]x- ]!] ]V]V ]!^^.^ . ^(!^T^W^W^<^^^ ^^^ ^_ _ _$ _( _8T_<T _HU_LU _XW_\W `$M`0G`<H`HD`dO`lM`S`Sb?b?bcc cHWcLWch"c>c> c!cc@c@ c!cc*c* c!d  d\+d`+ dh!d d,d, d!d e4-e8- e@!ed eZeZ e!e f [f[ f!f< fx.f|. f!ffWfWg<g gg g g,g0 g8gd]gh] gt g]g] g gXgX hYh Y h\h\ hhWhlWhOiD^iH^ iP4iEi?i?j$j,jhWjlWj"j@j@ j!jj*j* j!k kD+kH+ kP!kt k,k, k!k l-l - l(!lL l.l. l!llWlWm<mm$m( m0m`_md_ mp`mt` mama mWmWm"n>n> n!n4n|nnWnWo<oo$o( o0o@coDc oPdoTd o`bodb p,Mp8GpDHpPDplOptMt?t?tXtdt|>ttWtWt"u>u> u!u0u<@u@@ uH!uhut*ux* u!u u+u+ u!v vL,vP, vX!v| v-v- v!v w$gw(g w0!wPwd<w3w3 w>whwh x!x ix$i x,4xHjxLj xT4xpkxtk x|4xlxl x4x.x. x!yy8>yH1y>ypyp y1yqyq y3y3 yrzr z(sz,s z83z<3 zTszXs ztzt z3z3 ztzt zqzq z3z3 {q{q {0s{4s {@3{D3 {\u{`u {t{t {3{3 {t{t {q{q {3{3 | q|q |8s|<s |H3|L3 |ds|hs |t|t |3|3 |v|v }03}43 }H>}X }\ }l }x }1}q}q }r}r }q}q }3}3 ~s~s ~$s~(s ~Ds~Hs ~`3~d3 ~t~t ~t~t ~v~v ~3~3 ~qq qq 0w4w H3L3 psts uu xx 33 tt tt yy 0343 Xq\q lqpq rr 33 ss ss ss 3 3 DtHt Xv\v ttxt 33 >1zz 33 <{@{ L3P3 t|x| 33 !! mm nn  WW0<<DH P\` hee ff oo WWJ|33 WW|  6}} MGHD0O8M|??WW"@@ !$0>4> <!\h*l* t! ++ ! @,D, L!p -- ! .. $!PWW<    hWlW"hh ! 4}}  4 ~$~ 8< D4X\ pt |4  4  !<T3X3 > !33  !083<3 `d l!33  ! !$,303 >WW<  ,}0} MGH D|OM?? ,4pWtW">> !@@ ! ** $!H ++ ! ,, !  \-`- h!  ! !,0 84TX `4.. !WW<  (48 @p t     W WMMGHDOM???@LX`WW" !>> 4$( 04PT \4| 4 4>> !?? !@L@P@ X!x** ! ++ !  \,`, h! -- ! 48 @!`h3l3  !33  ! 3$3 HL T!t|33 .. !WW0<<HL T`d lx|    ODM?(4<xW|W"@@ !** ! X+\+ d! ,, ! 0-4- <!` .. ! 8W<WP<\dh p|    (W,WMMGHDOM33  33  ???PWTWp">> !?? !@@ !$0*4* <!` ++ ! , , !8 t-x- !  ! !HL T!t.. !WW<$( 0<@ HTX `     WW8< WW   dh  55  $5(5 xW|WŨŬ   J@IƜ Ơ ƼJILP ǀDŽ   @55 4585 P5T5 WW@GLHXDOMA|3̀3 ̐3̔3 ̤5̨5 33 33 33   , 0 0?8?x΄ΌWW">> !,8@<@ D!dp*t* |!Ϡ ++ !  H,L, T!x д-и- !  $ ,!`lp x!єѬѰ Ѹ! ! 4HhLh T!pt |4Ҥ.Ҩ. Ұ!WW4<@HL T`d lӘ Ӝ Ӵ Ӹ  $ 04 ԰#7@ \NִC??GD,M,O٤٬??t?ڸ W$WH"`>d> l!یۘ@ۜ@ ۤ! !** !D ܀+܄+ ܌!ܰ ,, ! X-\- d!݈ .. !8W<WP<\dh p|ހ ވ޸޼   HWW  W$WHL dWW`3d3 4383 X \ H \ t   S(SHS8W<WSSSSSS SS   H L \ ` p t PWTWp" ! SS  ! ,S0S HL T!p** ! + + !8  !  $!H  !  !  \` h!WW<    hl WW(, 44TX `4 4XMdGpH|DOM33 33 33 0343 P T t x     ,A33 33 33 (3,3 @ D ` d x3|3 33 33 33 0343 T3X3 t3x3 33     33 33  3$3 83<3 33 33 33 33   ( , @3D3 d3h3 33 33 H?P?WW">> $!DP@T@ \!|** ! ++ !$ `,d, l! -- ! 8K<K D!htx ! ! !(.,. 4!`WW<       ,  0  @  D  T  X  p t      W W H L  T4 t x  4   4 xM G H D O M 3 3  3 3  43 83  P3 T3  pA `  d         33   L3P3 h3l3     ??0W4WP"h>l> t!@@ !** ! D+H+ P!t ,, ! - - (!L  ! !  !,<@ H!hx.|. !WW<   ,0 8h l |       MODM?$,hWlW">> !@@ !** !@ |++ ! ,, ! T-X- `! .. !0W4WH<T\` htx    66@ #"('(-(6(8?/J/V3Ob3p3xL @ lHبD0  /295 1283748915 0 0 100644 14916 ` ELF+6@@.shstrtab.text.rodata1.rodata.bss.data.picdata.comment.debug_loc.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_infoСA@`wwwwww_@_瀢H_`]@@@h w_\ \ @@_`]@hw_`]@h @@  (`\@Ot_`]@@@h@@<t\u \u  @] t`] t`_`]@@@h@@<t\u \u  P] t`] t`_`]@@@h@@<t\u \u  `] t`] t`_`]@@@h@@<t\u \u  p] t`] t`_`]@@@h`]@@H H' @? _`]@@@h`]@@H' 8`]@H ' 8_`]@h@' __\ `]__@_A@`w  @@`] ?`'` '``]@<t\u \u `Pw] u`] u``@]`t`]`t``]@<t\u \u @`pw] t] t``\t`\t` %`8%``]u`0w@@0A@`w/w????w@_wWo@o_W@ _D`H`] J`] H?_`?_o@_o@_D 8H o@Do@_D`HR``_@ h?O_ p_@ v?G`] ??`] ?7_D`4 ``OG?7@s_O J ??࠙G J` ?7O ?o`] ?w`] ?G` ???7?o@__ @ o_ @_@ h?_ P_@ v@@]o@@_@_@wW_W@_ 'kk Hk,0@_W< k 'kk  O@_@_wWB H._D`H _```@`H!_`] ?`] ?``@ h@?_ p_@ v]]]@@ 'kk_\  H@__\ \ k,0\@_@ @_k 'kk_\   O@_@__D H@_ρ A@`www@_h_@@@h\ \ `]@HH@A@`w?ww@_w _@ o?_\bw\bw\bw`] JH_h _h_h;`] ?`] ?נ '_\` (?\` 0?\`D ' D`$ H??G'??G'_^ < ,p,p$ (?^  0?^ D'G H H H=_h7G H?/?_\ >,p,p$ H /@H_/]]@@H??H@H_]]@@HG`H`H>_h8G H ??_\ < ,p,p$ ߁ @_]߉]@@H??@_υ]]@@Hr_hn`H^ =,p,p$ ?w^  H ?oϕ?wǕ?oG H_] < ,p,p$ ߕ?g]  וH ?_ߕ?gו?_wJoJ@J?WgJ_J@J?OwW?wo?og?g_?_J`] ʙN`] @?G__@@_D $ OidclassviewBoxrefXrefYmarkerWidthmarkerHeightorientautomarkerUnitsuserSpaceOnUsestrokeWidthpreserveAspectRatiomarker01@f@ !TD-@@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)ieeefp.h 2.12 04/10/23 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03rsvg-marker.c /var/tmp/librsvg-2.31.0 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -xc99 -DHAVE_CONFIG_H -I. -I. -I. -DG_LOG_DOMAIN='"librsvg"' -DLIBRSVG_DATADIR='"/usr/local/share"' -I/usr/local/include -D_REENTRANT -D_PTHREADS -D_POSIX_PTHREAD_SEMANTICS -I/usr/local/include/gdk-pixbuf-2.0 -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include/libxml2 -I/usr/local/include/pango-1.0 -I/usr/local/include/freetype2 -I/usr/local/include -I/usr/local/include/cairo -I/usr/local/include/pixman-1 -I/usr/local/include/libpng14 -I/usr/local/include/libcroco-0.6 -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include/libxml2 -DHAVE_LIBCROCO='1' -L/usr/local/lib -I/usr/local/include -c -o librsvg_2_la-rsvg-marker.o rsvg-marker.cXa;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7C9 /var/tmp/librsvg-2.31.0rsvg-marker.c DD%rsvg-marker.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodata.L20.L23.L26.L29.L32.L35.L38.L41.L44.L48.L51.L54.L57.L59rsvg_node_marker_set_atts.L66.L67.L_cseg0.L_cseg1.L_cseg2.L_cseg3sqrtatan2rsvg_render_markersg_freersvg_defs_lookuprsvg_get_url_stringrsvg_marker_parse_rsvg_pop_view_boxrsvg_pop_discrete_layerrsvg_state_poprsvg_node_drawrsvg_add_clipping_rectrsvg_push_discrete_layerrsvg_state_reconstructrsvg_state_reinitrsvg_state_push_rsvg_push_view_boxrsvg_preserve_aspect_ratio_rsvg_css_normalize_length_rsvg_affine_scale_rsvg_affine_rotate_rsvg_affine_multiply_rsvg_affine_translatersvg_current_statersvg_marker_render_rsvg_node_initg_malloc_nrsvg_new_markerrsvg_parse_style_attrsrsvg_css_parse_aspect_ratiorsvg_css_parse_anglestrcmp_rsvg_css_parse_lengthrsvg_css_parse_vboxrsvg_defs_register_namersvg_property_bag_lookuprsvg_property_bag_size_GLOBAL_OFFSET_TABLE_  #4 CHMRW \(a8fHkPpXuhzx 0 p.AYhw*=Qg~@P5Iaz B$BHA`d l@?  @  @ >0 4 <@`=  @=  @8=tx @= @  <4;DH P@lp x< < @: 9HBLB`7l6tx  = =dh BB432 $ 48 \1l202//  4.  2- /(/<3L2T,\4d+p*)4 ( $ ( 8 < T/ p/ ( , ' & % $& @$ xB |B " !    < 8B <B P4 d/       P t5  5\55TX lp 566@ h "'-68?JVQObpx!`H '(50  /323 1283748918 0 0 100644 11252 ` ELF+'@@.shstrtab.text.rodata1.bss.data.rodata.picdata.comment.debug_loc.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_infoA@`wwwwww_@_瀢H_`]@@@h`]@@H H'`x'`x_`]@@@h`]@@HH'`| '`|_`]@@@h@@<t\u \u `8] t`] t`_`]@@@h@@<t\u \u `H] t`] t`_`]@@@h@@<t\u \u `X] t`] t`_`]@@@h@@<t\u \u `h] t`] t`_`]@@@h w_\ \ @@@_`]@hw__``]__@_A@`w  @@'`x '`|`]@<t\u \u `8] t`] t``]@<t\u \u `H] t`] t``]@<t\u \u `X] t`] t``]@<t\u \u @h] t`] t``]t0w A@`ww_`] @H7_ `]\ O`,084084,0!H``]\ O`,084084,0 ! O O`H@<L@ )H@@H >L@O A@`www@_h_@@@h\ \ `]@HH@ A@`www@_h_@@@h\ \ `]@HH@A@`wwwwwwת_@_瀢H7_`]@@@h`]@@HH' 8 ' 8_`]@@@h w_\ \ @@_`]@hw__ `]__@_0A@`w  @@@ @$`8`]t`0`]t` w@@maskUnitsuserSpaceOnUsemaskContentUnitsobjectBoundingBoxxywidthheightidclassmask01url(clipPathclipPathUnits@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)ieeefp.h 2.12 04/10/23 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03rsvg-mask.c /var/tmp/librsvg-2.31.0 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -xc99 -DHAVE_CONFIG_H -I. -I. -I. -DG_LOG_DOMAIN='"librsvg"' -DLIBRSVG_DATADIR='"/usr/local/share"' -I/usr/local/include -D_REENTRANT -D_PTHREADS -D_POSIX_PTHREAD_SEMANTICS -I/usr/local/include/gdk-pixbuf-2.0 -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include/libxml2 -I/usr/local/include/pango-1.0 -I/usr/local/include/freetype2 -I/usr/local/include -I/usr/local/include/cairo -I/usr/local/include/pixman-1 -I/usr/local/include/libpng14 -I/usr/local/include/libcroco-0.6 -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include/libxml2 -DHAVE_LIBCROCO='1' -L/usr/local/lib -I/usr/local/include -c -o librsvg_2_la-rsvg-mask.o rsvg-mask.cXa;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7A7 /var/tmp/librsvg-2.31.0rsvg-mask.c DD%rsvg-mask.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodata.L20.L23.L27.L30.L34.L37.L40.L43.L46.L49.L51rsvg_mask_set_atts.L58.L59.L67.L102.L113rsvg_clip_path_set_atts_rsvg_node_freersvg_new_clip_pathrsvg_clip_path_parseg_freersvg_defs_lookuprsvg_mask_parseg_strndupstrncmprsvg_get_url_stringg_ascii_table_rsvg_node_initg_malloc_nrsvg_new_maskrsvg_parse_style_attrsrsvg_defs_register_name_rsvg_css_parse_lengthstrcmprsvg_property_bag_lookuprsvg_property_bag_size_GLOBAL_OFFSET_TABLE_  !2AFK P8UPZX_`dhipnxsxXP X|0p(00(DRbm{ -$-H,`d l+  *  +  *  $+H)  +) + )\` h+) +( +DH X'--%$ )  )X\ h) ) 8-<-PT `!|## ##  x-|-" *8-<-P"p| *--$,<@ H+d h p* +( +   (' `- d- x% $     66@    v v% v- v6 v8?JV9MbpxP  '0  /349 1283748921 0 0 100644 36892 ` ELF+@@.shstrtab.text.rodata1.rodata.bss.data.picdata.comment.debug_loc.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_info@w__`8h@@@@@0ww'_@\`8h _\`@G_@_ 8A@`wwwwww_@_瀢H?_`]@h ]8h@@@u8_`]@hw_`]@@@h w_\ \ _@@__\ `]__@_0A@`w  @@@@t`8`]t` `]t`(`]t`0w@@A@`wwww_ww@_瀢HO_`]@h _`]@h D@@w 8_`]@hw_`]@@@h w_\ \ _@@G @H`]Hw`]w__\ ___@_A@`www'_ D  H[@`]@_ 8 @ '@@@@ _ 8 @ '@@   Dh$`]@@_ 8-@@@ '@@@@ _ 8,0@@ '@@ D oG @H`]@@__\ @G_@_`@@ @w__`8h@@@@@0A@`w'  H@@`]@t` `]t`(`]t`0t`8G$`@$`Dw@@@Ӑ w@ wA@`wwwwww_@_瀢H_`]@@@h@@<t\u \u  8] t`] t`_`]@@@h@@<t\u \u  X] t`] t`_`]@@@h@@<t\u \u  H] t`] t`_`]@@@h@@<t\u \u  h] t`] t`_`]@hw_`]@@@h w_\ \ _@@__\ `]__@_A@`www'_`]@8_@ h@ '@@@@@@ X_@ v@ '@@@@`]@@H_@ h@ '@@@@@@ h_@ v@ '@@@@__\ @G_@_`@@ A@`w  x@@`]w`(`]w`0`]@<t\u \u @`hw] t] t`Xw\u \u `Hw] t] t`8\t`\t`w@@A@`wwwwww_@_瀢H_`]@@@h@@<t\u \u  8] t`] t`_`]@@@h@@<t\u \u  H] t`] t`_`]@@@h@@<t\u \u  X] t`] t`_`]@@@h@@<t\u \u  h] t`] t`_`]@@@h@@<t\u \u  x] t`] t` ' _`]@@@h@@<t\u \u  ] t`] t` ' _`]@hw_`]@@@h w_\ \ _@@__\ `]__@_㾰A@`wwww'_8_@ h?ߐH_@ v?אX_@ h?ϐh_@ v?ǐx_@ h?_@ v@?`] HH `] HHEHH??EHH???g`] @gH `] @??g`] @gH `] @?`] HH`] H?`] HH`] ?`]@H@ '@@@@ @ '@@`]@@ϕH@ '@@`]@@@ '@@@@ @ '@@@@ `] @ '@@@@ `] @ '@@@@ `] @ '@@@@ ωH@ '@@@@ H@ '@@`]@@ǕH@ '@@`]@@@ '@@@@ @ '@@@@ `] @ '@@@@ `] @ '@@@@ `] @ '@@@@ ϕH@ '@@@@ ljH@ '@@`]@@H@ '@@`]@@@ '@@@@ @ '@@@@ `] @ '@@@@ `] @ '@@@@ `] @ '@@@@ @ '@@@@ ǕH@ '@@`]@@H@ '@@`]@@@ '@@@@ @ '@@@@ `] @ '@@@@ `] @ '@@@@ `] @ '@@@@ H@ '@@@@ @ '@@`]@@__\ @G_@_`@@ A@`w  @@`]w`(`]w`0`]@<t\u \u @`w] t] t`xw\u \u `hw] t] t`Xw\u \u `Hw] t] t`8\t`\t`%`%`w@@A@`wwwwww_@_瀢H}_`]@@@h@@<t\u \u  8] t`] t`_`]@@@h@@<t\u \u  H] t`] t`_`]@@@h@@<t\u \u  X] t`] t`_`]@hw_`]@@@h w_\ \ _@@__\ `]__@_A@`www'_8_@ h?H_@ v?X_@ o?`] H`]@H@ '@@@@ @ '@@`]@@H@ '@@@@ `] HH@ '@@@@ `] HH@ '@@@@ H@ '@@@@ @ '@@@@ H@ '@@`]@@`] H@ '@@@@ H@ '@@@@ @ '@@@@ `] HH@ '@@@@ @ '@@@@ @ '@@`]@@@ '@@@@ `] H@ '@@@@ `] H@ '@@@@ @ '@@@@ @ '@@@@ @ '@@`]@@`] HH@ '@@@@ @ '@@@@ H@ '@@@@ `] H@ '@@@@ H@ '@@@@ @ '@@`]@@__\ @G_@_`@@ A@`w  h@@`]w`(`]w`0`]@<t\u \u @`Xw] t] t`Hw\u \u `8] t`] t`w@@A@`wwwwww_@_瀢H_`]@@@h@@<t\u \u  8] t`] t`_`]@@@h@@<t\u \u  H] t`] t`_`]@@@h@@<t\u \u  X] t`] t`_`]@@@h@@<t\u \u  h] t`] t`_`]@hw_`]@@@h w_\ \ _@@__\ `]__@_СA@`www'_8_@ h?H_@ v?X_@ h?h_@ v@?`] H `] H`]@H@ '@@@@ @ '@@`]@@H@ '@@@@ `] H@ '@@@@ `] HH@ '@@@@ @ '@@@@ @ '@@@@ @ '@@`]@@`] H@ '@@@@ @ '@@@@ @ '@@@@ `] H@ '@@@@ @ '@@@@ @ '@@`]@@@ '@@@@ `] HH@ '@@@@ `] H@ '@@@@ H@ '@@@@ @ '@@@@ H@ '@@`]@@`] HH@ '@@@@ H@ '@@@@ H@ '@@@@ `] HH@ '@@@@ H@ '@@@@ @ '@@`]@@__\ @G_@_`@@ A@`w  x@@`]w`(`]w`0`]@<t\u \u @`hw] t] t`Xw\u \u `Hw] t] t`8\t`\t`w@@dclassidpathvertspointspolylinepolygon M L Zx1y1x2y2lineM 0xywidthheightrxryrect H A V cxcyrcircle C ellipse@??QO@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wchar_c99.h 1.3 04/03/29 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03rsvg-shapes.c /var/tmp/librsvg-2.31.0 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -xc99 -DHAVE_CONFIG_H -I. -I. -I. -DG_LOG_DOMAIN='"librsvg"' -DLIBRSVG_DATADIR='"/usr/local/share"' -I/usr/local/include -D_REENTRANT -D_PTHREADS -D_POSIX_PTHREAD_SEMANTICS -I/usr/local/include/gdk-pixbuf-2.0 -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include/libxml2 -I/usr/local/include/pango-1.0 -I/usr/local/include/freetype2 -I/usr/local/include -I/usr/local/include/cairo -I/usr/local/include/pixman-1 -I/usr/local/include/libpng14 -I/usr/local/include/libcroco-0.6 -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include/libxml2 -DHAVE_LIBCROCO='1' -L/usr/local/lib -I/usr/local/include -c -o librsvg_2_la-rsvg-shapes.o rsvg-shapes.cXa;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7C9 /var/tmp/librsvg-2.31.0rsvg-shapes.c DD%rsvg-shapes.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodatarsvg_node_path_freersvg_node_path_draw.L36.L41.L44.L46rsvg_node_path_set_atts.L63.L65.L73.L75_rsvg_node_poly_set_atts.L84.L89.L93_rsvg_node_poly_draw_rsvg_node_poly_freersvg_new_any_poly.L129.L132.L135.L138.L144_rsvg_node_line_set_atts.L151_rsvg_node_line_draw.L158.L168.L171.L174.L177.L180.L183.L189_rsvg_node_rect_set_atts.L215.L216.L217_rsvg_node_rect_draw.L_cseg0.L_cseg1.L_cseg2.L233.L236.L239.L245_rsvg_node_circle_set_atts.L254_rsvg_node_circle_draw.L_cseg3.L281_rsvg_node_ellipse_set_atts_rsvg_node_ellipse_drawrsvg_new_ellipsersvg_new_circlersvg_new_rectfabsrsvg_new_line_rsvg_css_normalize_length_rsvg_css_parse_lengthrsvg_new_polylinersvg_new_polygong_string_freeg_string_append_cg_ascii_dtostrg_string_appendg_string_newrsvg_css_parse_number_list_rsvg_node_initg_malloc_nrsvg_new_pathrsvg_parse_style_attrsrsvg_defs_register_nameg_strduprsvg_property_bag_lookuprsvg_property_bag_sizersvg_render_pathrsvg_state_reinherit_top_rsvg_node_finalizeg_free_GLOBAL_OFFSET_TABLE_  #4 CDWxTkpuz@ (0@HPXx8D`hp!x'-FL hagmsy 8 L8%`<EK%pg(0.$hH< ,H,$6EUb}@8LS4W<VDWUTXXS0 4 <RdWlQ|  R  RP  OHXLX`MlL|    XXS(, 4RPT \RxK  R  RP   $ HOXXJ IHIGHI<@ HI`HlIxGHI IUTFTW\VdWXXML   XXS $ ,RPC RC R (C d h pR C  R   R <P P T dO X X  J B H I G B 0H <I D H PI dB tH I G B H I U T F X $X 8M DL L! P! \ ` l" p" |C @X DX hS # # R C $ $ RCX%\% dRC&& RC0'4' <R`C(( RC  $RH L TRP)) OXXB(B<BPBdBxB// //  0$0 4@P0T0 d@|00 @00 @// // / / $/(/ 8 < DJ`HlIxGHI++ IHI,, IHIG H,I8GD/H/ TH`IlGx/|/ HIG11 HIGHIGH(I0-4- <I\HhIp,t, |IHIGHIG// HIG // H(I4G@1D1 PH\IhGHIGHI++ IHI,, I H,I8GHHTI`Gl/p/ |HIG// HIG11 HIG HI$GDHPIX-\- dI|HI,, IHIGHIG// HI G,/0/ <HHITG`1d1 pH|IGHIGHI IUTFPXTXhMtL|.. ** "" CXXS22 RCT3X3 `RC44 RC, 0 8R\ ` hRP55 OXX$B8BLBX/\/ |  JHIGHI77 IHIG0949 HHTI`Gt9x9 HIGHIGHIG H I (7 ,7 4I H9 L9 `H lI xG H I G H I G 9 9 !H!I!G!4H!@I!LG!\H!hI!p7!t7 !|I!H!I!G!9!9 !H!I!G"9"9 "H"(I"4G"LH"XI"dG"tH"I"G"H"I"7"7 "I"9"9 "H"I#G# H#,I#8G#PH#\I#hG#|9#9 #H#I#G#H#I#G#H#I$$ $ I$ U$,T$8F$pX$tX$M$L$8$8 $6$6 $"$" $C%xX%|X%S%2%2 %R%C&$3&(3 &0R&TC&'&' &R&C&('( 'R',C'h 'l 'tR' ' 'R'P':': 'O(8X(<X(dB(xB(B(B(/(/ (/(/ ( ( )J)H)(I)4G)DH)PI)X7)\7 )dI)|H)I)G)9)9 )H)I)G)9)9 *H*I*G*4H*@I*LG*\H*hI*tG*H*I*7*7 *I*9*9 *H*I*G+H+I+ G+8H+DI+PG+d9+h9 +|H+I+G+H+I+G+H+I+7+7 +I, H,I,$G,89,<9 ,PH,\I,hG,|9,9 ,H,I,G,H,I,G,H,I-G-H-(I-07-47 -<I-P9-T9 -hH-tI-G-H-I-G-H-I-G-9-9 . H.I.$G.<H.HI.TG.dH.pI.x.| .I.U.T.F.X.X/M/ L/</< /$;/(; /4"/8" /DC66@ /01 "2'2-2628?98J98V<Ob=p=.ixAX =IA0  /377 1283748925 0 0 100644 23108 ` ELF+V@@.shstrtab.text.rodata1.rodata.bss.data.picdata.comment.debug_loc.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_info A@`www'_\_ p] @h\`h-\`u EaH'_\ x@_h `]`]@ _\ x@__r`x_Z (G_t p\ x@__t x0ww'G뀤H __\ @@@_ 7_\  H@__\ \ 74,0\@_@ @_7 7_\   OG뀤?H@_0ww'0www@A@`ww_@t _t  "H@_t @\ `]_t` `]t`(`]t`0t`@w_\ h@_@\ _\ h@ _\ h@ @w@_@_A@`wwwwwߪ@_瀢H,_`]@wπhw_`]@wπ@h @_\ \ _@@__\ `]__@@0A@`w  8@@`]@t`(`]t`0w@@@w_Z  0Z`hZ r`@ww_\ @___t`0A@`www__hH \`@hH Ow`]`]`] @ ?`㾰A@`woww'_wߐ @_@ h?_ߐ P_@ v?_ߐ `_@ h?_ߐ p_@ v?__\ @G_\ 8@h_@H@_]\ `]@H@ @@_@__@ @_@_@D`@HGD`84 `X``@s@ @`X `` @ @`H`P@ʔ @_`X@``@_D`H D`H ]D H_`H`P`X@``H @ @@_@__@ @_@_E`@H@_@A@`www'_`@_@ h?7`P_@ v?/``_@ h?'`p_@ v?__\ @G@_ 7@ Hw7@4,0 <7@ 7@  O@D`HB7?/?'??D`84 ``@s` ?`] ?`] ?` ?` J ʕ?` J ʕ?ϔ@_`@`H"`] ?`] ?`] ?`] ?7?/?ϔ@_'@ 7@ HG7@4,0 <7@ 7@  O@_EH1_\ h, 7@ Hw7@4,0@< 7@ 7@  O_7/'@ 7@ HG7@4,0@< 7@ 7@  O 7@_\  H@__\ \ 7@4,0\@_@ @_7@ 7@_\   O@_@_A@`wwww_@_瀢H_`]@h @@  (`\@Ot_`]@h@' 8_`]@@@h@@<t\u \u  `] t`] t`_`]@@@h@@<t\u \u  p] t`] t`_\ h_`]@@@h@@<t\u \u  @] t`] t`_\ h_`]@@@h@@<t\u \u  P] t`] t`_`]@@@h_\ \ @@@_w  A@`www_@\ H(_\ `]@h_\ `]@h__\``]\`@@w__ h@w @_A@`w  @@'` '`8`]@<t\u \u `@] t`] t``]@<t\u \u `P] t`] t``]@<t\u \u ``] t`] t``]@<t\u \u @p] t`] t``]t(`]t `]t0wA@`wwwwww_@_瀢H_`]@@@h@@<t\u \u  @] t`] t`_`]@@@h@@<t\u \u  P] t`] t`_`]@@@h@@<t\u \u  `] t`] t`_`]@@@h@@<t\u \u  p] t`] t`_`]@hw_`]@@@h w_\ \ @@_`]@@@h_\ \  8@@__\ `]__@_A@`w  @@`]w`(`]w`0`]@<t\u \u `@] t`] t``]@<t\u \u `P] t`] t``]@<t\u \u ``] t`] t``]@<t\u \u @p] t`] t`t8wA@`wwww_ww@_瀢HP_`]@wπhw_`]@wπ@h w_\ \ @@_`]@wπh @@ @ (`\@Ot_`]@wπh@' 8__\ `]__@_0A@`w  h@@@$`@ $`8`]t`(`]t`0w@@0A@`w  8@@`]@t`(`]t`0w@@0ww'__\ @G@_ 7_\  H(_ ]`\ 75,0\w_\ D!H@__\ \ 74,0\@_@ @_H  7]`  O@_0A@`w  8@@`]@t`(`]t`0w@@librsvgCircular SVG reference noticed, droppingclassidgrsvg-structure.csymbolviewBoxpreserveAspectRatiowidthheightxysvg0100%xlink:hrefusersvg_node_is_ancestor?@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)ieeefp.h 2.12 04/10/23 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03rsvg-structure.c /var/tmp/librsvg-2.31.0 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -xc99 -DHAVE_CONFIG_H -I. -I. -I. -DG_LOG_DOMAIN='"librsvg"' -DLIBRSVG_DATADIR='"/usr/local/share"' -I/usr/local/include -D_REENTRANT -D_PTHREADS -D_POSIX_PTHREAD_SEMANTICS -I/usr/local/include/gdk-pixbuf-2.0 -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include/libxml2 -I/usr/local/include/pango-1.0 -I/usr/local/include/freetype2 -I/usr/local/include -I/usr/local/include/cairo -I/usr/local/include/pixman-1 -I/usr/local/include/libpng14 -I/usr/local/include/libcroco-0.6 -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include/libxml2 -DHAVE_LIBCROCO='1' -L/usr/local/lib -I/usr/local/include -c -o librsvg_2_la-rsvg-structure.o rsvg-structure.cXa;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7F< /var/tmp/librsvg-2.31.0rsvg-structure.c DD%rsvg-structure.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodata.L25.L26_rsvg_node_draw_nothing_rsvg_node_dont_set_atts.L87.L90.L92rsvg_node_group_set_atts.L129.L116rsvg_node_is_ancestor.L141rsvg_node_use_drawrsvg_node_svg_draw.L_cseg0.L_cseg1.L200.L203.L206.L209.L213.L217rsvg_node_svg_set_atts.L233_rsvg_svg_free.L248.L249.L271.L273rsvg_node_use_set_attsrsvg_node_symbol_set_atts_rsvg_node_switch_drawrsvg_new_switchrsvg_new_defsrsvg_new_symbolrsvg_new_usersvg_defs_add_resolverrsvg_new_svgrsvg_property_bag_free_rsvg_node_svg_apply_attsrsvg_property_bag_ref_rsvg_css_parse_lengthrsvg_css_parse_aspect_ratiorsvg_css_parse_vbox_rsvg_pop_view_boxrsvg_add_clipping_rect_rsvg_push_view_box_rsvg_affine_scalersvg_preserve_aspect_ratio_rsvg_affine_multiply_rsvg_affine_translatestrcmprsvg_current_state_rsvg_css_normalize_lengthg_assertion_messageg_ptr_array_addrsvg_node_group_packrsvg_pop_def_grouprsvg_new_grouprsvg_parse_style_attrsrsvg_defs_register_namersvg_property_bag_lookuprsvg_property_bag_sizeg_string_freeg_ptr_array_freeg_freersvg_state_finalize_rsvg_node_finalize_rsvg_node_freersvg_state_initg_malloc_ng_ptr_array_new_rsvg_node_initrsvg_pop_discrete_layerrsvg_state_poprsvg_state_pushrsvg_push_discrete_layerrsvg_state_reinherit_top_rsvg_node_draw_childreng_slist_removeg_slist_appendg_logg_slist_findrsvg_node_draw_GLOBAL_OFFSET_TABLE_  &7(FK0P8 hp 8@H0Pph( @,  px!'-DJ@Y_ekqx@Xtt /I_v(?FYt 8<8t.<MThX|(0@IXgmz  \$\Z  YXWlUtTS[RQ\\ONMLL     tJIHGKI8\<\\Ft x E  ED C@\D\XNdPlVpV  4?x\|\   >0\4\\=t===U<  ;0:@9HTPS`[hRpQ8:97 9 $: 49 D6 LT 5 : 9 T S V R Q 4 H\ L\ p= = = = U < t8     9 $6 4 8 H L \ ` p t 9 6 T 5 S[ RLQT4\\F E3 $ ,EH2X\ dE1 E1DH PEt1 E10 4 <EhDp0\\F  E$ ( 0E\` pC.L\\N$P8!<! H1!! 1"" 1""  1\` l p | \\F  E<1x| E1 E1PT \E1  E  E(D4#8# @El,$$ C\\NP  %% ! ! ,1d!h! t1!! 1!! 1\\F  E  E,D8< DEl3 E2 C \$\8NDP\ ` l&p& \\NP   \UdTS[R$Q`\d\xNP''  66@ ("'-68?&J&V*Rb*p*x0 (9PU0  /408 1283748928 0 0 100644 61540 ` ELF+ @@.shstrtab.text.rodata1.rodata.bss.data.picdata.comment.debug_loc.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_info0w'  @@_@t`G$`w@@@w_h@\ @_0??@H@?灠HH@w_\  p x@H@?HHA@`ww_ "H@_t @ _@ 8_t`p ,` ,``]@ _t` ,` ,``]@<t\u \u _] t`] t``] <$$ $ᠠ $ $$( $$$$ ,`]@_t! `]@<t\u \u _] t`] t`$<$D!$L $T$d$l$t`]@<t\u \u _] t`] t` $ᨠ $thtxttt$$$$$$$$$$$$$$$$$$$$$($8$@$H$P$X$`$h$p$x$$$$ $$,$0$4$8`]`]`]`]@_t"@@w_@Z @__t`0ww_@Z __"H`\@Ot_t`_@\! _t! _@\!0_t!0@\ _@\ _@\"@_t"@_D!Ѐ H<  @_t!ض _D!ЀH_]aء>,0_\!<EaЀO0www'__D!_D!@H_!_$a__D!_D!@H_!_$a__D!_D!@H_ !_,a__D _D @H_@\ _\ h@_\ _t`__D _D @H_ _,`__D _D @H_D _$`__D _D @H_D _$`__D _D @H_D _$`__D _D @H_@\ _\ h@_\ _t`__D _D ȟ@H_ _,`__D _D @H _ _ \t`\t`__D _D @H_ _< __D _D @H_D _$`__D!_D!@H_D _$`__D!_D!@H_!_$a__D!_D!@H_D!_$a__D!_D!@H_D!_$a__D!_D!@H _!_!\t`\t`__D!@_D!@@H_D!<_$a<__D!H_D!H@H_D!D_$aD__D!P_D!P@H_D!L_$aL__D!X_D!X@H_D!T_$aT__D!`_D!`@H_D!\_$a\__D!h_D!h@H_D!d_$ad__D!p_D!p@H_D!l_$al__D!x_D!x@H_D!t_$at__D!_D!@H _!_!\t`\t`__D"_D"@H_\"_tb__D"_D"@H_\"_tb__D" _D" @H_\"_tb__D"0_D"0@H_D",_$b,__D"8_D"8@H_D"4_$b4__D!(_D!(@H _@\! _@\! _t! __D!_D!@H_D!_$a__D!_D!@H_D!_$a__D!8_D!8@H_Da8H@\a0_@\!0_t!0_DaЀ H1__D!DaH(_DaH@\a_D!В @_t_!D`$Р 'D`H_]aGߩ,p_\!<`'EaЀO__D!_D!@H _!_!\t`\t`G〤H_] x_t`x] pt`pE"($b( ,` ,`] ht`hE"$$b$@''G`??`0A@`www__`]U @''GHGHH  ?`0A@`www__`]# @'' ' : 0A@`www__`] @''G': : 0A@`www__`]͖ @w_@\! _@\!0_@\ _@\ _DaЀ H@\a_\"@h@_t"@A@`wwwww'_\"@@_wπh D HGۀHR_\"@@__G۔@@_`]@H __@!_$!_`]@H @_ߡ: _,`_`]@H __@!_$!_`]@H @_ߧ: _,a $a_`]@H _\ \ @__t h_`]@H_`]@H _H,`_`]@H _H,`_`]@H _Hz,`_`]@H _Hm,`_`]@H _H`,`_`]@H _HS,`_`]@H _HF,`_`]@H _H9,`_`]@H _H,,`_`]@H _H,`_`]@H _H,`_`]@H _H,` _,`_`]@H _\ \ @__t p_`]@H _\ \ @__t x_`]@H_`]@H__@ _$ _`]@H_`]@H _H$b(_$"(_`]@H>_`]@H_H0$"$_`]@H _H#$b$_`]@H _H$b$_`]@H _H $b$_`]@H _H$b$_`]@H _H$b$_`]@H _H$b$_`]@H _H$b$_`]@H _H$b$_`]@H _H$b$_`]@H _H$b$_`]@H _H$b$_`]@H _H$b$_`]@H _H$b$_`]@H _Hz$b$_`]@H _Hm$b$_`]@H _H`$b$_`]@H _HS$b$_`]@H _HF$b$_`]@H _H9$b$_`]@H _H,$b$_`]@H _H$b$_`]@H _H$b$_`]@H _H$b$ _$b$_`]@H& _$a_`]@H_H$!_`]@`?'Gˀ H _H$a_$!_`]@H& _$a_`]@H_H$!_`]@`?'Gˀ H _H$a_$!_`]@H& _$a_`]@H _H$a_`]@`?'Gˀ H_H$!_$!_`]@H_\`wǐ`_\ \ _@ _t @_ǁ_`]@H @_ߧ: _,` $`_`]@H" _$`_`]@H _H$`_`]@H_H$ _$ _`]@H" _$`_`]@H _H$`_`]@H_H$ _$ _`]@H_\`wǐ`_\ \ _@ _t @_ǁ_`]@H_ߦ@<t\u \u _] t`] t` $_`]@H6 _$`_`]@H_H%$ _`]@H _H$`_`]@H _H $``]`]_@ _`]@H @_ߧ: _,`Ġ $`ȁ_`]@H6 _$a_`]@H_H%$ _`]@H _H$`_`]@H _H $``]`]_@ _`]@H_ߦ@<t\u \u _] t`] t` $_`]@H__@!(@w_@\! __ta _`]@H@_w_@\!0__ta0 $a8_`]@H __@!@_$!<_`]@H __@!H_$!D_`]@H __@!P_$!L_`]@H __@!X_$!T_`]@HG_`]@H_$!`H8$!\_`]@h_!\D` $`_`]@h_!\D` $`_`]@h _`]@h_!\D` $` _$a`_`]@H# _$ah_`]@H_$!dH$!h_`]@H _H$ad_$!d_`]@H0 _$ap_`]@H_$!lH$!p_`]@H _H$al_`]@H _H$al_$!l_`]@HO _$ah_`]@H_$!dH=$!h_`]@H _`]@H _H'$ad_`]@H _H$ad_`]@H _`]@H _H$ad_$!d_`]@H9 _$ax_`]@H_$!tH'$!x_`]@h_H$!t_`]@h _H$at_`]@h _$at_`]@H _$a_ߦ@<t\u \u _!] t`] t`_`]@H_`]@H__@!_$!_`]@H_`]@H  _$a@_ߡ: _$a_`]@H _\ \ @__tb $b_`]@H _\ \ @__tb $b_`]@H _\ \ @__tb $b _`]@H  _$`_@_< _`]@H% _$a_ߦ@<t\u \u _!] t`] t```] H`] <`_`]@HB _$b0_`]@H _`]@H_H($",_`]@H _H$b,_`]@H _H$b,_`]@H _$b,_`]@HB _$b8_`]@H _`]@H_H($"4_`]@H _H$b4_`]@H _H$b4_`]@H _$b4_`]@H _$a_`]@H _DaЀ H@\a_$!Ё_`]@?wǀh '`] ? '_\ h Gâ '_ǡ<`,0\oGá<` @ ?$@  "H 'Gä@?,@,` '_!$ D  @_t!ؠ 'GÀH_G,0\@@_!\G,0<@\G,0@H?G GÀO'GHG_D!ЀH_\GGà$< ,0@,<@G 'DЀO@_`] HH _@\!_$!Ё wwww_@_w׀h ___{  A@`wwww__`]___`]___`]___`]___`]___`]___`]___`]___`]___`]___`]___`]___`]___`]y___`]r___`]k___`]d___`]]___`]V___`]O___`]H___`]A___`]:___`]3___`],___`]%___`]___`]___`]___`] ___`]___`]___`]___`]___`]___`]___`]___`]___`]___`]___`]___`]___`]___`]___`]__@ߦ'G߀H_$a $a A@`wwww_`]@ @ H@_`@`]@H _H$`_$ @_`@@_t @@ ' < A@`wwww_`]@? @7@H27@4,0]`]@ h@ Hw_ __@_ @_Gː@@_@7@ 7@@ O@A@`wwwww'۪ _\ \ @@_h`]`]`]`]@_\ \ @@_@@H _@whD H @H@__PG۔@@ww__r`r`0A@`www_h`]`]`]`] @#ց\ @__w 0A@`www_h`]`]`]`] @#\ @_`w`A@`wwww'ww_h`]`]`]`] @#\ w_h7_瀤h3_\ h.h*_`h"@wh@_w@_: w@_Ϫ@_w_\ _G@@_@@@__`@o@A@`ww`]`]@ @A@`ww`]`]@ @A@`ww_r`r``]r`(r`8r`@`]r`H`]r`P`]r`Xr``r`hr`pr`xr`r`r``]r``]r`A@`wwww @_w __ @ @ H`]`]@ @@@@ @@@@wwwww_瀤@h_\ @@@]@@@@h ]\``@@ 0www___㾐A@`wGww@_ _L H`]\ _?`L@,084084,0!H``]\ _?`L,084084,0 ! O_?`L@ H ' h'_?`L@/^`]\ O^,p84084,0  H`-H _?`L,H`H`' o h H' ,@`]\ _?`L@,084084,0!H``]\ _?`L,084084,0 ! O_@<`L (H H_'` '`]\ _?`L@,084084,0!H``]\ _?`L,084084,0 ! O_@=L/^`]\ O^-p84084,0  H `+H`-H`.H?G h H'_?`@@OG,0<@_O_$@< `]\ ?`L,084084,0!H``]\ _?`L,084084,0 ! O_@<`L ,H`H`)H  H'G O'`]@HG H H'_@H`]@HG`H`] H?`H H'_@__@H`]@HG HH? H H'_@__@Hw`]@H2G H _@__@H# H_@__@_@__@_@__@H HH'H>`]@HG H H6'_@__@H%`]@HG H H'_@o?g`] ?o__@H H '_?`L@O" 'G< www@_瀢H_ 8@_ @0www_w\`\`__\`UD`A@`wwww_\ \ @@_h  @_u_u`]@@@H  ? A@`wwwwwwwϠ 'ˠ 'w 'w@_π H__@__`]__瀤@h__@_߀h@: 'GǀH '`]@wGGˀH(`]\ _ߡ<L@,084084,0!HGǦ 'GˀH`]\ _ߡ<L@,084084,0 ! OGGˀH3`]\ _ߡ<L@,084084,0 ! H#_GL/`'O/_,p8:p8@GGˀH`]\ _ߡ<L@,084084,0!O_瀤h(_\` h#_׀h`]\`@wGH __@H H' 'G'@__\` h"_׀h`]\`@wGH __@H H' 'G'@__瀤h#_\` h`]\`@wGH __ʒ@H H' 'G'@_GHH __\ _H H' 'G'_@ GGˀO_׀h`]@w__@__瀤@h_׀h`]@@w_~_@_@_π H"_`]@wh__@_`]@wh__#@w_Z @@w_Z @@w_h _@Z _"H@wo A@`ww`]`]`]`]@_@h \`h_? ,0@\@_ < ,0@\@@ _? ,0\ow@w@_w@w@_0ww_@_w@w@_7@4 0www__@_0w_\ "H@@h@@ >,0@ @@< Ot`_t`@w_ \_`t@@"H@@ ww'G뀤 H+@_@G뀤 H_@@@@_@@@hG뀤H@@@H@@@`@@@ww_@h _@\`__@\ #0001Times New Roman12.00.0coloropacityflood-colorflood-opacityfiltera:adobe-blending-modenormalmultiplyscreendarkenlightensoftlighthardlightcolordodgecolorburnoverlayexclusiondifferencemaskclip-pathoverflowinheritenable-backgroundnewcomp-opclearsrcdstsrc-overdst-oversrc-indst-insrc-outdst-outsrc-atopdst-atopxorpluscolor-dodgecolor-burnhard-lightsoft-lightdisplaynonexml:spacedefaultpreservevisibilityvisiblefillfill-opacityfill-rulenonzeroevenoddclip-rulestrokestroke-widthstroke-linecapbuttroundsquarelibrsvgunknown line cap style %s stroke-opacitystroke-linejoinmiterbevelunknown line join style %s font-sizefont-familyxml:langfont-stylefont-variantfont-weightfont-stretchtext-decorationunderlineoverlinestrikeline-throughdirectionrtlunicode-bidiembedbidi-overridewriting-modelr-tbtbrltb-rlrl-tbtext-anchorstartmiddleendletter-spacingstop-colorstop-opacitymarker-startmarker-midmarker-endstroke-miterlimitstroke-dashoffsetshape-renderingautooptimizeSpeedcrispEdgesgeometricPrecisiontext-renderingoptimizeLegibilitystroke-dasharray,!important;:file %s: line %d: assertion `%s' failedrsvg-styles.ca_handlerCSS parsing error CSS unrecoverable error Error setting CSS SAC handler matrixtranslatescalerotateskewXskewY*.%s%s#%s%s#%s%s%s#%sstyletransform@@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wchar_c99.h 1.3 04/03/29 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03rsvg-styles.c /var/tmp/librsvg-2.31.0 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -xc99 -DHAVE_CONFIG_H -I. -I. -I. -DG_LOG_DOMAIN='"librsvg"' -DLIBRSVG_DATADIR='"/usr/local/share"' -I/usr/local/include -D_REENTRANT -D_PTHREADS -D_POSIX_PTHREAD_SEMANTICS -I/usr/local/include/gdk-pixbuf-2.0 -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include/libxml2 -I/usr/local/include/pango-1.0 -I/usr/local/include/freetype2 -I/usr/local/include -I/usr/local/include/cairo -I/usr/local/include/pixman-1 -I/usr/local/include/libpng14 -I/usr/local/include/libcroco-0.6 -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include/libxml2 -DHAVE_LIBCROCO='1' -L/usr/local/lib -I/usr/local/include -c -o librsvg_2_la-rsvg-styles.o rsvg-styles.cXa;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7C9 /var/tmp/librsvg-2.31.0rsvg-styles.c DD%rsvg-styles.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodatastyle_value_data_newstyle_value_data_free.L43.L44.L45.L46.L47.L_cseg0rsvg_state_inherit_runreinheritfunctiondominatefunctionclonefunctioninheritfunction.L240.L244.L248.L252.L256.L260.L263.L267.L271.L275.L279.L283.L287.L291.L295.L299.L303.L307.L312.L316.L320.L323.L327.L330.L335.L338.L342.L346.L350.L354.L358.L362.L366.L370.L374.L378.L382.L386.L405.L409.L413.L417.L428.L431.L442.L445.L450.L457.L460.L471.L475.L479.L482.L486.L491.L501.L505.L509.L512.L516.L520.L523.L524.L527.L531.L534.L541.L544.L547.L551.L555.L559.L563.L567.L571.L575.L581.L584.L588.L590.L594.L600.L605.L611.L615.L620.L627.L629.L633.L638.L640.L645.L651.L655.L659.L663.L667.L673.L679.L683.L687.L691.L695.L701.L705.L710.L714.L718.L722.L733.L740.L747rsvg_parse_style_pair.L_cseg1rsvg_lookup_parse_style_pair.L794.L797parse_style_value.L806.L811rsvg_css_define_stylecss_user_data_init.L850.L851.L852ccss_start_selectorccss_end_selectorccss_property.L896ccss_error.L903ccss_unrecoverable_errorinit_sac_handlerccss_import_style.L918rsvg_real_parse_cssbuffer.L998.L1004.L1013.L1022.L1032.L1038rsvg_parse_transform_attrapply_stylersvg_lookup_apply_css_style.L1074.L1083.L1104.L1113.L1122.L1138.L1145.L1148rsvg_state_reconstructrsvg_state_reinherit_toprsvg_state_popg_slice_allocrsvg_state_pushrsvg_property_bag_enumerateg_hash_table_sizersvg_property_bag_freersvg_property_bag_refrsvg_property_bag_newg_slice_free1rsvg_state_free_allrsvg_state_parentrsvg_current_stateg_string_freeg_strdup_printfg_string_append_cg_string_newstrlenrsvg_property_bag_sizersvg_parse_style_attrsg_hash_table_foreach_rsvg_affine_shear_rsvg_affine_rotate_rsvg_affine_scale_rsvg_affine_translate_rsvg_affine_multiplystrcmprsvg_parse_transformg_ascii_tablersvg_parse_cssbufferg_byte_array_freersvg_handle_get_base_uri_rsvg_acquire_xlink_href_resourcecr_parser_parsecr_parser_set_use_core_grammarcr_parser_destroycr_parser_set_sac_handlercr_parser_new_from_bufcr_doc_handler_newcr_term_to_stringg_strndupcr_string_peek_raw_str_lencr_string_peek_raw_strcr_simple_sel_to_stringcr_selector_unrefcr_selector_refrsvg_parse_styleg_strchugg_strchompg_strv_lengthrsvg_eval_switch_attributesrsvg_parse_style_pairsrsvg_property_bag_lookupg_strfreevg_strsplitg_ascii_strtodrsvg_marker_parsestrstrrsvg_css_parse_font_stretchrsvg_css_parse_font_weightrsvg_css_parse_font_variantrsvg_css_parse_font_stylersvg_css_parse_font_familyg_logrsvg_css_parse_overflowrsvg_clip_path_parsersvg_mask_parsersvg_filter_parsersvg_css_parse_opacityrsvg_css_parse_colorg_hash_table_insertg_hash_table_lookupg_hash_table_unrefrsvg_state_inheritrsvg_state_overridersvg_state_dominatersvg_state_reinheritrsvg_paint_server_unrefg_hash_table_refrsvg_paint_server_refrsvg_state_clonersvg_state_finalizersvg_state_reinitg_str_equalg_str_hashg_hash_table_new_full_rsvg_css_parse_lengthrsvg_paint_server_parse_rsvg_affine_identitymemsetrsvg_state_initrsvg_dpi_percentagesqrtrsvg_viewport_percentageg_freeg_strdupg_malloc_n_GLOBAL_OFFSET_TABLE_  #4CTX8nsx} (8 p$D$,08@P`h $*06<BHNTZ `0f@lHr`xh~px(8@HX`p &,28>DJPV\ b8hHnXt`zh (0@PXhp "(.4: @0F@LXRpX^djpv|!5\; (=8?,0(X#h)?`=@O@x]xcBPLn tBLC D CM`NXDN;BIP W(^0e8l@ sZHYY@XX0W Wx0+V`AOULcUuUXH$Ox"6I`v}EE01C]t <0  * 5 C _6 T vW8          : U [ s        L $ L 8xL LL a y   8 4      3 I P `0@ t y<    ,8   H    $ 0lp     HL XTX `d l p x |   Pdt <`|   ( <  (,HL  D P \h  Pp|    (DH Pd   ,0 8`d l    0!4! <d"h" p## $$ %%  4&8& @|'' ((  )) 0*4* <Xt+x+ ,, -- ..  0/4/ <d0h0 p11 22 33  4484 @h5l5 t66 77 88 89<9 Dl:p: x  $ $ <@ Hpt |;; <<  == @>D> Lt&x& %% ??  @$@ ,P*T* \AA BB  C C  XD \D d E E  * * ! F!F !!L!\!pG!tG !|!!H!H !!I!I !"J" J "("\K"`K "h"I"I ""J"J "#L#L # #@#P#dM#hM #p##N#N #$ O$O $$<P$@P $H$pQ$tQ $|$R$R $S$S $$T$T $$%U%U %$%HV%LV %T%xP%|P %%W%W %%R%R %X%X %& Y&Y &&4&Z&Z &&&& &[&[ &'' '<\'@\ 'H'd']'] '''^'^ ''(_( _ ((0(L`(P` (X(p*(t* (|(a(a ((b(b ()c)c ) )8d)<d )D)e)e ))*)* ))f)f )*,g*0g *8*\**`* *h*h*h **i*i *+j+ j ++8*+<* +D+lk+pk +x+l+l ++m+m ++n+n ,,o, o ,(,`p,dp ,l,*,* ,,q,q ,,r,r --(s-,s -4-`t-dt -l--u-u -.*.* . .(.Dv.Hv .P.h*.l* .t..w.w ../x/x //0/Ty/Xy /`//z/z ///{/{ /0$0d0h 00 0|0| 00}0} 00B0B 11$~1(~ 101X1\ 1d11 111 11}1} 22B2B 2$2H~2L~ 2T2|2 222 222 23@3@ 3$3L 3h3l 3t33 4L45D5P5T 5p 56(6,6L6P 6h(6l( 6K6K 66 6e6e 6?6? 6+6+ 7-7- 7,F70F 7HG7LG 7dH7hH 77 77 77 7Z7Z 7Y7Y 8 _8_ 8(\8,\ 8D]8H] 8`^8d^ 8|y8y 8'8' 8x8x 8w8w 88 9)9 ) 9$|9(| 9@u9Du 9\v9`v 9xL9|L 99 9{9{ 9N9N 9U9U :z:z : T:$T :<M:@M :Xp:\p :t`:x` :g:g :t:t :D:D :j:j ;[;[ ;A; A ;4;;;; ;;;;;; ;<(<0<8> >$ >,>0 >8 >< >D >H >P>h>x>>>?h?l?R?R ?? ?? ?? ??@@@@R@DR @L@P @X@\ @d@h @t@@@ARAR A A AA A$A( A4AAAAAB B B BXB\BlRBpR BxB| BBBBRBR BB BC(C,CHCL C`Cd CpCt CC CC CC DDD$DTD`DxRD|R DD DDDDDE(E4EDExEEFF0F4 FpFt FF GG GG HPHT HH HH IhII II JdJh JpJJJ JJJ K$K4KHKL KTKKKK KKL L0L@LLL\LtLLL LLLMM MMPM`Md M|MNN(NNNOO$O( O4O< OOOOOO P4P\P` PhPP PP Q4Q8 QQQ R,R0 R@R RR RS, SXS\ ShS T TLTP TXTt TT TT TTT TUU$U( U0VV$VhVlV|V VV V V V V VVWWWWXXPXXX Y YYYZZ,Z<ZhZ|ZZZ66@ [[Jc8"cH'cH-cH6cH8?jJjVnObn`pnv x{@ W0  /436 1283748931 0 0 100644 21812 ` ELF+P@@.shstrtab.text.rodata1.rodata.bss.data.picdata.comment.debug_loc.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_infow'_@G󀤠H@@H: `H ?`@H_Ϡ$@< h@?`=`@@ ?`'@_϶ `OhG`H_@<`Hw@_w_H w@@ w_ www_@\ @_D!Hh 7@4\`h] 7@4L H @ @H7@4_  o 7@4_ h_ 7@4@L` H ,`7@ 7@4_  o 7@4_ h+\7@4L@ H_D H  @H_ 7@4L@ H _H$`_$ 7@ 7@4_  ow߰A@`wwwwww_@_瀢H_`]@@@h@@<t\u \u  8] t`] t`_`]@@@h@@<t\u \u  H] t`] t`_`]@@@h@@<t\u \u  X] t`] t`_`]@@@h@@<t\u \u  h] t`] t`_`]@hw_`]@@@h w_\ \ _@@__\ `]__@_A@`wwwwww@_ '_\  HW_\ \ ӡ,0\@]`\ `]@Hw@__\ 8_w_Z __@@_@ H*]`\ `]@Hw@_____@b_@_H]`\ `]@H w____@Ր@Ӡ '_\   O@_A@`wwwwwߠ 'Ӫ 5@_\  Hc_\ \ 5@4,0\@@___`@ _`\ `]@Hw@__\ 8&_w_ ?_Z @@H@_< _@ H%_`\ `]@H w___@_@H'_`\ `]@H w___@u@'@_GӀH 5@ 5@_\   OG'۱< < A@`www' '___ @G 8_@ h?ߐ H_@ v?? X_@ hH@?? h_@ vH@?@_B!t H%`] ?__B@_B!t H?@_B!t H `] ȑ?ߠ '__ߖӁA@`w  x@@`]w`(`]w`0`]@<t\u \u @`hw] t] t`Xw\u \u `Hw] t] t`8\t`\t`w@@A@`wwwwww__\ @ _L`@ nH6`8_@ h_< @_B!t H*`] ?_D '__@_B!t H_ ϑ< @_B!t H _``] ȑ<`_L`P nH`H_@ v_< _ ?_ X_@ hH@_< _ ?_ h_@ vH@_:____ׁ wwww_L`@ nHL`P nHH ___=@?`A@`wwwwww_@_瀢H_`]@@@h@@<t\u \u  8] t`] t`_`]@@@h@@<t\u \u  H] t`] t`_`]@@@h@@<t\u \u  X] t`] t`_`]@@@h@@<t\u \u  h] t`] t`_`]@hw_`]@@@h w_\ \ _@@__\ `]__@_A@`w  x@@`]w`0 n/`P n/`@`]@<t\u \u @`hw] t] t`X\t`\t`w@@ wwwww_\ 8@h ____@ wwww_\ 8@h ___@H ?` A@`wwww_@_瀢H&_`]@w߀@h_\ \ `8@@_`]@w߀@h _\ \ _@@0A@`w  @@@`]@t 0t 8w@w_@\ @_A@`wwwww_\!0@h_@@@_D!l H H__@D!d@_@@_\! h@@_D!<@_D!D@_D!L@_D!T@_@_`] H_ 8`] HH'G@@_w@@@_!_@ h`] HH'@Gw"`!#"` @@_Da`H#_瀤hDa\ H @ w"`?4 "` @@_D!\ H @ w"`?4 "` @@_@@@@_瀤h_ǒ@?H_ǒ@ _D!d H H H' '_@G_wװ www_\`(h \`\ @_t (  0@___Z (t`_t`_D!t$`w߰@@A@`wwwww@_w!`] HH_Z \ w___@@@w'`] ȑH'G'@__Z \ _ _ G'Ȓ@_`G'`] ȑH<`@@_ׁ A@`ww_\ @G'ە`] ?HHA@`www_@@_A@`] : `] : @_B!d H@_B!d HH  ' (?C?灠HHxydxdyclassidtextRSVG_NODE_CHARStspantref0xlink:href@@@R@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03rsvg-text.c /var/tmp/librsvg-2.31.0 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -xc99 -DHAVE_CONFIG_H -I. -I. -I. -DG_LOG_DOMAIN='"librsvg"' -DLIBRSVG_DATADIR='"/usr/local/share"' -I/usr/local/include -D_REENTRANT -D_PTHREADS -D_POSIX_PTHREAD_SEMANTICS -I/usr/local/include/gdk-pixbuf-2.0 -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include/libxml2 -I/usr/local/include/pango-1.0 -I/usr/local/include/freetype2 -I/usr/local/include -I/usr/local/include/cairo -I/usr/local/include/pixman-1 -I/usr/local/include/libpng14 -I/usr/local/include/libcroco-0.6 -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include/libxml2 -DHAVE_LIBCROCO='1' -L/usr/local/lib -I/usr/local/include -c -o librsvg_2_la-rsvg-text.o rsvg-text.cXa;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7A7 /var/tmp/librsvg-2.31.0rsvg-text.c DD%rsvg-text.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodata_rsvg_text_chomp.L78.L81.L84.L87.L90.L93.L95_rsvg_node_text_set_atts.L107.L111.L115_rsvg_node_text_type_children_rsvg_node_text_type_tspan_rsvg_node_text_type_tref_rsvg_node_text_length_childrenrsvg_text_length_text_as_string_rsvg_node_text_length_tspan_rsvg_node_text_length_tref_rsvg_node_text_draw.L_cseg0.L_cseg1.L157_rsvg_node_tspan_set_atts.L235_rsvg_node_tref_set_attsrsvg_text_layout_freersvg_text_create_layout.L_cseg2.L_cseg3rsvg_text_layout_newrsvg_text_layout_widthpango_layout_iter_freepango_layout_iter_get_baselinepango_layout_get_iterpango_layout_get_sizeg_malloc0_npango_layout_set_alignmentpango_layout_set_textpango_attr_list_unrefpango_layout_set_attributespango_attr_strikethrough_newpango_attr_underline_newpango_attr_list_insertpango_attr_letter_spacing_newpango_attr_list_newpango_font_description_freepango_layout_set_font_descriptionpango_layout_new_rsvg_css_normalize_font_sizepango_font_description_set_sizepango_font_description_set_stretchpango_font_description_set_weightpango_font_description_set_variantpango_font_description_set_stylepango_font_description_set_family_staticpango_context_get_font_descriptionpango_font_description_copypango_context_set_base_dirpango_language_from_stringpango_context_set_languageg_freeg_object_unrefrsvg_new_trefrsvg_defs_add_resolverrsvg_new_tspan_rsvg_node_initg_malloc_nrsvg_new_text_rsvg_css_normalize_lengthrsvg_state_reinherit_toprsvg_pop_discrete_layerrsvg_state_poprsvg_state_pushrsvg_text_render_textrsvg_current_statestrcmprsvg_push_discrete_layerrsvg_parse_style_attrsrsvg_defs_register_name_rsvg_css_parse_lengthrsvg_property_bag_lookuprsvg_property_bag_sizeg_string_eraseg_string_newg_string_freeg_string_appendg_strdupg_strndupg_string_append_cg_string_append_leng_string_sized_newg_utf8_validatestrlenrsvg_make_valid_utf8_GLOBAL_OFFSET_TABLE_  !2 AhRW\af k(p0up8HP0 T3dPpTl XP` P, 'p>Ut,E\z>` 'B]dsh +;pQdk $4=GYm8@ehdcba` _(^4]|\[[xg|gZ  YX$ ( 0YTX  YX  Y,Xh l tY YW V8g<g\U TSR]  (T@Q`Px| TOgg|QN TS ] $ ( 0T l p xT P (g ,g XN hM |M M M S   S 8S X \ g g K J       $X g g N <M LS d h S S    MHMxMXg\gZ  YX  Y4Xp t |YX  Y XH L TYx| YW Vgg0K<JDH dh tXggZ $ ,YXHdh pYWggKJ!! \FdEggCDB@$AL?\>l=|<;9$$ %% :8765M$$($ @4`323130 /,.D.-,ggS +* )4$8$ X($$ FFgg0+H$L$ ggS  SS66@ pPk "'-68?%J%V(Mb(p)x0 (:8P0  /462 1283748934 0 0 100644 10476 ` ELF+$h@@.shstrtab.text.rodata1.data.rodata.bss.picdata.comment.debug_loc.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.data.rela.debug_info0ww__@\ '< < A@`www' ' _@h-〤H) 7@〤HH7@4,0]_`] @h 7@ 7@〤HO@H '< <  A@`www__@@@@HH _`]@w߀@hH  __@$@ `??  A@`ww ' _@h]HY `]@@h @@@h @@@@h `]@@ H @@`]@@h! 7HH74,0^x@H 7 7HO@@@H '< <  A@`www  _hI@HD_`]@@@h `]`] ߐ@ @H_`]@@@h`]\ `] Ő@ @H_`]@h3 _@h$`@'< < -LANGCenrequiredFeaturesrequiredExtensionssystemLanguagehttp://www.w3.org/TR/SVG11/feature#BasicTexthttp://www.w3.org/TR/SVG11/feature#BasicFilterhttp://www.w3.org/TR/SVG11/feature#BasicGraphicsAttributehttp://www.w3.org/TR/SVG11/feature#BasicPaintAttributehttp://www.w3.org/TR/SVG11/feature#BasicStructurehttp://www.w3.org/TR/SVG11/feature#ConditionalProcessinghttp://www.w3.org/TR/SVG11/feature#ContainerAttributehttp://www.w3.org/TR/SVG11/feature#Filterhttp://www.w3.org/TR/SVG11/feature#Gradienthttp://www.w3.org/TR/SVG11/feature#Imagehttp://www.w3.org/TR/SVG11/feature#Markerhttp://www.w3.org/TR/SVG11/feature#Maskhttp://www.w3.org/TR/SVG11/feature#OpacityAttributehttp://www.w3.org/TR/SVG11/feature#Patternhttp://www.w3.org/TR/SVG11/feature#Shapehttp://www.w3.org/TR/SVG11/feature#Structurehttp://www.w3.org/TR/SVG11/feature#Stylehttp://www.w3.org/TR/SVG11/feature#SVGhttp://www.w3.org/TR/SVG11/feature#SVG-statichttp://www.w3.org/TR/SVG11/feature#Vieworg.w3c.svg.static@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)ieeefp.h 2.12 04/10/23 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03rsvg-cond.c /var/tmp/librsvg-2.31.0 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -xc99 -DHAVE_CONFIG_H -I. -I. -I. -DG_LOG_DOMAIN='"librsvg"' -DLIBRSVG_DATADIR='"/usr/local/share"' -I/usr/local/include -D_REENTRANT -D_PTHREADS -D_POSIX_PTHREAD_SEMANTICS -I/usr/local/include/gdk-pixbuf-2.0 -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include/libxml2 -I/usr/local/include/pango-1.0 -I/usr/local/include/freetype2 -I/usr/local/include -I/usr/local/include/cairo -I/usr/local/include/pixman-1 -I/usr/local/include/libpng14 -I/usr/local/include/libcroco-0.6 -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include/libxml2 -DHAVE_LIBCROCO='1' -L/usr/local/lib -I/usr/local/include -c -o librsvg_2_la-rsvg-cond.o rsvg-cond.cXa;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7A7 /var/tmp/librsvg-2.31.0rsvg-cond.c DD%rsvg-cond.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodataimplemented_featuresnb_implemented_featuresimplemented_extensionsnb_implemented_extensionsrsvg_feature_comparersvg_cond_fulfills_requirement.L66rsvg_locale_compare.L83.L91.L93rsvg_cond_parse_system_language.L117.L121.L125rsvg_property_bag_lookuprsvg_property_bag_sizersvg_eval_switch_attributesg_freesetlocaleg_getenvg_strdupstrstrstrleng_ascii_strncasecmpg_strfreevbsearchrsvg_css_parse_liststrcmp_GLOBAL_OFFSET_TABLE_  !2AVn<pp !8'P-F]`y,%x&|&$  #X"&& !  8!x&|&$ $,HL T%hpt |"h&l&       < @ L P |  `     8( p0 8 @ H HP xX ` h p 8x h      H66@ ` 0  ( - 6 y?aJaVMb9pOxX @"@$80  /488 1283748938 0 0 100644 68492 ` ELF+H@@.shstrtab.text.rodata1.bss.data.rodata.picdata.comment.debug_loc.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_info0w__`(_`0\`\`@_`0@ @@0ww'_w\ 0_@G0www A@`www_w\`(\` _`]@H_`\ H@h \`@_`t`H0A@`www  8@`]r `]r `]r `]r _r (@w 0_ \\ Hw \t`H A@`wwww_`]@H@H_`]@H@H_`]@H@H_`]@H@H_`]@H@H_`]@H@H_`]@H@H_`]@H@H_`]@H@Ht_`]@H@Hf_`]@H@HX_`]@H@HJ_`]@H@H<_`]@H@H._`]@H@H _`]@H@H_`]@H@H_`]@H@H_`]@H@H_`]@H@H_`]@H@H_`]@H@H_`]@H@H_`]@H@H_`]@H@H_`]@H@H_`]@H@Hx_`]@H@Hj_`]@H@H\_`]@H@HN_`]@H@H@_`]@H@H2_`]@H@H$_`]@H@H_`]@H@H_`]@H@H_`]@H@H_`]@H@H_`]@H@H_`]@H@H_`]@H@H_`]@H@ rH_`]@H@ gH_`]@H@ bH_`]@H@ aH_`]@H@ dHs_`]@H@ sHf_`]@H@ pHY_`]@H@HK_`]@H@H=_`]@H@H/_`]@H@H!_`]@H@H_`]@H@H@h0@_w _Z`\ 0w _@_\ \ @_\ \ 0@h @@_\ t`0_`]@H _ \t`8\t`0@w@_ ww'_w\ _@hG뀤H< @@H_@G]\ @@@@]\ _@G0www A@`www_w\ _`]@H_`\ H@h \`@_`t H0A@`www  (@`]r `]r `]r `]r _r @_ \`t \`t`H@w@_ ww'_w\ _@hG뀤H< @@H_@G]\ @@@@]\ _@G0www A@`www_w\ _`]@H_`\ H@h \`@_`t H0A@`www  (@`]r `]r `]r `]r _r @_ \`t \`t`H@w@_ ww'_w\ _@hG뀤H< @@H_@G]\ @@@@]\ _@G A@`wwww_w`]_@_ A@`wwww_w\ _`\ `]@__`]_`@\ _`\ `]@ A@`www_w\ _`]@H_`\ H@h\`@_`t H_`\ `]@_0A@`www  (@`]r `]r `]r `]r _r @_ \`t \`t`H@w@_0ww'_wD`4H\`(_@:G A@`wwww_@D`0H'D`4H_`]@H_`(@c_H_`(_=__`]@H '`4 A@`www__`(_`]@H _`]@H\`\ Hh _` \`\ HZ ^t`HG`4H_`]@H'`4A@`www '_`]@w׀@hi@_@@h__`]@wǀ@h2`]@@H* _`]@wh_  `]@sH _  w__< @]@@H@@H`]_ @_  < @ '`]@ @ '_`w@@@_@  'Ӑ  8@w`]r `]r `]r `]r _\`\ Hr r (G" 0\`t HA@`wwww_@_ \\`Hh`PE` %`\\ H\`h_@H]_M` H@L` :H`w`M` O_`]@HƒH>_`]@HFH0_`]@HH"_`]@HH_`]@HH_@ A@`www__`D`P H\`H@h\`h_@_` PF$ &_N HL` :H`wN O_`\ H@h\`@_`t H_`\ 0@h _\`@\ H@@_`\ 8h_`]@H_`\ 8@@@w_w\ 8@ @_A@`www'_hG뀤H_\ \ 0@h_`]\`@\ H`]_\ \ 0\ @\ HJ '_\ \ 0\  H#_\ \ 0\ \ ۡ,0\@w_\ \ `]@H_۠ '_\ \ 0\   O@h_G@H _@Gw@_`8@_H_`8_@G  @@@_G@H _@G@ww`8@_H_@Gw`8`]@w``]w` _`$!_\ \ @@_\ \ 0@h@@@0ww'_]\ H@h \`h _G@_G3 ww_w\ \ X@_wwA@`www'www_w\`\ Xww_׀h @@@H w_߀h@@@G뀤 H*_πh&_׀@h @_ǒ@@H _߀@h @_ǒ@@@h \``@< wϐ@ _G__ϐ@@w`]\ @`]\ __@__@@ wwwww____ߔ y ww_w\ \ X@_ww0wwwwwwA@`wwww__`]@HQ@_@wϢ@@hH`]@@@@h `]@@ H0`]@@@@h&`]@@ H`]@@@@h@@@@@h \``@@ @_@@@A@`w`]D HV `]$``] !@`]`]t`(`]`]t`0`]`]t`P`]`]t``]`]t``]`]t``]`]t``]`]t`p`]`]t`x`]`]t`0w_@hHW @@ hHP _L aH zH _L AH ZHH> _H `O` aH zOO` AH ZOO` 0H 9O@L` +O -O .O@@ hH @L` :H L` /HL` /HH  > w@_H_@H@_@@@@0A@`www_h`]`]`]`] @$_h#SH@_H@_h_\ \ h@_ \ t`\ \` @\`0A@`www@_@@H`]`]`]`] @$8@_@@H`]`]`]`] @$9_\ @__ h@_w @_ @_ t`_ @\`0A@`ww_h`]`]`]`] @$TH\ \ @@A@`w`]@7@4 A@`www@_h)\ hHw`]w_`hH`]@_`]G`G`G` G`D_ߐ sss@sǁ@_`]@@ A@`wwwwww_h `]`]@_H> Ϡ \ t`h\ \ `h`]@@ _ \`t ` \`\ `$`_\ \ `__< @ 'ˀ H __\ r\ `H _\ t h_πh_@H  =`A@`wwwwߦ _ ] $`] t`h] \ `h\ ] \ ``] @ _\ @\ `@@H __\ ,\ `H _\ @\  _ \ $`\ t h_߀h_@H  ? @w_@\ _@\ _@\ p_@\ x_\ h@_\ (h@@_0A@`ww_h`]`]`]`] @$H \ \ hH\ @0A@`ww_h`]`]`]`] @$H \ \ hH\ @0A@`ww_h`]`]`]`] @%H \ \ hH\ @0ww_\ D`H  $`_@_\ $  _$` '둠<` $` '둠<`㾐A@`wGwww 'S_h`]`]`]`] @%K H$'_@h`]`]`]`] @%L H'@  @_瀤@hL`H_\ \ @@_\ \ 8hwH_\ \ 8h _瀤h H'_\ \ 8@@h H'`] ?__?W`] ?oo?g_瀤hL`h pHL`x pH E`H H'S_瀤h@```] HH `p`] HH 'SGS HL  @ @ww@_h @_@_Ϡ H'〥h _ p@w p]o@@__\ \ 8@ _ w_ ?W ?_ ?g ?o@_@@@_@_gH'CGC_$`oH'CGCH<$``?g`?o``_\  pgW`] HH`]@ `] HH'CGC_$``p_\  xo_`] HH`]@ `] HH'CGC_$`_D'CC<E 'CC<_\ \`h\` 'G< 㾀A@`w7wwwwOwG 'C_h`]`]`]`] @%H _@h`]`]`]`] @%H _瀠hL H_$ $ H @  @W  @_\ \ @_hH _\ \ 8h_$ $ Hu wπ@hHo   @ @wOwG@_hUh _`p@w`p]o@@@_G_\ \ 8@@ _` ?o_` ?w_` ?_` ?@_G@@@@oH'3G3_$`wH'3G3$`H'3G3'WH'3G3'[GW'33?_G['33?g_\ \`hW[\` 'C_Gh@_Oh@GC=`0A@`www_h`]`]`]`] @&H _@hL`HH  \\ @@ 2h ?`@?@B0A@`w??`] H `] `]H: `]: `] H `] `]: `]: @w?_@D0A@`ww??_@h`]`]`]`] @&h`] H `] \`H< p\`< p`] H `] _\ < x_\ < x A@`wwwww_h`]`]`]`] @&\ \`h\`__ ] t`_] t`_] t`A@`wwwww_@h `]`]@_ߠ HA'\`D`H `]`]@_ߠ H0'ۢ`D`H$`_瀤  h_ ` H  ` H@u]@h__@< _`]@@ H'____'G۱< A@`www_h `]`]@_H- \@D`HH% \`h@ @@@w@_`@_@_`w`__@'@HG_ސ>A@`wwwwww@_@@H`]`]`]`] @'BH @_@@H`]`]`]`] @'CH _瀤@h @@@HH`]`]`]`] @'DH| _߀h\ hH`]`]`]`] @'EHa _\`w`h_``h`]@@@@ ``t` \`$`__@ w_``@ w@_`` H __``@_H1 @_``' H_h_@H__\ q\ `H @t`h_h_@H ``\`\ w@\`w``@_@_`  '` =`A@`ww'ww@_@@H`]`]`]`] @'HU_瀤@h @@@HH`]`]`]`] @'H6_߀h\ hH`]`]`]`] @'H__@_ߢwǀ@hH@@@_G_@_w@__ϰ@A@`www'ww@_@@H`]`]`]`] @'Hs_@h @@@HH`]`]`]`] @'HT_߀@h @@@HH`]`]`]`] @'H5_׀h\ hH`]`]`]`] @'H@@_h@@___@@H@@H@P@@P@0www_Z 0__@w_Z \ (@w_Z \ 00ww@_@_Z \ @_@@@@ ww????_Z \ _ϟ w????_Z \ 8ן ww??_Z \ @_ߟwװ@w_Z 0ww _"  _? *0@_@: (  O㾰A@`woww_D H_D` H`?` ?``H? `HH ?`] ????_@ (_ (@ _>  &'kkHH?<`'kkHH? Nϑ LHߡH?Ǖ Nב LH瑢H?w_ D`H????H$` H?H?wH?wH?O_< < < < 㾰A@`woww_D H_D HH? H?? H ?`] ????_@ (_ (@ _>  &'kkHH?<`'kkHH? Nϑ LHߡH?Ǖ Nב LH瑢H?w_ D`H????H$` H?H?wH?wH?O_ H?_  H?_  H H?_  H H?_< < < < 0w??  (@_ @ (`\Or_\ h@_t h< X< `@w_\`h\ `@ (`\Ot_\ h@\ _\ h@@_t h0A@`wwww@_`]__@@ stylegaswitchdefsusepathlinerectellipsecirclepolygonpolylinesymbolsvgmaskclipPathimagemarkerstoppatternlinearGradientradialGradientconicalGradientfilterfeBlendfeColorMatrixfeComponentTransferfeCompositefeConvolveMatrixfeDiffuseLightingfeDisplacementMapfeFloodfeGaussianBlurfeImagefeMergefeMorphologyfeOffsetfeSpecularLightingfeTilefeTurbulencefeMergeNodefeFuncRfeFuncGfeFuncBfeFuncAfeDistantLightfeSpotLightfePointLightmultiImagesubImageRefsubImagetexttspantrefdesctitle%s="%s" <%s > metadata xi:includexi:fallbackincludehrefparseencodingutf-8RSVG_NODE_CHARSxml-stylesheetalternatenotypetext/csslibrsvgfile %s: line %d: assertion `%s' failedrsvg-base.chandle != NULLRSVG_IS_HANDLE (handle)G_IS_FILE (base_file)handlersvg-error-quarkError domain %d code %d on line %d column %d of %s: %sdata-Error parsing XML datadimension_dataposition_data!priv->is_closedG_IS_INPUT_STREAM (stream)cancellable == NULL || G_IS_CANCELLABLE (cancellable)error == NULL || *error == NULLG_IS_FILE (file)base_file == NULL || G_IS_FILE (base_file)%s: assertion `%s' failed@V@Vrsvg_handle_write_impl?@@(?@Vrsvg_handle_writersvg_handle_close@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)ieeefp.h 2.12 04/10/23 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03rsvg-base.c /var/tmp/librsvg-2.31.0 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -xc99 -DHAVE_CONFIG_H -I. -I. -I. -DG_LOG_DOMAIN='"librsvg"' -DLIBRSVG_DATADIR='"/usr/local/share"' -I/usr/local/include -D_REENTRANT -D_PTHREADS -D_POSIX_PTHREAD_SEMANTICS -I/usr/local/include/gdk-pixbuf-2.0 -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include/libxml2 -I/usr/local/include/pango-1.0 -I/usr/local/include/freetype2 -I/usr/local/include -I/usr/local/include/cairo -I/usr/local/include/pixman-1 -I/usr/local/include/libpng14 -I/usr/local/include/libcroco-0.6 -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include/libxml2 -DHAVE_LIBCROCO='1' -L/usr/local/lib -I/usr/local/include -c -o librsvg_2_la-rsvg-base.o rsvg-base.cXa;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7A7 /var/tmp/librsvg-2.31.0rsvg-base.c DD%rsvg-base.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodatarsvgSAXHandlerStructInitedrsvg_style_handler_freersvg_style_handler_charactersrsvg_style_handler_start.L36rsvg_style_handler_endrsvg_start_style.L53.L57.L61.L65.L69.L73.L77.L81.L85.L89.L93.L97.L101.L105.L109.L113.L117.L121.L125.L129.L133.L137.L141.L145.L149.L153.L157.L161.L165.L169.L173.L177.L181.L185.L189.L193.L197.L201.L205.L209.L213.L217.L221.L225.L229.L233.L237.L241.L245.L249.L253.L257.L261.L265rsvg_standard_element_startrsvg_desc_handler_freersvg_desc_handler_charactersrsvg_desc_handler_start.L307rsvg_desc_handler_endrsvg_start_descrsvg_title_handler_freersvg_title_handler_charactersrsvg_title_handler_start.L349rsvg_title_handler_endrsvg_start_titlersvg_metadata_handler_freersvg_metadata_handler_characters.L384rsvg_metadata_props_enumerate.L391.L392rsvg_metadata_handler_start.L400.L405rsvg_metadata_handler_endrsvg_start_metadatarsvg_xinclude_handler_freersvg_xinclude_handler_charactersrsvg_characters_impl.L437.L442rsvg_xinclude_handler_startrsvg_start_xinclude.L452rsvg_xinclude_handler_end.L468.L473.L477.L480.L485rsvgSAXHandlerStructrsvg_start_elementrsvg_end_element_rsvg_node_chars_free.L573rsvg_charactersrsvg_get_entityrsvg_entity_declrsvg_unparsed_entity_declrsvg_get_parameter_entityrsvg_error_cb.L647.L651.L655.L657.L660rsvg_processing_instructionrsvg_path_is_uri.L734.L735.L736.L737.L759.L766.L781.L788.L797.L801.L805.L807rsvg_set_error.L811rsvg_handle_write_impl.L834rsvg_handle_close_impl.L918.L_cseg0.L_cseg1.L_cseg2.L_cseg3.L_cseg4.L_cseg5.L971.L_cseg6.L1086.L1071.L1098.L1129.L1138.L1147.L1171.L1210.L1382g_slist_delete_link_rsvg_pop_view_box_rsvg_push_view_boxrsvg_bbox_clip_rsvg_affine_multiply_rsvg_affine_invertrsvg_bbox_insertrsvg_bbox_initrsvg_get_image_of_nodersvg_add_clipping_rectrsvg_render_imagersvg_bpath_def_freersvg_render_markersrsvg_bpath_def_art_finishrsvg_parse_pathrsvg_render_pathrsvg_push_discrete_layerrsvg_pop_discrete_layerxmlCleanupParserrsvg_termxmlInitParserg_type_initrsvg_initrsvg_handle_newrsvg_handle_new_from_stream_syncg_file_readrsvg_handle_new_from_gfile_syncxmlParseDocumentxmlFreeInputStreamxmlPushInputxmlNewIOInputStream_rsvg_xml_input_buffer_new_from_streamg_cancellable_get_typeg_input_stream_get_typersvg_handle_read_stream_syncg_converter_input_stream_newg_converter_get_typeg_zlib_decompressor_newg_type_check_instance_castrsvg_handle_closeg_memdupg_memory_input_stream_add_datag_memory_input_stream_newrsvg_handle_writersvg_handle_set_size_callbackrsvg_handle_set_dpi_x_yrsvg_handle_set_dpirsvg_set_default_dpi_x_yrsvg_set_default_dpirsvg_handle_has_subrsvg_handle_get_position_sub_rsvg_css_hand_normalize_lengthrsvg_state_popcairo_restorersvg_node_drawcairo_saversvg_state_pushg_slist_prependcairo_surface_destroycairo_destroyrsvg_cairo_new_drawing_ctxcairo_createcairo_image_surface_creatersvg_defs_lookuprsvg_handle_get_dimensions_subrsvg_handle_get_dimensionsrsvg_handle_get_descrsvg_handle_get_titlersvg_handle_get_metadatag_slist_freersvg_state_free_allrsvg_render_freersvg_drawing_ctx_freersvg_defs_resolve_allg_propagate_errorrsvg_return_if_fail_warningg_set_errorxmlCtxtGetLastErrorg_quark_from_stringrsvg_error_quarkg_file_get_urig_object_unrefg_object_refg_file_get_typersvg_handle_get_typeg_type_check_instance_is_arsvg_handle_set_base_gfilersvg_defs_set_base_urig_logrsvg_handle_set_base_urig_build_filenameg_get_current_dirg_filename_to_urig_path_is_absolutersvg_get_base_uri_from_filenamestrlenmemsetrsvg_SAX_handler_struct_initg_strfreevrsvg_css_parse_xml_attribute_stringg_strdupg_hash_table_insertxmlNewEntityxmlCharStrndupxmlBuildRelativeURIxmlFreeg_hash_table_lookupg_string_new_len_rsvg_node_initg_malloc_n_rsvg_node_free_rsvg_node_svg_apply_attsrsvg_pop_def_grouprsvg_property_bag_freersvg_property_bag_newg_byte_array_freexmlFreeDocxmlFreeParserCtxtxmlParseChunkxmlCreatePushParserCtxtg_convertrsvg_handle_get_base_uri_rsvg_acquire_xlink_href_resourcersvg_property_bag_lookuprsvg_property_bag_enumerateg_string_append_printfg_string_appendrsvg_make_valid_utf8g_utf8_validatersvg_node_group_packrsvg_defs_register_memoryrsvg_node_set_attsrsvg_new_trefrsvg_new_tspanrsvg_new_textrsvg_new_filter_primitive_light_sourcersvg_new_node_component_transfer_functionrsvg_new_filter_primitive_merge_nodersvg_new_filter_primitive_turbulencersvg_new_filter_primitive_tilersvg_new_filter_primitive_specular_lightingrsvg_new_filter_primitive_offsetrsvg_new_filter_primitive_erodersvg_new_filter_primitive_mergersvg_new_filter_primitive_imagersvg_new_filter_primitive_gaussian_blurrsvg_new_filter_primitive_floodrsvg_new_filter_primitive_displacement_maprsvg_new_filter_primitive_diffuse_lightingrsvg_new_filter_primitive_convolve_matrixrsvg_new_filter_primitive_compositersvg_new_filter_primitive_component_transferrsvg_new_filter_primitive_colour_matrixrsvg_new_filter_primitive_blendrsvg_new_filterrsvg_new_radial_gradientrsvg_new_linear_gradientrsvg_new_patternrsvg_new_stoprsvg_new_markerrsvg_new_imagersvg_new_clip_pathrsvg_new_maskrsvg_new_svgrsvg_new_symbolrsvg_new_polylinersvg_new_polygonrsvg_new_circlersvg_new_ellipsersvg_new_rectrsvg_new_linersvg_new_pathrsvg_new_usersvg_new_defsrsvg_new_switchrsvg_new_groupg_string_newg_malloc0_nstrcmpg_string_append_leng_freeg_string_freersvg_parse_cssbufferrsvg_internal_dpi_yrsvg_internal_dpi_x_GLOBAL_OFFSET_TABLE_  !2tA\Htx8  (08@HP X`px &,28>DJPV\bhn t0zH`x 0@P`p x ,H C`P x~0 0 8! <]cT ` H!4:@\|pv(0!`48$t%H#%x4'hDN'Hh((,vH|Xhpx(p+((8`hp 1x 2`5;4 RXa j(s0|8@HPb 8 @X0Z@dYxV&<PT@aTPpShTSLRTR XQ,,Q,DUQ_myP$NP`LP   % L c {Hd     G   7 QF p cE0 C C, B Bx$ A >l  , ; I X c s       8$ 8 57` J6 `5 y  S( 5P   Z`   % 91 @ J Y h u   /L   -);N-Xnu|*1BR]m&0?azQ@8$2AOv 5Vv)T~'@Yjx'5CP^n}4V@UHTSY Y4 8 @RYYQ        $PYY RO RO  R4NLP XRlM RL RK RJ,0 8RLIdh pRH RG RF  R,EDH PRdD| RC RB R A$( 0RD@\ ` hR|?!! R>"" R=## R$<<$@$ HR\;t%x% R;&& R:'' R9( ( (R<8T)X) `Rt7** R6++ R5, , R 4 4- 8- @R T3 l. p. xR 2 / / R 1 0 0 R 0 1 1 R 4/ L2 P2 XR l. 3 3 R - 4 4 R , 5 5 R + ,6 06 8R L* d7 h7 pR ) 8 8 R ( 9 9 R ( : : R $( 8; <; DR X( l< p< xR ' = = R ' > > R ' ? ? R (N @@ D@ LR `@ xA |A R O B B R & C C R% D$D ,R@$TOlP#"! RPT TSYYII R8Y<YXQdFhF tGxG HH JJ PT| TS@YDYhOlO tRYYQLL $M(M 4N8N DPHP \PT, DX`T|SYYTT (Y,YXV\V dpUtU WW YYYY  R\Z`Z hYYQRR SS XX [[ PhTYYH`L` TRaa RYYdd  R8`<` DRaa RYY$f(f 0L\xg|g BB Rhh ii PT`kdk xjj Q]]  ^^ b b ,e0e YYl p xROO RII RYY  RLdPd XRYY R !! !R!,!tU!|!Y!Y"C"C "$R"8B"<B "TR"o"o "R#0 #H#X#`T#xS# # # ##P#T# #o#o $P$n$n $4"$X!%4 %Y%Y%%&& &L&\&|&&&&& & ' ' '$'4' (xY(|Y(v(v (R(((w(w ()x) x )R)(y),y )4)Pz)Tz )\R)pf)tf )|)))V)))* Y*$Y*0*4 *P*T *`k*dk *t*|q*q *k*k *r*r *k*k *s*s *k*k *t*t *k*k *p*p *k*k +u+ u +k+k +$p+(p +0k+4k +@l+Dl +Lk+Pk +\m+`m +hk+lk +x{+|{ +k+k +,-`-|----T-T-Y-Y. }.$} .,~.0~ .8.< .D.H .T...T./ Y/$Y/8/D/X}/\} /d~/h~ /p/t /|/ ////}/} /~/~ // // /00 00T080L0Y0Y0}0} 0~0~ 00 00 01(Y1,Y181< 1D1Y1Y111 11 22 2 2@2P2\2` 2l2Y2Y22 22 23(k3,k 343L334 Y4$Y4|4 444455\5h5t55T55T5Y5Y6}6 } 6(~6,~ 6468 6@6D 6P6Y6Y6}6} 6~6~ 66 66 77hY7lY7}7} 7~7~ 77 77 78P8Y8Y9}9} 9 ~9$~ 9,90 989< 9H9l}9p} 9x~9|~ 99 99 999:: :: ;; ;<;@ ;x;;;;;;;< <@Y>Y>T}>X} >`~>d~ >l>p >x>| >>}>} >~>~ >> >> >?,?@?T???@@@$@<@t@|@ALAdAYAYA}A} A~A~ AA AA AB<BBYBYBB BB CXC X CXC X C0C4 CLCP C\WC`W CtWCxW CDYDYD,}D0} D8~D<~ DDDH DPDT D`DtDx DXDX DD DWDW E8YE<YEh}El} Et~Ex~ EE EE EF(YF,YFXF\ FdFh FpFF FF FGG8GHTGLT GTGYGYGG GG GH0H8HDHTH`HhHHHYHYHII}I } I(~I,~ I4I8 I@ID IPI`IlI}I} I~I~ II II IIII}J} J~J ~ JJ J J$ J0Jh}Jl} Jt~Jx~ JJ JJ JJkJk JJKK,K<K\KlKKLL LLXYL\YLxLL}L} L~L~ LL LL LLLM}M} M ~M$~ M,M0 M8M< MHM}M} M~M~ MM MM MMMMNNNXYN\YN|NN}N} N~N~ NN NN NNNO}O} O$~O(~ O0O4 O<O@ OLOlOxO}O} O~O~ OO OO OP}P} P ~P~ PP P$P( P4PDPhP|PPPQ R,R4RXR`TYTYUU U,U@VYVYWXW\ WWY YZtTZZYZYZZZ [66@ [ \aa%at-b46b48?ilJilVlMbmDpmZxx p c00  /514 1283748941 0 0 100644 5612 ` ELF+h@@.shstrtab.text.data.rodata1.picdata.bss.rodata.comment.debug_loc.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.picdata.rela.debug_info@A@`w`]\ h`]`]@`]t `]\ @@A@`w`]\ h`]`]@`]t `]\ @RsvgErrorRsvgHandleFlagsRSVG_ERROR_FAILEDfailedRSVG_HANDLE_FLAGS_NONEnone@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03librsvg-enum-types.c /var/tmp/librsvg-2.31.0 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -xc99 -DHAVE_CONFIG_H -I. -I. -I. -DG_LOG_DOMAIN='"librsvg"' -DLIBRSVG_DATADIR='"/usr/local/share"' -I/usr/local/include -D_REENTRANT -D_PTHREADS -D_POSIX_PTHREAD_SEMANTICS -I/usr/local/include/gdk-pixbuf-2.0 -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include/libxml2 -I/usr/local/include/pango-1.0 -I/usr/local/include/freetype2 -I/usr/local/include -I/usr/local/include/cairo -I/usr/local/include/pixman-1 -I/usr/local/include/libpng14 -I/usr/local/include/libcroco-0.6 -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include/libxml2 -DHAVE_LIBCROCO='1' -L/usr/local/lib -I/usr/local/include -c -o librsvg_2_la-librsvg-enum-types.o librsvg-enum-types.cXa;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7J@ /var/tmp/librsvg-2.31.0librsvg-enum-types.c DD%librsvg-enum-types.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodata.L17.L20.L23.L30.L33.L36rsvg_handle_flags_get_typeg_enum_register_staticrsvg_error_get_type_GLOBAL_OFFSET_TABLE_  *`;JO0TY^00ch $0 4 L P X \ dl p |            88 @@ X66@ 0 0` `).6?JV kVb p x  hp`80  /549 1283748944 0 0 100644 33076 ` ELF+|@@.shstrtab.text.rodata1.rodata.bss.data.picdata.comment.debug_loc.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_info@w'G H_@  H_@  H_@  H_@ @w'G H_@  H_@  H_@  H_@ 0A@`@ww'HH( H& H$ H" H  H H H H H H H H G O, < !!@?D@_@@$,4<DLT\dlt|@ww@_A@`www'/_ hP_\ -\@]`\ `]@H<w`@'_`8ˡ4` 4w `] ̡4` 4w `] ̡4` 4w `] ̢ `L@4w `] `] @_  o㽰A@`www'/w_\ \ Hw_ς Ђ`\@Or@w_D`H`'_D 8H _`] `]@ _ x_@ h@?_ _@ v@?w_ _@ h@?g_ _@ v@]w]g@]w_D 8H@__ @ H P X `@ h_D 8H_``] `] ``@`@@_@_D p H_@ H H_@ __\ _@_@_ρ㽀A@`www'/w_\ \ Hw_ `\@Or@w_D`̀H`'_D 8H _`] `]@ _ _@ h@?w_ _@ v@?g`] ?W_ x_@ h@?G_ _@ v@?7_ _@ o@w]g]W]G]7@]w_D 8H@__ @ H P X `@ h_D 8H_``] `] ``@`@@_@_D p H_@ H H_@ __\ T_@_@_ρСA@`www/'_\ \ H_`D`H5@4` 4w `] ??ϡ4` 4w `] ??Ǡ `4w `] ?? H @]]@]w `] ʐ@]]@]㼰A@`www/w_\ w_ 肠`\@Or@w_\ Hw@g@7_D <H _`] `]@ _ p_@ h?_ _@ v?_ _@ h?_ _@ v?_D <H@__D <H_ ?/ H ?'`] ?/`] ?'_ @@_ @@硣NN@N?NN@N?/ NNN'G'' N @N'G'G'?G'?@_GG @w@w_D <H_   NN?   NNH???g_ @@@_E`HB/ N?' N?`] ?`] ?```Ж@s_ N Ν? N` Ν? ?7` ?O?W?__ @`HE`8H_ ?7 ?O_`] `]@ `] NH `] NH@7@@`]  `]  @g@__t`H@_ '7G,0@??o@_G,0o< ?o@_G,0o< 8G  O'__@ @___t`H@_w@ gow@@_@_@ _@_@_@_@__D`8HD`H@_A@`ww'w/w'H:__\ _טo X`\@Os__\ _טo X`\@Os __\ __\ _זo X`\@Or _D  H , < !!h?Dt4A@`www_\`H\``@ 2h H`] H?`h?H`] H?_ p?_     N (@N@@ w_@\ @w@@@^H@@_ 8@@@wPA@`w_ww??_@Z w_`HB"4֐@_ϒ @_@g_@ G'[[`] ȑH?gG'[[`] ȑH?oG'[[`] ?wG'[[`] ? '_\ h!_`HL@N`@g__a\` `g@!@@ X`]Os_`H@__\ h._`H@ߐ`@g_`H@___a\` `Ĭg@!@@ X`]Os_`H_ϐ _@ h@@@@_`HA@`www_Z @w@ \`h\`hD@\`h \`h ` H@\`xh\`ph \`hhDb$ H H'k 'kGkH@__\ HGb,͐_``_@ h@@`@G`@G`@_aGaАa_@ o@@ '_D H?_\ G˥,p,p$Hw@_ ( 0@H%_     ( 0@H_ ( 0@HHD` H , < #a|_DG˦ '_D Oo@`@\`h@`'@?'?' '/o@@\`h@`'@?'?' '/o@_ @o@\`h>D` H@ H@ H``L<  .! H'g`'g_a_`Ggo@!@ X`]@Osw_`h@H@@\`h*H ` `L<  .! H'g `'g_a_`Ggo@!@ X`]@OsB@H@_40A@`www????_Z @ww@_'@_'G'둠?'둠?@_w@_'@_'_h_@ ??'?/?7 '?__O _\ H@בȑ H?ϑȑ H?G$ `?'GGL@, @< whGGG*@w`]_`]@GHj'{_w_wG HG,`@< @w@h_ _,` ,` ,` w`w_ oH8G, < @w@h0_` _- ` L '44 < - ` L '44 < - ` L@ '44 < -`ww_ o_G@w_G, < @wG{$ O'{_\ H_D"$_\ H_@_@\ H@__ǐ @PA@`wwwww_Z @ww_@ P'_@ X', '__\ `@ 2h 'C_D x H _`] `]@ _ 8_@ h?__ H_@ v?W_ X_@ h?O_ h_@ v?G_D x H@_L@4 @w< < < @ @ww_ H\`wt`_D x H___ N JW P JONG@PH__WO@G_D | H9_`?`] ?`] ?`?'`?/`?7 ' Hg_\ -0 <@ '  O_\  @_`] `]@ @___@ @__D | H@_ ' Hg-0@_\ <  '  O__t`H 'HG_L@4w7 'H11-!3?c5?_7-w/` 4 ,`$,`$,`$,` $,` $ 4 L ,`,`,` ,` _ L@%`' O ' O@_@_GCH`] H?7_ h?7GCH`] H?/_ p?/__7@/@_@_@w_\ @\ H@_Z xh@_Z xD 8 H _@@Z x@@A@`ww_@Z  @_Z xh @_Z xD 8 H  ` H\`hh\`ph @H Db$ HDb( Hp_ hh@_`H`PH'G`XH'G @H=`P``] HH'G``XH`] @H @w`PH'G`XH'G @_`_`PH'G`XH'G`]   ss@s@w`@w@_`x@_`Hw`x_w`H  X@wנ` X`\Or_`@_w`ؐ`@ @w2_T_A@`ww_Z _`Hw @@_Z xh @_Z xD 8 H  ` H\`hh\`ph @H Db$ HDb( H_ hh)`\`\ w\`@_w`_ h__``]@@_@@@@@ @H@_`x\`\ w`H\`@@w`x`H] _``@ 2h '@] GÀH`] H?`h?GÀH`] H?`p?_`H@@H _@@Z x`@@_`H"G"$\ ph _`H_`H ` H_`H `w`] @H@_`H@__`\ @`_`\ ` X`\Ot_`@\ _`@@w`_ hh@@@w__\ @\ Hw????_Z @]`H E@@@A@`www??w_\ w`] HH'GߕH`] @H @w瑠H'GߑH'G @@wǪ@_@@w_t @__@ @__瑠H'GߑH'G`]   ss@sw@@_@\ __t`_wװw'' GHs_GM< w߸ Hd_ߡ? @˒@ @!?< @4 /p8408< H  -` -` -` HC-`!? @4 ,$=  < 4 t< -`!?# @4 ,$/p8408< < < 4 t< -`ˤ ,$/p8408< < < 4 t< -`/p8408-` GOGOw'' GHK_GO< wߺ H<_ߡ?`@˒ @'ǀHH(%,ˠL<  .! , @̠L<  .! , @͠L<  .! @4 %`G@O GOstop2103@o?@@@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)ieeefp.h 2.12 04/10/23 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03rsvg-cairo-draw.c /var/tmp/librsvg-2.31.0 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -xc99 -DHAVE_CONFIG_H -I. -I. -I. -DG_LOG_DOMAIN='"librsvg"' -DLIBRSVG_DATADIR='"/usr/local/share"' -I/usr/local/include -D_REENTRANT -D_PTHREADS -D_POSIX_PTHREAD_SEMANTICS -I/usr/local/include/gdk-pixbuf-2.0 -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include/libxml2 -I/usr/local/include/pango-1.0 -I/usr/local/include/freetype2 -I/usr/local/include -I/usr/local/include/cairo -I/usr/local/include/pixman-1 -I/usr/local/include/libpng14 -I/usr/local/include/libcroco-0.6 -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include/libxml2 -DHAVE_LIBCROCO='1' -L/usr/local/lib -I/usr/local/include -c -o librsvg_2_la-rsvg-cairo-draw.o rsvg-cairo-draw.cXa;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7G= /var/tmp/librsvg-2.31.0rsvg-cairo-draw.c DD%rsvg-cairo-draw.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodata_rsvg_cairo_set_shape_antialias_rsvg_cairo_set_text_antialias_rsvg_cairo_set_operatorrsvg_pixmap_destroy.L95_pattern_add_rsvg_color_stops.L_cseg0_set_source_rsvg_linear_gradient.L_cseg1.L_cseg2_set_source_rsvg_radial_gradient_set_source_rsvg_solid_colour_set_source_rsvg_pattern_set_source_rsvg_paint_server_set_rsvg_affine.L_cseg3.L285rsvg_cairo_generate_maskrsvg_cairo_push_early_clipsrsvg_cairo_push_render_stack.L_cseg4.L418rsvg_cairo_pop_render_stack__dtoul__dtoursvg_pixbuf_to_cairomemcpyrsvg_cairo_to_pixbufrsvg_render_freersvg_node_drawrsvg_cairo_render_newrsvg_cairo_get_image_of_nodecairo_clipcairo_rectanglecairo_restorecairo_paint_with_alphag_list_delete_linkg_object_unrefrsvg_filter_renderg_list_removeg_malloc_ngdk_pixbuf_new_from_datag_list_prependrsvg_cairo_clipcairo_savecairo_mask_surfacecairo_identity_matrixrsvg_cairo_add_clipping_rectg_malloc0_ncairo_paintcairo_set_source_surfacecairo_surface_set_user_datacairo_image_surface_create_for_datag_try_malloccairo_scalegdk_pixbuf_get_n_channelsgdk_pixbuf_get_rowstridegdk_pixbuf_get_pixelsgdk_pixbuf_get_heightgdk_pixbuf_get_widthrsvg_cairo_render_imagersvg_cairo_pop_discrete_layercairo_fillcairo_fill_preservecairo_set_fill_rulecairo_stroke_extentscairo_fill_extentscairo_line_tocairo_curve_tocairo_close_pathcairo_set_dashcairo_set_line_joincairo_set_line_capcairo_set_miter_limitrsvg_cairo_push_discrete_layerrsvg_cairo_render_pathcairo_strokecairo_set_line_widthpango_cairo_layout_pathpango_cairo_show_layoutrsvg_bbox_insertcairo_move_torsvg_bbox_initpango_layout_get_extentsrsvg_cairo_render_pango_layoutpango_cairo_context_set_resolutionpango_cairo_update_contextpango_cairo_font_map_get_typeg_type_check_instance_castpango_cairo_font_map_create_contextpango_cairo_font_map_get_defaultrsvg_cairo_create_pango_contextcairo_set_matrixcairo_surface_destroycairo_destroycairo_pattern_set_filtercairo_pattern_create_for_surfacersvg_state_pop_rsvg_node_draw_childrenrsvg_state_push_rsvg_affine_scalersvg_preserve_aspect_ratiocairo_createcairo_get_targetcairo_surface_create_similarsqrtrsvg_current_state_rsvg_affine_multiply_rsvg_affine_identityrsvg_pattern_fix_fallbackcairo_set_source_rgbacairo_set_source_rgbcairo_pattern_create_radialrsvg_radial_gradient_fix_fallbackcairo_pattern_destroycairo_set_sourcecairo_pattern_set_extendcairo_pattern_set_matrixcairo_matrix_invertcairo_matrix_multiplycairo_matrix_init_rsvg_pop_view_box_rsvg_css_normalize_lengthcairo_pattern_create_linear_rsvg_push_view_boxrsvg_linear_gradient_fix_fallbackcairo_pattern_add_color_stop_rgbastrcmpg_freecairo_set_operatorcairo_set_antialias_GLOBAL_OFFSET_TABLE_  '8(Ggx$t @3 xQ \j\!p|'x'  *x%-42PIP0ev. -;F_n~.`d@MYsp.0"6K^l{*8(l0H`q0"=at 9I\w  & ; W y        ! < X l      8Xx(HD $p t |   HL \` pDH TX `t,TX dh |~}||{ zHLy   04 Plx $ ( 4 8 L \ d~ p} | | { z   |      $w D H pv   u t t , 0 < @ H \ t        ,r <s Tq pq opns  m    4lDsPT hl lskrr,j4iHhT|t|~}g{zfe $  dpdb_`a^]8<\r[Z   @D |YXrW YX$VDrUTrR UQ$P0OH\NMYLKxZZJXZIPX`XHHrTGdFrT,Ex|rCBA@?,Z>=< $ 04 <;!:!$9!,e!<X!x!|!r! ! "" " "$ ","@"X"p"""8"<"n#`7#7## ## $Hs$T$X $d$h $p$xk$j$i$&@f&H6&`&d && &5&e&'4' r'8r'Xr'h3'''r'r'r(po(p(( (( ()8)0<)d )h )1)2)n)e)2)0)2*Z***r*r*r+t/++ +.+-+A+C+B+@+<+o,,,H6,`,d ,, ,:,r,3-P-T -d+-t9-|f-X--,---e.0*.r.).(..//  /D/H /T/`8/</n/e/&/k/%/i0 0 0,108f0D$0"2"66@ 34 4("5'5-5658?<8J<8V?Sb@(p@> xK@ X`$`|0  /581 1283748947 0 0 100644 10564 ` ELF+%@@.shstrtab.text.rodata.rodata1.bss.data.picdata.comment.debug_loc.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_info@w_@w A@`ww??  @w`]t``]t``]t``]t` `]t``]t`(`]t`0`]t`8`]t`@<`P<`X`] <`h`] <`p_t``t`Ht`xt`t`w߰@@`A@`ww??www_`] ?`] ???`] ??`] ??_@_@_@_@ ʕH?w? ʕH?o? ʁJH@?g_<  ʕH?_? ʕH?W? ʁJH@?O_<  ʕH?G? ʕH??? ʁJH@?7_<  ʕH?/? ʕH?'? ʁJH@?=`pA@`w/ww_@Gπ HGӀ HH  @_@G'++G'++OG?7Js_?O7G@ȦwhHkw`O\Bp=|B<B     DD@E[[;  : $ 04 @D PT \` hl t*x* ++ ZZ 89   ** ++ Y Y 8 (9 0 4 < @ H L X7 h9 p t |    6 9       6 9     ( , 4* 8* D+ H+ T* X* h8 x9       * * + + * * 8 9  ! ! " " 7 (9 0# 4# <$ @$ H% L% X7 h9 p& t& |' ' ( ( 7 9 5 [ [ - - 4 4 2 $, (, 4, 8, p[ t[ , , - - 4 4 1 , , , , L DJ P. \J hK 8 66@   H(XH16?JV+Pb{px h .)?0?0  /697 1283748959 0 0 100644 12620 ` ELF+-@@.shstrtab.text.rodata1.rodata.bss.data.picdata.comment.debug_loc.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_infoA@`wwww_w_D '_D H*'_D `H_D H_ 'H`] @H@'G_$`_ _D 'H`] @H@'G_H $`_D `H_D H_ 'H`] @H@'G_$`_ _D 'H`] @H@'G_% _D _E`HE E`H@_D'_D`'?D'_D '?ρ ̕LH??D`'H`] @H@'G_$`_D 'H`] @H@'G_$`H_D H_E H_D`'D'?D`'E '?`] HH?`] HH?ǁ̑LJ??_D 'H`] @H@'G_$`_D 'H`] @H@'G_H0$`_D ?H_$`_D ?H_$`H `]`]`] m@H_D O, < #b(_D_D H8_F _E%@< @''F HG'F 'G'ȑ HH'G%G'E'G'ȑ HH'G& DlA@`wwwwww@h @_ג`]@@ H)w`]_@_@___@H@Hw_@H@H w@w@_w_ϰA@`wwwww@h @_ߒ`]@@ H)`]_@_@@_\``_@@H@@H_@@H@@H@@w@@_ǰ@www@__Z _@@wπ@h __`_@_@ H@@ @w߰0ww__?@?wСA@`ww??w_@h`]`]`]`] @ H6?`] H?`] HH`]`]`]`] @ H '?? 'ϒ_l@@СA@`ww??''w_@h`]`]`]`] @!#H:?`] H?`] HH`]`]`]`] @!$H '??G'G'à 'ǒ_ @w''w 'G'G'Ӡ '__w߰w''w 'G'G'Ӡ '__w߰librsvgrsvg-file-util.cError creating SVG readerfile %s: line %d: assertion `%s' failedfile_name != NULLx_zoom > 0.0 && y_zoom > 0.0_rsvg_size_callback?@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03rsvg-file-util.c /var/tmp/librsvg-2.31.0 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -xc99 -DHAVE_CONFIG_H -I. -I. -I. -DG_LOG_DOMAIN='"librsvg"' -DLIBRSVG_DATADIR='"/usr/local/share"' -I/usr/local/include -D_REENTRANT -D_PTHREADS -D_POSIX_PTHREAD_SEMANTICS -I/usr/local/include/gdk-pixbuf-2.0 -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include/libxml2 -I/usr/local/include/pango-1.0 -I/usr/local/include/freetype2 -I/usr/local/include -I/usr/local/include/cairo -I/usr/local/include/pixman-1 -I/usr/local/include/libpng14 -I/usr/local/include/libcroco-0.6 -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include/libxml2 -DHAVE_LIBCROCO='1' -L/usr/local/lib -I/usr/local/include -c -o librsvg_2_la-rsvg-file-util.o rsvg-file-util.cXa;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7F< /var/tmp/librsvg-2.31.0rsvg-file-util.c DD%rsvg-file-util.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodata.L59.L60.L14.L_cseg0.L_cseg1.L78rsvg_pixbuf_from_stdio_file_with_size_datarsvg_pixbuf_from_file_with_size_data.L122.L123.L131rsvg_pixbuf_from_file_at_max_sizersvg_pixbuf_from_file_at_zoom_with_maxg_logrsvg_pixbuf_from_file_at_zoomrsvg_pixbuf_from_file_at_sizersvg_pixbuf_from_fileg_string_freeg_byte_array_free_rsvg_acquire_xlink_href_resourceg_string_newrsvg_handle_get_pixbufrsvg_handle_closeg_object_unrefrsvg_handle_writersvg_handle_set_base_urirsvg_handle_set_size_callbackrsvg_error_quarkg_set_errorrsvg_handle_newrsvg_pixbuf_from_data_with_size_datag_assertion_messagefloor_rsvg_size_callback_GLOBAL_OFFSET_TABLE_  &7(FKPU^ g l@(h Pd Hp X; dY @o}!?P\l`  *$*  (  (l p |(  (  (  (       (X \ h(     'h*l*%#  $)) "! 0DT`**%#  $) ) "(!@ Th| ( @  * *     (  , 4 8 D \  `          P* T*           $ ( 0 4 <  @ H L X66@  8("`'`-`6`?WJWVRbCpYx0 !8 ,0  /728 1283748962 0 0 100644 7184 ` ELF+@@.shstrtab.text.rodata1.bss.data.rodata.picdata.comment.debug_loc.debug_info.debug_line.debug_abbrev.strtab.symtab.rela.text.rela.debug_info0ww'_\\`hH?\_G\@@w߀`hH?<`?`0w_\ \`hH@_\`\`@_@\ _\ h@_ @@ ?''< < A@`www'w@_@@H`]`]`]`] @ SHT_@h @@@HH`]`]`]`] @ TH5_߀h`]`]`]`] @ UH  @@_u_h@Hww_u_u`]`]G@@librsvgfile %s: line %d: assertion `%s' failedrsvg-xml.cG_IS_INPUT_STREAM (stream)cancellable == NULL || G_IS_CANCELLABLE (cancellable)error != NULL@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)float.h 1.22 04/09/28 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)unistd.h 1.76 06/03/10 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03|rsvg-xml.c /var/tmp/librsvg-2.31.0 /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -xc99 -DHAVE_CONFIG_H -I. -I. -I. -DG_LOG_DOMAIN='"librsvg"' -DLIBRSVG_DATADIR='"/usr/local/share"' -I/usr/local/include -D_REENTRANT -D_PTHREADS -D_POSIX_PTHREAD_SEMANTICS -I/usr/local/include/gdk-pixbuf-2.0 -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include/libxml2 -I/usr/local/include/pango-1.0 -I/usr/local/include/freetype2 -I/usr/local/include -I/usr/local/include/cairo -I/usr/local/include/pixman-1 -I/usr/local/include/libpng14 -I/usr/local/include/libcroco-0.6 -I/usr/local/include/glib-2.0 -I/usr/local/lib/glib-2.0/include -I/usr/local/include/libxml2 -DHAVE_LIBCROCO='1' -L/usr/local/lib -I/usr/local/include -c -o librsvg_2_la-rsvg-xml.o rsvg-xml.cXa;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7@6 /var/tmp/librsvg-2.31.0rsvg-xml.c DD%rsvg-xml.cBbss.bssDdata.dataDpicdata.picdataDrodata.rodatacontext_readcontext_close.L52.L53.L54.L55.L64.L71xmlParserInputBufferCreateIOg_object_refg_slice_allocg_cancellable_get_typeg_logg_input_stream_get_typeg_type_check_instance_is_a_rsvg_xml_input_buffer_new_from_streamg_slice_free1g_object_unrefg_input_stream_closeg_input_stream_read_GLOBAL_OFFSET_TABLE_   1@tM[`(e0j@ o`8tyh(6EZnX pt        , 0 8 < D H PT `         $ 066@ H(%-6V? $J $VLbpx PP0 07070100039c7e000081ed0000000000000000000000014c8474860006fb480000010000010036ffffffffffffffff0000002700000000root/usr/local/lib/librsvg-2.so.2.31.0ELF+@@8@ttttQRKH !"#$&)+,./014789:>ABCEGHIKMNPQRSTXYZ\]^`acefghilmoqrstuxyz|     !#$%')-./03459:;>?CEF  %'(*-2356;<=?@DFJLOUVW[_bdjknpvw{}~ "&(*+,12678<=@ABDG) -=P 7@Xn 0";U\k| 6@ 8p%@Ym   ,G` -Pp , $Kb {  .>I ]s3AU_Nr} < 8l3B X`uy! $6A\ǜan ,   $ A ^ r ~           ; A N g }    d     4 ( = I X P m H@ ~      @L     + 3 P \ j , {           7 J s        (6I[n{Ƙ+ y`EJit&<Q`q :d ,@ !4EWo `t :8d+9P^cw x   (9P^j xx @ !<Lc $ Hp -?c|  +p".DNhqt +<J`r  x`4KkxmlNewIOInputStreamg_file_get_contents_rsvg_size_callbackcairo_fill_extentsrsvg_pixbuf_from_file_at_zoompango_context_get_font_descriptionxmlFreeNodeg_input_stream_closersvg_termg_ptr_array_newpango_attr_underline_newpango_layout_get_sizegdk_pixbuf_get_pixelsg_convertmemcpypango_layout_get_extentscr_doc_handler_newg_string_freecairo_set_dashcairo_get_targetrsvg_pixbuf_from_fileg_value_set_doublegdk_pixbuf_error_quarkg_string_erase_DYNAMICxmlFreestrcmpstrtok_rrsvg_pixbuf_from_file_at_zoom_with_maxbsearchg_strrstrg_type_check_instance_castcairo_pattern_set_matrixg_filename_from_uricr_simple_sel_to_stringrsvg_handle_flags_get_typecairo_move_togdk_pixbuf_get_has_alpharsvg_handle_set_dpi_x_yfabsg_byte_array_freecairo_pattern_create_for_surfacecairo_set_source_rgbcairo_image_surface_creategdk_pixbuf_get_rowstridersvg_handle_newg_cancellable_get_typeg_type_initpango_font_description_set_stretchcairo_surface_set_user_data__dtoug_value_get_stringpango_font_description_set_size__dtoulxmlFreeDocg_object_newrsvg_handle_get_dimensions_subcr_parser_new_from_bufrsvg_handle_set_base_urigdk_pixbuf_loader_newg_memory_input_stream_newcairo_pattern_set_filtercr_term_to_stringpango_attr_letter_spacing_newcairo_matrix_multiplyg_logfmodrsvg_handle_get_base_urig_strdup_printfcairo_saversvg_handle_has_subpango_attr_list_unrefxmlCreatePushParserCtxtsetlocalepango_font_description_freeg_list_prependg_utf8_validateg_quark_from_stringgdk_pixbuf_get_n_channelspango_layout_set_textg_memory_input_stream_add_datacairo_restorecairo_matrix_invertg_strchugcairo_set_line_capg_malloc_ncairo_set_fill_ruleg_value_set_intcairo_curve_tocr_parser_set_use_core_grammarpango_attr_strikethrough_newrsvg_handle_render_cairog_ptr_array_freersvg_handle_get_position_subgdk_pixbuf_newrsvg_handle_set_size_callbackg_hash_table_insertacos__align_cpy_8g_strnduppango_font_description_set_stylexmlFreeParserCtxtxmlCharStrndupg_slist_prependg_ascii_strtodg_list_delete_linkpango_font_description_copyrsvg_set_default_dpig_str_hashcr_string_peek_raw_str_len_endcairo_strokecairo_set_line_joinsqrtg_assertion_message_exprg_byte_array_sized_newpowsingdk_pixbuf_loader_closersvg_handle_set_dpig_ascii_dtostrg_byte_array_newg_hash_table_unrefatan2g_file_resolve_relative_pathgdk_pixbuf_loader_get_pixbufg_byte_array_appendcairo_scaleg_strfreevxmlCtxtGetLastErrorg_assertion_messageg_strchomprsvg_handle_get_pixbuf_subg_build_filenamegdk_pixbuf_get_widthxmlParseChunkxmlBuildRelativeURIg_type_module_register_typefloorg_string_newcairo_pattern_set_extendpango_layout_get_iterg_try_malloc0g_param_spec_stringcairo_identity_matrixrsvg_handle_read_stream_synccairo_surface_destroypango_cairo_show_layoutcairo_get_matrixrsvg_handle_get_pixbufg_converter_get_typeg_list_lastg_slist_removersvg_css_parse_colorrsvg_error_quarkpango_cairo_update_contextcairo_set_sourceg_file_readg_slist_findcairo_fill_preserversvg_handle_set_base_gfilecairo_cliprsvg_handle_get_metadatacairo_set_line_widthrsvg_pixbuf_from_data_with_size_datag_file_testg_slice_free1rsvg_handle_freexmlPushInputrsvg_cairo_to_pixbufcairo_pattern_add_color_stop_rgbapango_attr_list_insertg_hash_table_destroyg_ptr_array_add_rsvg_acquire_xlink_href_resourcecr_parser_set_sac_handlercairo_mask_surfacepango_font_description_set_family_staticcairo_surface_create_similarg_get_current_dircr_selector_refcairo_pattern_destroycairo_set_antialiasg_base64_decode_steprsvg_defs_lookuppango_layout_newg_file_load_contentsg_clear_errorg_value_get_doubleg_propagate_errorg_file_new_for_urig_object_refcairo_set_miter_limitgdk_pixbuf_loader_writepango_context_set_base_dirxmlCleanupParserg_memdup_edatag_string_assigng_object_unrefg_type_namepango_language_from_stringrsvg_handle_new_from_fileceilpango_layout_iter_get_baselinepango_font_description_set_variantpango_layout_set_alignmentxmlParserInputBufferCreateIOcairo_image_surface_create_for_datag_slist_freeg_value_set_stringstrleng_type_register_staticg_byte_array_set_sizecairo_stroke_extentsg_slist_appendg_string_new_leng_input_stream_readg_hash_table_sizersvg_pixbuf_from_file_at_max_sizexmlInitParserrsvg_handle_get_typeg_hash_table_foreachcairo_set_operatorrsvg_handle_render_cairo_subg_ascii_strcasecmpg_param_spec_intcairo_matrix_initg_input_stream_get_typeg_type_class_peek_parentrsvg_error_get_type_GLOBAL_OFFSET_TABLE_rsvg_pixbuf_from_file_at_sizecairo_creategdk_pixbuf_copy_areapango_layout_set_font_descriptiong_string_append_printfg_list_removepango_layout_iter_freecairo_line_toatofg_hash_table_lookuprsvg_handle_new_from_gfile_syncg_zlib_decompressor_newrsvg_handle_get_titlersvg_set_default_dpi_x_yatoitang_hash_table_newg_string_sized_newg_converter_input_stream_newg_hash_table_refg_enum_register_staticcairo_destroycairo_paintcairo_pattern_create_radialpango_cairo_layout_pathg_file_get_urig_path_is_absolutersvg_handle_new_from_datacairo_fill___errnorsvg_handle_get_dimensionsstrstrg_strdupstrncmppango_context_set_languagecr_parser_parsecairo_paint_with_alphapango_cairo_font_map_get_typeg_filename_to_uricairo_rectanglersvg_initg_ascii_tableg_ascii_strncasecmprsvg_handle_writeg_path_get_dirnamememsetxmlParseDocumentpango_cairo_font_map_get_defaultcr_selector_unrefpango_cairo_font_map_create_contextgdk_pixbuf_new_from_dataxmlFreeInputStreamg_set_errorg_type_check_instance_is_acairo_pattern_create_linearg_strsplitxmlNewEntitypango_cairo_context_set_resolution_rsvg_register_typesg_malloc0_ng_hash_table_new_fullg_realloc_PROCEDURE_LINKAGE_TABLE_g_getenvcairo_matrix_transform_pointcairo_set_source_surfacesscanfg_string_append_leng_type_check_class_castcairo_set_source_rgba_etextg_strv_lengthpango_attr_list_newrsvg_handle_closecairo_set_matrixg_slice_allocgdk_pixbuf_get_heightg_string_append_ccr_parser_destroyg_str_equalg_file_get_typepango_layout_set_attributesg_try_mallocrsvg_handle_get_descg_string_appendg_slist_delete_linkcairo_close_pathrsvg_handle_new_from_stream_synccr_string_peek_raw_strg_object_class_install_propertyg_param_spec_doublepango_font_description_set_weightlibrsvg-2.so.2libm.so.2SUNW_1.1libc.so.1SUNW_0.7libgdk_pixbuf-2.0.so.0libmlib.so.2libgio-2.0.so.0libpangoft2-1.0.so.0libpangocairo-1.0.so.0libpango-1.0.so.0libgobject-2.0.so.0libgmodule-2.0.so.0libgthread-2.0.so.0libpthread.so.1libthread.so.1librt.so.1libcairo.so.2libpng14.so.14libfontconfig.so.1libfreetype.so.6libcroco-0.6.so.3libglib-2.0.so.0libintl.so.8libxml2.so.2/usr/local/lib =' =(Kt>t>t>t>t>tHuHuH8uHPuH`u Hpu(Hu0>u8Hu@HuHHuPHuXHu`HuhHupHuxHuHuHuHuIuIuIuI uI(uI0u>u>u>u>u>u>u?v?v?v?v? v ?(v(?0v0?8v8v@I@vHIHvPI`vXv`IhvhIpvp?@vx?Hv?Pv?XvIxv?`vIvIvIvIvIvIvIvIvIvIvIvIwIwIwIwJw Jw(Jw0J(w8J8w@JHwHJXwPJhwXJxw`JwhJwpJwxJwJwJwJwJwJwKwKwK wK0wK@wKHwKPwKXwK`w?hwKhxS8xS@x@hxSPx @x(@x0Shx8Spx@@xH#hxP#xXSx`SxhSxpSxxSxSxSxTxTxT x%PxT(xT0xT@xTXx@xT`xThxTxxTxTyTyTyTyTy /y(@y0@y8Ty@TyHTyPTyXTy`TyhUypUyxUyUyU(yU@yUHyUXyUhy2yUyUyUyUyUyUyUy9yUzUzUzUzUz Uz(Uz0Vz8Vz@V(zHAzPV@zX@z`@zh@zpAzxAzAzAzA zA(zA0zA8zA@zAHzAPzVHzVXzAXzVhzAszAzA{A{A{A{{ V{(V{0B{8V{@V{HV{PV{XV{`V{hV{pV{xV{W{W{W {W0{WH{WP{WX{W`{Wh{{Wp{Wx{B{B {B({B0|x||W|W| W|(W|0W|8W|@W|HW|P@|X(|`|hW|pW|xW|W|W|W|X|X|X |X0|X@|h|B8|B@|Ӡ|Ր|XH||}P}XX}X`}ݨ} Xh}(Xp}0}8x}@}H0}P}X }`}h}pX}xX}X}X}X}X}X}BH} }Bx}B}B}B}B}B}B}B}B~B~B~B~B~ h~(~0~8 ~@0~HX~PX~XP~` ~hX~pY~xY~Y~Y ~Y(~Y8~Y@~YP~Y`~Yp~ ~~~x~Yx~Y~Y~YhY Y(Y0Y8Y@YHYPYX`&h)pYx)-B2PYZZ 2BBBCCC DxHZ(Z8ZHZPZ` Zh(I(0R8U@ZxHUPCXD`FphZpZxZZZZZZn[[[(t ~[8[H[X@@8[h p(0[8[@[H[P[X[`[h[p[x[[[\\ \(\0FxFFF\8\H\X\p\\\\\ \(\0P8\@\H\P\X\`(h(px\]]]]] ](]8]@]H]PH]X]`]h]p]x ](0]8]@]H]P]X]`]h]pHx]]]FFF]]]]ΰ^F^؀@^^0 h(^H0^P8^X@(H^`PFX^x` h8pFxF^^^^^^^^^^^p8P^^_ _(_0F88@HPPX_ `_(h_0p_@x_P_X_p_x__________``` `0`8`P`X ``(`h0`p8`x@`H`P`X```h`p`x````aaa(a0a8aHaPa`apaxaaaaaaa a(a0a8a@bHbPb(Xb8`bHhbPpbXxbxbbbbbbbbccc c0c@cHcXc`cpccc c(c0c8c@cHcPcXc`chdpdxd d0dHd`dpdxddddddFdeeee eHeX@( @(A0eh8C@eHCPEXe`ehepexeeeO efffff f(f0f@fHfPfXf`fhfp_@fx f(f0e8F@FHfPk Xf`ohGpGxGGxXffffffg~@~~k(kk k( k0(k80k@8kH@kPHkXPk`Xkh`kphkpkxkkkkkkkkkkllll0l@lXlpllll l(l0l8l@lHmPmXm`m hm(pm0xm@mPm`mpmmmmpxm X(m`m (m0m8H@mHmPX`hmpnx nnn n(n8n@ƘnH@PnXnh nx(n0n8@nHnPnXn`nhopoxo o8opoxoGooG0G8G@GHGPGXoG`oGhGzoo p0(pP0ph8p@HPpX` hppPxqGGGGǘGq xGq(q0qXqpGP (q0q8q@qHP!XX!`qhqprxr #Hr0%rHrPrhrprrrrrrrrrrrss s (s80sH8sX@GHGPXsp`shspGxGGssst;8;t t(tPt`tt8 X P(08P@HPxXp;hn`Hgg@gpggh h`hh h(i(0iX8i@iHiPjXjH`jxhjpjxjKxKKKKK K0K@KPK`KpKLLL L0L@LHLXLhLpLx L0L@LPL`LpLLLMMM(M0M@MPM`Mp M0M@MPM`MpMMMMNNNN(N8N@NP NX0N`@NpPNx`NpNNNNNNNNNOO O(0O@@OPPO``OppOOOOOOOOOPP P0P @P8PPH`PXpPh€PxP P°PPPPPQQ Q0Q @Q(PQ8`Q@pQPÀQXÐQhàQxðQQQQQQQ Q0Q@QPR`RpR ĀR(ĐR8ĠRHİRXR`RhRpRRR R0R@RPR`RpRŀRŐRŠSŰSSS S(pp(p0qh'ƈxcpt W@B`)dj  @`w . 3@ `iE'( @`.;5b) @`#^A @v`" @`| @` <y  @`8Du @`` C-&6 @`- @(`V @~`e@{9 @`};3T @#`Do?: :@[`7M @/`l @f`G15 K@4`@ \=H P@` + J@`Ig7 @h`$!< N@`9,FR @'`=Q  @`/ @C`0 @`"AS! @`+1*> 6@`%% @`rUs B@Z`X O@`>2L k@`,  @`4 @`Y?0 F@E`8a @`0A@cwww`] _ H`Hȕ? J_< `ȑ J ; ȑ J :  J ;` ` H( H< ` H`H< (ww''G뀢H_ H?_ ?_: G뀢H_ H?_ ?_: G瀢H_ H?_ ?_: G瀢H_ H?_ ?_: G뀢H_ H?_ ?_: G瀢H_ (H?_ (?_: (www__ H  HH?  H  `HH?א  H`HH?  H``HH?ǐ   H(`HH H?  H``HH (H?_: : : : : : (@A@cĮww`] _:``] :``] :``] :``] :` `] :`(0A@cww??_:``] :``] :`:``] :` `] :`( A@bTww?`] H` ] @1?`] H` ] @+?_<`<`<`<``] <` `] <`(0A@aTww?`] H` ] @?`] _<``] <`<``] <``] <` `] <`(0A@`dww??`] _:``] :``] :``] :`:` :`(@w_  H  H@贈@@?HH0A@cDww_@ `(] H _@ `(] H_@| `(] H_@r `(] HH  '< < 0A@bDwww_ _ @L`(] HE_ _ @?`(] H8_ _ @2`(] H+_ _ @%`(] H_ _ @`(] H_ (_ (@ `(] HH  '< < @  @"   $`?" D` 8@@t w A@`$ww_@h`0]`8]`@]`H] @И :H/ D` H `_?`,p,p$D O`HH  @" " ?" ?` 8@v^_?`,p,p@$@A@bܮww_h`0]`8]`@]`P] @~ N@\ @_A@b4ww??_h`0]`8]`@]`P] @R Z] wE `H_ߪ$`=`,p,p$D` H <`(<`0% _ wD'Gˠ $ D`H , '$`] <,p,p@9$_t _]`wߨ _ߣ? ,p,p$$ < (< 0%`A@`ww??_h`0]`8]`@]`P] @ zE  H`0]`8]`@]`X] @Ә { wD $ D`H , '$`] <,p,p@Ւ$_t _\  =,p,p$@$ < (< 0A@c ww??????_h`0]`8]`@]`P] @턘 E  H`0]`8]`@]`X] @o  wD`$' D`@H , '$`] <,p,p@q$_t _\ w _G,p,p$$ < < < < < (< 0 w'_ wD $ D`H , '$`] <,p,p@6$_t _\ G,p,p$>,p,p$ 8`]Ot0A@`|ww_@h`0]`8]`@]`P] @ D`H`0]`8]`@]`X] @ј D` H`0]`8]`@]``] @켘 @_]``E $ < ,p,p$'E $ %` A@bww_h`0]`8]`@]`P] @솘  wD $ D`H , '$`] <,p,p@숒$_t  _\ >,p,p$$A@aww '`h] ??`h] ??_@-wh@HHǀ`H@AH???? '@3ǐ@@> (A@`Ԯwwwwwww`h] ?w_$ _$ _$ _$ _@!@?a] ȁHH a] HH@B "H`h] HN?_@hHL`HD`p]@@ H<_`x]@H a] ? _H($`_`]@H _H$`_`]@H a] ? _H$`_`]@H a] ? _H$`_`]@H a ] ? _H$`_`]@H _H$`_`]@H _H$`_`]@H  _$`a(] HH?`h] ?_`]@vH  _$``h] H?_`]@dH  _$``h] H?_`]@RH a0] Hd?_`]@BH a8] HT?_`]@2H a@] HD?_`]@"H`h] H5?_`]@Ha@] H&?_`]@Ha8] H?_`]@Ha0] H?`h] H?aH] @aP] Ha] ? _$`?ǁw 'ˠ 'Ϡ 'Ӡ 'נ '_ϔۖט_?GۀH pH&/G׀H mH/GӀH xH/GπH iH/Gˀ`H lH /瀤`H sH/ /w  \  A@adwwwH@_w߀@h _@?_! @H!?H_!_@# vH?_L! pH mOOO xOOaP] ?A@`\www/_M `H Hu?߀`pH$OhH _ XHHh?߀vH _ `HH_?߀oH  ?_ X@  `I@HR?HK`mH`xH@>__@?_L` mH` JH;?` Ja8] H2?߀`iH$OhH _ 0HH%?߀vH _ 8HH?߀oH  ?_ 0@ 8I@H?H`lH`sH`h] ?߁ A@b$ww???_J`HH,?׀`pH瑢HH$?׀`mHߑHH?׀`xH ߕHa8] H?׀`iHHH?`h] ?ׁ0A@a w?aX] HH `h] HH a`] HaX] ah] @JH@'G?`@'G`HH `HH @?` ww_w_w@ \ '< < A@ctwww _@h $`_M #HI 'M H4_GL@ 0H 9H$ 0H'_GL@ AH FH$ 7H'_GL@ aH fH$ WH'H.G߶@G '_<`LOG〤 H , , .Hax]@趐hl '۠ 'ߠ '_`]@h: _74L@ (H 7 _74L@ (O7 _74@@Ӣ@@hӀ H\`@O']@I']@C'@vH_a]@tۀ H G'G'GH'۠ '۠ 'ߠ 'G, Gߡ, @GH*@_a]@#H _h$ H_a]ap]  @Fw߀@h _h$ H `'4  A@߂ctww_@ܒ畠@?_瀤h L %Ha(] H?a`] Hah] @聢H@7@4  A@߂bww_@稒ߕ@?a] ȁHH a] HH@B "H`h] H3?_߀@h-a]@璐@Ha] Ha] H?_a]@|Ha] Ha] H?? A@߂aww_@Fߕ@?a] ȁHH a] HH@;B "H`h] H?_߀@ha]@0@H a] HH?? A@߂`ww_@ߕ@?a] ȁHH a] HH@B "H`h] H?_߀@ha]@@H a] HH??0A@ނbwww_@h $`_@h'a]@潐@HH# _a]@HH _a]@H _h$ H _h$  >0A@ނaԮwww_@h $`_@ha]@w@HH _a]@lH _h$ H _h$  ? 0A@ނ`www_@h $`_@ha]@;@HH!,_b]@0HH"_b]@%HH{# _b]@HHp d_b]@HHe _b ]@HHZ!,_b(]@HHO!_b0]@HHD!_b8]@HH9"X_b@]@HH."_bH]@HH## _bP]@HH#_a]@H _h$ H!_h$ !? 0A@݂bwww_@h $`_@h|bX]@凐@HHx _b`]@|HHm _bh]@qH _bp]@hHHY _bx]@]HHN _b]@RHHC _b]@GH _b]@>HH/ _b]@3HH$ _b]@(HH _a]@H _h_$ H _h$  ? 0A@܂cwww_@h $`_@hHa]@@H _h$ H_@A@܂bwww w@_wb]@ߢ@@h6b]@䷐@ H @@7@ b]@hb]@䝐 H @@7@ b]@ܐo@^__@h7@$`h"7@ 4 @7w7@4@,0r$`wh_]_7@4@,0u$`]w_o@佐_w ww_h$ _qӶhӀHH'4 @ 7@ӀH7@4,0^@7@4,0?7@ 7@Ӏ O@C_@h$`@ A@ۂcĮwwww_@_< _߀h(L `H$a]\ ,p84084,0!H@H_ߢ wa]\ L`,p84084,0!H@O_߀@h L`H @@㷒_< _ _<  A@ۂblww _גh〤H 7@〤H7@4,0_b]@HH 7@4,0_b]@HHs 7@4,0_b]@vHHe 7@4,0_b]@hHHW 7@4,0_b]@ZHHI 7@4,0_b]@LHH; 7@4,0_b]@>HH- @7@4,0_b]@0HH 7@4,0_b]@"HH!7@4,0_c]@H!<7@ 7@〤 On@->0A@ڂcwww_@h $`_c]@H _c]@HH _c]@H _c ]@HH _h$  ? A@ڂblwww'wߪ   '_ wH`HG뀢@H __ߑ:`*0r  *  _ Hw`HG뀢@H __ߑ:`*0r  *  _ H w`HG뀢@H __ߑ:`*0r  *  _ Hw`HG뀢@H __ߑ:`*0r  *  H`HG뀢@H _ _ߑ:`*0r   H'Gπ H G뀢@H__ߑ:`*0r H`HG뀢@H _ _ߑ:`*0r   H'Gπ H G뀢@H__ߑ:`*0r HG뀢@H _ߑ:`*0* H@`HH. `H+G뀢@H&_ߑ:`*0J`H_Z`hJ HJ H : c(]J@Gπ@H _ߑ=*0@* HU@`HH `H G뀢@H _ߑ:`*0* H?`H'۱; H5H3_J c(]J@H" O* : !X_ǐ?Ԑ B HHOOOOOOOO_ Ow; DHD( A@ق`ww_H_ HAw_ H=w_ H9w_ H5w_"@: '; _J c(]J@HH" O* : !P?B OO" O* : !h?B O; $4DTTTTdTA@؂clww wc0]@N_w?  @__)@H@ૐ@?  @__@. <  @2wǶ H.  >,0@_@_ǡ.< ,0t \ _ϡ>,0W_@: ->,0@@\ _ǡ. < ,0t \ >,0@\`\`$-O@g@@e__w0A@؂aw  (@4a]a]a]@w`a]a]a]a]@w`@@t t t w@ww__r ww__@\ __\ @௔h&@@@w@ಐ@@_]@@ೖH@@൒H _\ @N_@@ಔ@@ි @Ր@ ' <  www_\ @_h__HH_\ @_@h \ \ \ @_HA@ׂbwww_c8]@|w߀hH_h_\ @e`Hc8]@@m _Z Z @@߼@@0www_@h L` H__@@_@#_0www_\ @߬__@@@ww_\ @'_@w_@\  7_\  H_\ \ 74,0\@Z 7 7_\   O_\ @ _@\ @_0www  @_r @K_w _\ @V_t @w_\ h_Z \ @_ _ t @޺_ @޸_\ @Ԑ@_ t \ oA@ւb̮www 'ˠ '_h cH]c@]@_H'L H_L``w@,HL`O@ߟ_wף20,p@@ߡ< __Z ˘@ߡ@wϓ: @ߥ ww_@ߜ H@ߟ_H@޺_H$_h@ߘh @ߙ@6@HHH@ߖ_@ߙ@&A@ւ`wwwww_@h cX]cP]@ _H$_@@@hHǔ_@m@H@H@l__@o< @_@@@A@Ղcwwww _h c`]cP]@_H:@Nǖ_@OH_h@M_@S@9_w@V_@K_ǖ_@4@AH @w__@< @ݍ_HH_װ@ A@Ղb4wwww_@hL`HH!ch]@ @H_@h__;@h__w@@A@ՂaDwwww__@_h=@wǺ]``@_'Ð@@ GÀH @@@Ő@H(_@@H@޻@H@@wǀh@ް@@_cp]_@@ H @@ޠ@H_ǬA@Ԃcw'??www_w H_ ?_`? H` HȒ -H   "H @H H?? `H  `H `@HH$ `H  `H `H_`_ cx] ȑH :`_`_ ȑ:` `H  `H `HH$ `H  `H ` H_`_ cx] ȑH :`_`_ ȑ:`_: _: @w_@|#_`@A_`w`_`h@@p_ww'_@D`8\`hN`@_ h?ǐP_ v?`_ h?p_  v?_]@G@_@{_B H5@!<@H_@!5@@' ?@' Ǡ@]s_@@_A@ӂctwwwwww_@_瀢H_c]@@@h@<t\u \u  @] t`] t`_c]@@@h@<t\u \u  P] t`] t`_c]@@@h@<t\u \u  `] t`] t`_c]@v@@h@<t\u \u  p] t`] t`_c]@[h _c]@Qh@C_ t \ h_c]@;hw_c]@/@@h w_\ \ @є_c]@h|' 8__ c]__@_A@ӂ`w  @@o-_`hc]c]`]c]@!hw` '`8`]6<t\u \u @`pw] t] t``w\u \u `Pw] t] t`@\t`\t`c]u` c]u`(c]u`0w@@0'  @t "  "   @k@ t\$`\$ w@  @Q "  "   @H@t` \`$`w0w  @.w $` $`_t`w@@0w  @w $`$`_t`w@@0w  @ "  " @ __t wA@҂`wwww'_@h $`_`]@ HHi@`U_wπh:_@@_Ϡ@hHV\ \ `]@Ht@HH_`\ ` ]@H@H:_`\ `(]@H@H,H*_`0]@H _h$  H_`8]@ٮHH _@ۓ_'@w_@hB` "`@w_@hD`$ ' H $`D` H@F\`@D_㼐A@тa$wGwww``] ?ߠ '_@K_瀢Hq_`@]@.wπ@h<O@<t_\u \u o] t`] t`@te_`h] ``] @@@?``] H``] H?`h] H`h] ?=`8_`H]@wπ@h__\ @@_`P]@wπ@h `8]@@H '__\ @O__\ \ 0_t`@t"@m_GۀHg', G4 @%`@@x}0A@Ђbw  H@p@l`X]@t`0``] <`8$`@w@@A@Ђawwww_@_瀢H6_`p]@g@@h_\ \ _ @_`x]@V@@h@<t\u \u `x] t`] t``%`,$`_`]@4@@h@<t\u \u `] t`] t``%`,$`_`]@@@h@f<t\u \u `] t`] t``%`,$`_`]@@@h@E<t\u \u `] t`] t``%`,$`_`]@@@h'`]@ߐ@HH'`p`]@ՐH H '`p`]@ʐH '`p`%`,$`_`]@@@h__\ \ @؞@h_\ \ `_`]@@@h `@@@`%`,$`_`]@sh@s'`_`]@d@@h`]@r@HH '`8`]@hH '`8`%`,$`__\ `]_@A@ς`w  @@kZ0`@'``]u<t\u \u `w] t] t`w\u \u `x] t`] t``]W<t\u \u @] t`] t`tȠ $8$p`]t0!,@ $!,@ $!,@ $!,@ $!,@ $!,@ $!<,@ $wA@΂b̮wwww_@_瀢Ho_`p]@@@h_\ \ _B@_a]@@@h%@<t\u \u @x] u`] u`%`,$``4  H]`t`]`t`_a]@`@@h$@<t\u \u @] u`] u`%`,$``4  H]`t`]`t`_a]@3@@h@<t\u \u `] t`] t``%`,$`_a]@@@h@e<t\u \u `] t`] t``%`,$`_a ]@@@h@D<t\u \u `] t`] t``%`,$`_`]@@@h__\ \ @͒@h_\ \ `Ɣ_`]@@@h `@@,@`%@`,$`_`]@h@ע'`_`]@@@h'`]@ա@HH'`p`]@՗H H '`p`]@ՌH '`p`%`,$`_`]@c@@h`]@q@HH '`8`]@gH '`8`%`,$`__\ ` ]_@A@͂`w  @@i[1`@'`̠ '`8'`pw`a0]r<t\u \u @`w] t] t`w\u \u `w] t] t`w\u \u `x] t`] t`a(]u`0`!@,@ $!,@ $!,@ $!,@ $!,@ $!,@ $!,@ $!<,@ $w@@A@̂bԮwwww_@_瀢HC_`p]@@@h_\ \ _D@_a8]@h@ ` (`\@Ot`%`,$`_a@]@t@@h@<t\u \u `p] t`] t``%`,$`_aH]@R@@h@<t\u \u `] t`] t``%`,$`_aP]@1@@h@<t\u \u `] t`] t``%`,$`_aX]@@@h@c<t\u \u `] t`] t``%`,$`_`]@@@h__\ \ @@h_\ \ `_a`]@@@h `@@K@`% `,$`_ah]@@@h`]@ϐ@HH '`<`]@ŐH '`<`%@`,$`_ap]@@@h`]@Ӫ@HH '`8`]@ӠH '`8`%`,$`_ax]@wh֐2 '`آ`%`,$`A@˂atw  @,@g '`<'`8`]<t\u \u `w] t] t`w\u \u `w] t] t`p\t`\t`w` '`'`4`@a]@u 0 ! ,@ $!,@ $!,@ $!,@ $!@,@ $!,@ $!,@ $!,@ $!<,@ $w0A@ʂcww 7@_ H_\ 7@4,0\@\ \ a]@HH  7@ 7@_  O > A@ʂbww_\ Ȁh&^\ `]@ҵH@_` 4 H`4  H %,% `x`x\t`\t`_` 4 H`4  H %,% ``\t`\t`_` 4 H`4  H %,% ``\t`\t`_` 4 H`4  H %,% ``\t`\t`_ 4` H 4  H%,@$ >,0 @_< @O_` 4 H`4  H%,% D`p%`p_` 4 H`4  H%,% D`8%`8_\ H  _ H_ _t`Hb_ ^\ ` ]@HX_  4` HС4  H%,@%  >,0 @_< @O_` 4 H`С4  H%,% D`p%`p_` 4 H`С4  H%,% D`8%`8_\ H _ H_ _t`_ ؀o A@ɂaܮww_\ ؀h>^\ ` ]@}H@_` 4 H`С4  H %,% `x`x\t`\t`_` 4 H`С4  H %,% ``\t`\t`_` 4 H`С4  H %,% ``\t`\t`_` 4 H`С4  H %,% ``\t`\t`_` 4 H`С4  H %,% ``\t`\t`_ 4` H С4  H%@,@$ >,0 @_< @O_` 4 H`С4  H%,% D`p%`p_` 4 H`С4  H%,% D`8%`8_\ H _ H_ _t`Hb_ ^\ `]@ФHX_  4` H4  H%@,@%  >,0 @_< @O_` 4 H`4  H%,% D`p%`p_` 4 H`4  H%,% D`8%`8__\ H Z_ H_ _t`_ Ȁo0w_Z @h_ 2` H@ܑ2  H <*@@"p pZ`rZ`r_ 2` H@ܑ2  H *@@" Z`rZ`r_ 2` H@ܑ2  H *@@" Z`rZ`r_ 2` H@ܑ2  H *@@"ࠔ Z`rZ`r_ 2` H`ܑ2  H *@@" >*0@  @_ : @O_ܑ2  H@`ܑ2  H ` (`ZOr@_ 2` H@ܑ2  H*@@"# _ 2` H@ܑ2  H@*@@"B<# <_ 2` H@ܑ2  H*@@"B8# 8_ Z` H_`Hr`_`@o#0A@ǂ`w_w???????a] Na] @?w?o@w?gߡa] N?a] a] ?Oa] @βNOI@??a] @Ψ N?I@?/@Σ/I??@Τ߿@??@ΖI@HIN??@΋߿@??@΍I@HNIN??@΂I@??@sI@????@hI@INHN????@`I@INHN?_\ gIRNoT睦RNITNIRNVΝRNIVNIRNTΝRNIT໙N A@ƂaĮww???''??_ ? ???PH THa] Pa] @??@?@a] H @a] H _\ ǁa] H?a] H?a] ??a] ?7V XP?ԥ VXP? \?_I[Х T硤 PХP?Wa] H@ͰRI@??@ͩW硧I@?ﭤ PPP硦 X R RP??a] PHX X a] @̀P@͆@??GGۀH???A C繤 ?wҡ G Z ?o \EPa] СP?g\ EPPa] СP?_ܥ ??ũ ?7ڡܡ ?/áš ?'R T@9P@?@?a] PH? ?a] Ha] H?a] Ha] ?@V@?O7a] H?O? P7 PP/ P' PP@ P@@?a] PH?/P7'PP ?a] Ha] H?a] Ha] ?@ @?G?'P/7Pa] H?GG׀HGa] Ha] a] PPH?GG׀HGa] H a] a] P?GGa] a] Pa] P @r@@' G ' H&'_g_OG'  G TG'  ЍP`'   T'  БPJG GO'_< < 0A@Ăaww'_B0H0B,G@H)@H _": *0@ 8:*0@H: 8H _`:*0@H : 8H_`:*0@: 8`G@OB,G@Ha] _?`*0@: 8`G@OA@Ă`Tw'HN_D , HGH_ _\``8p`@_`8?<`<``@?<` <`$`, l,`(_D , HGH_v _\``8ݹ`@_ 8?< <  @?< < $ ,_D , HGH$_W _ 8? @? H? P? X? `?\ _< < < < $ ,_D , HGH0_* _`a] P`?`a] P` ?`8?`@?`H?`P?\`ݱ_< < < < $ ,_D`, H \``8<`_ 8?< < $ ,_D`, H \``*`8_ 8?< < $ ,_D , HGHd_͒ _``8a] PPa] a] Ѕ P?``@a] PPa] a] Љ P?`H?`P?a] PPa] a] Ѝ P?a] PPa] a] Б P? \`_ 8<  @< < < $ ,_E`, HGHp_`a] P`?`a] P` ?a] PPa] a] Ѕ P?a] PPa] a] Љ P?`8?`@?a] PPa] a] Ѝ P?a] PPa] a] Б P?ܨ\`_< < < < H~$ ,H| Hd@ _``8a] PPa] a] Ѕ P?``@a] PPa] a] Љ P?`H?`P?a] PPa] a] Ѝ P?a] PPa] a] Б P?@\`_ 8<  @< < H< _ _\``8`@_ 8?< <  @?< < _$ ,_D , HGH_ 8 @ H PP'G XP'G `Y h_$ ,_$ ,_L ( qH hH  aO cOO lH hOFOO mOO$ q O, < #b$DH @ @A@b@w?'''?G'ÿ?a] GGL@'@ɒI@IH?_D0HcH5_D`,  H`HH ? H`H?HM_D`, H`HH ? H`H?H:_ HH4?_ HH.?L( qH hH  aO cOH lH hOHO mOH$ q H , < #bxD@_ ,wD'GӠ`$,p< 8ݒ PA@c|www 'a] ?ߺ   'Ӡ 'Ϡ 'ˠ 'Ǭ  'a] ?  '_GL@/p8<80HM9HJH4GπH --$ 0 H&'GӀHa] H?ߠ$0'HHH?a] H'Ha] H?H  'Ӡ 'Ϭ  ' 'ˠ$0'?ߠ 'Hh/p8_'@;_'@8_'@_w@_w@_wGπ H 'GӀ H 'GGH'GGH'G'GGۀHhG'GG׀H[_G, GGM@_Ǣ D`< wc] ?w_GM@D`< wc] ?ob0] b0] b0] ʑ H?b8] ? 'K_GK,0D@/_G, GGM@Ơ@< wc] ?g_GM@< @wc] ?_b0] wȑ NL?Ob0] oȑ LNH?Wb0] w_HgHH?b0] w_ Nb0] og JHNHHx?_gJHHq?b0] w_ RgPb0] oΑ PRH b0] ̑ RPH ??b0] Α PR???HH?b0] w_ RgPb0] oΑ PRH b0] ̑ RPH ?7b0] Α PR?77H?Oc ] HWc(] H LJb0] c(] HȑHHH?@WOc(] Hc0] H HWc(] Hb0] ̑HH?H_c ] H Wc(] HOHH?b0] b0] Wc(] Hb0] Oȑ H?HOb0] HHb0] H?Wb0] ̕b0] H b0] ̑H?/b0] ?//?HOb8] HHb8] H)?b0] b0] W̑ Εb8] Hb0] b0] ̑ ΑH?/b8] ?//?HSWc ] H c(] HOHH?b0] b0] c(] Hb0] Oȑ H?H)WOLc(] H LH?WOȑH'@jG'H?G H , < #b_'РDc] H?c] Hc] ?b8] Hb8] ?H'G_G-GGL@Ơ< -@GK  O'Kc] HH'G_D < -@G׀O'G GۀO'(Xld@ ww_w_ttD$D$D$D $ D$`D$`D$`D $` _\ x__\ _@@   @_D _ @`+0 ``+p ` @s_\ _@@@@@@w__`@ _`x@ _`@ @Mv_A@cwwww_@i_瀢H_cH]@i@@h/cP]@ې@H H$'`cX]@АH H'`c`]@ŐH H'`ch]@H H'`'`_cp]@i@@h_`x@=@_cx]@i@@h_`@/@_c]@iy@@h_`@!@_b]@ik@@h@;<t\u \u `8] t`] t`_b]@iP@@h@ͣ<t\u \u `H] t`] t`_b]@i5@@h@͈<t\u \u `X] t`] t`_b]@i@@h@m<t\u \u `h] t`] t`_b]@h@@h _\ \ @آ@0A@cw  @@L'`b]@w`xb]@w`b]@@t` n,`p n,`` n,`P n,`@c8]t`c@]t` c]t`0w@@PA@bwww__@tt7D$D$D$D $ D$`D$`D$`D $` _\ x_@ww@m_'@b_'Ϣ@D`'_H?WD`'H?O`b8] HH `b8] HH `_ H?g` HH ?_b0] ?__?g@_'GGӐ  Ք @ewwG'GGˀHtG'GGǀHg 'KG`Ȁ`?'3G3 H_GK,0@D /b8] ?o 'G`H 'G`HG'WG'gHHH'GG'OG'_HHH'G'G`̀ HGHGǀH$ GGÀH'GGˀH$ 'HO H6GHGǀHG&GǤ$<`@.! L$@GGÀHGˀHGG$Gˤ$<`@.! L$@'H HGHGǀH GÀ@HGˀ@HHCG`G۠$@$ 'G`Gߠ$@$ '_.GGנL@< '/HH/@H< ,$< .! H/ /_`GGG`L< ,0?wowwHH?oGۦ 'G`O/Gߦ 'G`O"o``HH'G'G H 'GGG H 'GGG_G, GGנL@@< ,GK 'KG`Ȁ`?'/G/ OG`ȀH_G, GGנL@_D @< _,@ 'K_GK-D /_G. GGנL@<  `D༠< L@<  .! -` O'K GǀO'G GˀO'_\ _\_@T_@R_@w__`@R _`x@O @_`@J-_A@b\wwww '_ 'ˠ '@f_瀢HG_cp]@f}@@h_`x@%@_c]@fo@@h_`@@_b]@fa@@h@ʴ<t\u \u `8] t`] t`_b]@fF@@h@ʙ<t\u \u `H] t`] t`_b]@f+@@h@~<t\u \u `X] t`] t`_b]@f@@h@c<t\u \u `h] t`] t`_c]@e@@h '@@'`_c]@e@@h '@@'`_c]@eh@?`_c]@e@@hc]@Ր@H H'`'`_c]@eh@q?`_c]@e@@hЩ@H'G'`H'G'`_c]@eh``А_c]@ez@@h>@w`_c]@ek@@hc]@y@H H'`b]@nH H'`'`_b]@eI@@h_\ \ @@@`b8] HH( 'D`H" 'G`H` _`GGG`M@< ,0H= `'G`OGߦ 'G`O``b8] HHb0] <`۩< `E``DLH$%`GˀHG`<` @< '@@'G'`GǀHG`<` @< '@@'G'`ā0A@cw  @@Gb]@nw`xb]@h@t` n,`p n,`` n,`P n,`@b8] <`b8] <`b8] <`b8] <`$`$`c]t`c]t` c]t`0w@@A@aԮwwww''ߡ7p ''''_w@P_'@E_'@_w@_w@_'GGGϠ$@H'GGGӠ$@H'G〤 H 'H_D H_D H_D H_D $HHGÀ H , < #a_DG'GGۀH 'G'GGG@HC_G-`GGL@Gà@< /_G=`@.! L%@< ,G@'= < %@HG׀H<.) _,< ,@G 'GG@OGG@G׀HF'G_GG>.! L&< @$'_.GGL@Gà@< />.! L&< -@'< .) _>  < &, < ,G׀O'G'GGG@H;G_GG=`@.! L%@< %'< < %@ HG׀H<.+ _- GGL@Gà@< ,G 'GG@OG GۀO#'Gà  O'_wG߀ H 'H_D H_D H_D H_D $HHGÀ H , < #a_DG'GG׀H 'G'GGGߢ@HC_G, GGM@@Gà@< /_G߃=`@.! L%@< ,G@'= < %@HGۀH<.) _L@< ,@G 'GGߢ@OGGۀHFG_GG߃>.! L&< $'_G, GN@Gà@< />.! L&< -@'< .) _= < &L@< ,GۀO'GGGߢ@H;G_GG߃=`@.! L%@< %'< < %@ HGۀH<.+ _G, GM@Gà@< ,G 'GGߢ@OG G׀O''Gà  O'Á$Pdx㾰A@` www''70 ''ۡ7p ''_w`] I((?oc(] `] @HoI@bh] c ] @H@'G`] I((?oc(] `] @HoI@bh] c ] @ၢH@'G@H`HW@$< @$'<  @tw___ϖ@`+p `@`#` # (`\Ots___ϐ@@`+p `@`#` # (`\Ots___ϐ@@`+p `@`#` # (`\Ots@D_pww__w@ttD$D$D$D $ D$`D$`D$`D $` _\ x_O@ (`\@Ot_@@@ @   ꪖ@`_ H'` H'âǦ@`+0 ``+p ` @' (`\OtswǢD$`D$`D$`D $` _\ _' (`\@Or@8@r@@p@w__ @p _ x@m @DM_A@bܮwwww_@`_瀢H_cp]@`@@h_ x@K@_c]@`@@h_ @=@_b]@`@@h@<t\u \u  8] t`] t`_b]@`l@@h@Ŀ<t\u \u  H] t`] t`_b]@`Q@@h@Ĥ<t\u \u  X] t`] t`_b]@`6@@h@ĉ<t\u \u  h] t`] t`_` ]@`h  "_b]@` @@h _\ \ @ϯ0A@cԮw  @@C!b]@w`xb]@@t` n,`p n,`` n,`P n,`@b8] <`b8] <``]t``]t` `(]t`0w@@`ww_w_?)ttOD$D$D$D $ D$`D$`D$`D $` _\ x_@www@z_w'@o_w'@_w'GGې   @ww_ _\ ^ w?o_ _\ W v?g_`o L` @HH';G;'c` L` @HH';G;'_GGӀHIGGπH?Gc&GǀHGπHH.G_'GˀHGӀHH" / H_G_'GߤL@Gc&, < _O.@< ,/ OGπO GӀO_w ' ' ' 'ǢD$`D$`D$`D $` _\ _ (`\@Or@H@_w@_@w__ @ _ x@} @B]_A@cwwww_@^_瀢H_cp]@^@@h_ x@[@_c]@^@@h_ @M@_b]@^@@h@<t\u \u  8] t`] t`_b]@^|@@h@<t\u \u  H] t`] t`_b]@^a@@h@´<t\u \u  X] t`] t`_b]@^F@@h@™<t\u \u  h] t`] t`_`@]@^+@@h@~<t\u \u  ] t`] t`_`H]@^@@h@c<t\u \u  ] t`] t`_b]@]@@h _\ \ @͘A@c|w  @@A b]@w`xb]@w` n/`p n/`` n/`P n/`@`X]<t\u \u `] t`] t``X]<t\u \u @] t`] t``0]t`8]t `P]t0wСA@awww__ttD$D$D$D $ D$`D$`D$`D $` _D`D`    7@] H,]\ 7@4,0\@]`\ ``]@ZH]`x_wGGG$G$@ss@_7@ 7@]  O_\ _쾒@@w_w\ @ @@_A@cwwww_@]_瀢H_c]@\@@h_ @@_b]@\@@h@0<t\u \u  8] t`] t`_b]@\@@h@<t\u \u  H] t`] t`_b]@\@@h@<t\u \u  X] t`] t`_b]@\@@h@<t\u \u  h] t`] t`_b]@\q@@h _\ \ @0A@alw  @*@?b]@@t` n,`p n,`` n,`P n,`@`h]t``p]t` `x]t`0w@@ A@`wwww@\/_瀢H_cp]@\w߀@h_\ x@@@w_w\ x@ @?_@ww0A@clw  @@?b]@@t`x`]t` `]t``]t`0w@@㾰ww_w_g'ttD$D$D$D $ D$`D$`D$`D $` _\ x_@ww@x_'@m_'@_'GGא   @wwGGπHG'GGˀH_G, G۠N_D @< '{H' _\ /`@ < ,0D H H _G, G۠N_?`,0@D < -``OHs _?`,0@D /  'w_Gw-D '߀H _\ /`@< ,0D_G, G۠NGߠ@< MG{<`@.! H_\ /`@< ,0D_G, G۠NGߠ@< M<  .! Gw  O'w_\ /`@ < ,0D H H _G, G۠N@< ,``O _?`,0D /_G-G۠N<  `D༠< L@<  .! -```OGˀO4'GπO(_\ _2_@*_@(_@w__`@( _`x@% _`h@g@=_A@awwww '_ @Zo_瀢H_cp]@ZR@@h_`x@@_c]@ZD@@h_`@@_b]@Z6@@h@<t\u \u `8] t`] t`_b]@Z@@h@n<t\u \u `H] t`] t`_b]@Z@@h@S<t\u \u `X] t`] t`_b]@Y@@h@8<t\u \u `h] t`] t`_`]@Y@@h,Ď@wߒ @w` '߀H_ˡ,0@c] HH'G_`˥,0$@ˠ '߀ O@__`]@Y@@h+`]@@HH! `]@HH `]@HH  `]@HH  _b]@Ya@@h_\ \ @@@`H߀ H _`h@8  @w``H߀ H `\`D ''@!\`H`] 'ː  @`t`] c] H˕(a] HHH'G\$`a] c] H˕(a] HȑH'G\$`a] c] H˕(a] HȑH'G\$``] c] H˕(`] HȑH'G\$`a] c] H˕(a] HHH'G\$`a] c] H˕(a] HȑH'G\$``] c] H˕(`] HȑH'G\$`(a] c] H˕(a] HȑH'G\$`,a] c] H˕(a ] HHH'G\$`0 \$`H`H2߀ H`\`D 'c] ?@4\`Hb8] ?@?@?  @`t`] a] HH`] ȑHHc] HH'G\$`a] a] ȑHHa] ȑHHc] HH'G\$`a] a] ȑHHa ] HHc] HH'G\$``] `] ȑHHa(] HHc] HH'G\$`a] a] HHa0] HHc] HH'G\$`a] a] ȑHHa8] ȑHHc] HH'G\$``] `] ȑHHa] ȑHHc] HH'G\$`(a] a] ȑHHa] HHc] HH'G\$`,a] a ] HHa] HHc] HH'G\$`0 \$`H`H:_`h@   @`ta@] c] HH'G\$`<aH] c] HH'G\$`@aP] c] HH'G\$`Db]`]`]'@0A@cLw  @@9b]@zw`xb]@t@t` n,`p n,`` n,`P n,`@t``]t``]t` `]t`0w@@0'wG': :  'w_H@HH)GG2 "`Kr @Z5@3@*0B@Z`2*0B@" K+`" "@: 'ې&J@:  . ? 0'w_H@HHGG2 J r : 'Z@*0B@? 0'w_BLGJ@:  . BP@': : @'' G HGO@:  .; G"  O'@': : A@cw'w_@  X_X HHDTGH'G۠L<  .# _D `H@DT'ۿ?G'ەc] @ ǕI@_D `'ۑHH'G۱>`A@btwww_B`'o_wWtt7D$D$D$D $ D$`D$`D$`D $`  a]?`L@/6 '_\  H6_\ \ ߡ,0\@w'_'\ \ a] @H_']\ L O6H]8_?`,0@ D`,0uD`,0H uߠ '_\   O_\  H aX]_?`,0@D ,0u``O_\ x_@BwGwg@_G'@_G'@Q_G'GGӐ  ޠ @0wOw_G'GGˀHG'GGǀHw_gGGעL@G, @< ww @Go@H_w<`  H H'3=` ,$< .! '3H_w=` @'3?`,0\@G3\@'ۀ`H H'ۀ`H 'Gۦs?`,``O s_?`,0D Go L<  .) __GGפL@G.< .@``OGo < .@GǀO'G GˀO'_\ _O_@_G@ _OA@awwww_@Tr_瀢H_c]@TU@@h_ @@_cp]@TG@@h_ x@@_b]@T9@@h@<t\u \u  8] t`] t`_b]@T@@h@q<t\u \u  H] t`] t`_b]@T@@h@V<t\u \u  X] t`] t`_b]@S@@h@;<t\u \u  h] t`] t`_b]@S@@h _\ \ @p0A@bܮw  @@6b]@^w`b]@X@t`x n,`p n,`` n,`P n,`@a]t`a]t`0w@@A@awwww_@S_瀢H_`]@Skw߀@hFa]@y@HaX]H9w`8_a]@kHa`]H+w`8_a]@]Hah]Hw`8_a]@OHap]Hw`8_a]@AHax]w`8_a]@Sw߀@h*`H@w`H @w`@ '`HH_ӡ-pc] HH'G_`@-p$@`'`H O@__a]@Rw߀h@c] HH'G'`L_a]@Rw߀h@Ғc] HH'G'`P_a]@Rw߀h@c] HH'G'`T_a]@Rw߀h@?`X_a]@Rw߀h@c] HH'G'``@w_w`HH@`\`@@5_0A@aw/  h@1@5b]@t` a]t`0aX]t`8$`Hw@@㾰ww_w_gڳtt{D$D$D$D $ D$`D$`D$`D $` _\ x_@?ww@_'@_'@N_'__`HH'cGc'`HH'cGc'GGӐ  ۍ @wwGGˀ@HGGǀH -8408< Hs_D HH  G 'ߢ`HPG 'ۢ`HAGߦ@GӀHH GۨGπH HH%_GעL- @-8408< @< @/_D H .8408< HH .8408< HGۤ 'G OGߤ 'G O.8508_GעO@/ @-84p8<`< ,`-8408< O GǀO`Gˀ@O{_\ __@_@_@w__ @ _ x@ @4_A@`wwww_@QF_瀢H_cp]@Q)@@h_`x@ђ@_c]@Q@@h_`@Ò@_b]@Q @@h@`<t\u \u `8] t`] t`_b]@P@@h@E<t\u \u `H] t`] t`_b]@P@@h@*<t\u \u `X] t`] t`_b]@P@@h@<t\u \u `h] t`] t`_b]@Ph``_b ]@P@@hb(]@@HH '`b0]@H '`_b]@Ps@@h _\ \ @@0A@atw  @,@3b]@w`xb]@@t` n,`p n,`` n,`P n,`@b8] <`b8] <`$`b]t`b]t` b8]t`0w@@㾐A@`\w?ww_w_G،ttD$D$D$D $ D$`D$`D$`D $` _\ xj_@ww_\ c_@ww@_'@_'@ _'GGې  o @ww_D HGGӀ@HGGπH_/ GߠO@ < < 'w_ < 's_D`LL<  .% D`LD`L<  .7 H H _/ GߠO@ < ,HU -8408< HN_/ GߠO@-8408