# PaCkAgE DaTaStReAm lua 1 1505 # end of header 0707010005d1f2000081a40000000000000000000000014c5cc6580000010b0000010000010036ffffffffffffffff0000000c00000000lua/pkginfoPKG=lua NAME=lua 5.1.4 SPARC 64bit Solaris 10 VERSION=5.1.4 PSTAMP=7th August 2010 VENDOR=The Lua Project EMAIL=http://www.lua.org/home.html DESC=Lua embeddable scripting language ARCH=sparc CATEGORY=utility CLASSES=none BASEDIR=/ ISTATES=S s 1 2 3 RSTATES=S s 1 2 3 0707010005d1f1000081a40000000000000000000000014c5cc658000004fa0000010000010036ffffffffffffffff0000000b00000000lua/pkgmap: 1 1505 1 d none /usr ? ? ? 1 d none /usr/local ? ? ? 1 d none /usr/local/bin 0755 root root 1 f none /usr/local/bin/lua 0755 root root 223856 62841 1281148483 1 f none /usr/local/bin/luac 0755 root root 158804 17724 1281148483 1 d none /usr/local/include 0755 root root 1 f none /usr/local/include/lauxlib.h 0644 root root 5777 49677 1281148483 1 f none /usr/local/include/lua.h 0644 root root 11688 61038 1281148483 1 f none /usr/local/include/lua.hpp 0644 root root 191 15745 1281148483 1 f none /usr/local/include/luaconf.h 0644 root root 22299 51288 1281148483 1 f none /usr/local/include/lualib.h 0644 root root 1026 14471 1281148483 1 d none /usr/local/lib 0755 root root 1 f none /usr/local/lib/liblua.a 0644 root root 299008 1937 1281148483 1 d none /usr/local/lib/lua 0755 root root 1 d none /usr/local/lib/lua/5.1 0755 root root 1 d none /usr/local/man 0755 root root 1 d none /usr/local/man/man1 0755 root root 1 f none /usr/local/man/man1/lua.1 0644 root root 3619 49753 1281148483 1 f none /usr/local/man/man1/luac.1 0644 root root 3617 56791 1281148483 1 d none /usr/local/share 0755 root root 1 d none /usr/local/share/lua 0755 root root 1 d none /usr/local/share/lua/5.1 0755 root root 1 i checkinstall 785 2565 1281148504 1 i pkginfo 267 20670 1281148504 07070100000000000000000000000000000000000000010000000000000000000000000000000000000000000000000000000b00000000TRAILER!!!0707010005d1f2000081a40000000000000000000000014c5cc6580000010b0000010000010036ffffffffffffffff0000000800000000pkginfoPKG=lua NAME=lua 5.1.4 SPARC 64bit Solaris 10 VERSION=5.1.4 PSTAMP=7th August 2010 VENDOR=The Lua Project EMAIL=http://www.lua.org/home.html DESC=Lua embeddable scripting language ARCH=sparc CATEGORY=utility CLASSES=none BASEDIR=/ ISTATES=S s 1 2 3 RSTATES=S s 1 2 3 0707010005d1f1000081a40000000000000000000000014c5cc658000004fa0000010000010036ffffffffffffffff0000000700000000pkgmap: 1 1505 1 d none /usr ? ? ? 1 d none /usr/local ? ? ? 1 d none /usr/local/bin 0755 root root 1 f none /usr/local/bin/lua 0755 root root 223856 62841 1281148483 1 f none /usr/local/bin/luac 0755 root root 158804 17724 1281148483 1 d none /usr/local/include 0755 root root 1 f none /usr/local/include/lauxlib.h 0644 root root 5777 49677 1281148483 1 f none /usr/local/include/lua.h 0644 root root 11688 61038 1281148483 1 f none /usr/local/include/lua.hpp 0644 root root 191 15745 1281148483 1 f none /usr/local/include/luaconf.h 0644 root root 22299 51288 1281148483 1 f none /usr/local/include/lualib.h 0644 root root 1026 14471 1281148483 1 d none /usr/local/lib 0755 root root 1 f none /usr/local/lib/liblua.a 0644 root root 299008 1937 1281148483 1 d none /usr/local/lib/lua 0755 root root 1 d none /usr/local/lib/lua/5.1 0755 root root 1 d none /usr/local/man 0755 root root 1 d none /usr/local/man/man1 0755 root root 1 f none /usr/local/man/man1/lua.1 0644 root root 3619 49753 1281148483 1 f none /usr/local/man/man1/luac.1 0644 root root 3617 56791 1281148483 1 d none /usr/local/share 0755 root root 1 d none /usr/local/share/lua 0755 root root 1 d none /usr/local/share/lua/5.1 0755 root root 1 i checkinstall 785 2565 1281148504 1 i pkginfo 267 20670 1281148504 0707010005d205000041ed0000000000000000000000024c5cc658000000000000010000010036ffffffffffffffff0000000800000000install0707010005d206000081ed0000000000000000000000014c5cc658000003110000010000010036ffffffffffffffff0000001500000000install/checkinstall#!/bin/sh # expected_bits="64" expected_release="5.10" expected_platform="sparc" # release=`uname -r` platform=`uname -p` bits=`isainfo -b` # if [ ${platform} != ${expected_platform} ]; then echo "\n\n\n\tThis package must be installed on a ${expected_platform} architecture\n" echo "\tAborting installation.\n\n\n" exit 1 fi if [ ${release} != ${expected_release} ]; then echo "\n\n\n\tThis package must be installed on a ${expected_release} machine\n" echo "\tAborting installation.\n\n\n" exit 1 fi if [ ${bits} != ${expected_bits} ]; then echo "\n\n\n\tThis package must be installed on a ${expected_bits} bit machine\n" echo "\tYour machine is running a ${bits} bit O.S. currently\n" echo "\tAborting installation.\n\n\n" exit 1 fi exit 0 0707010005d1f3000041ed0000000000000000000000034c5cc658000000000000010000010036ffffffffffffffff0000000500000000root0707010005d1f4000041ed0000000000000000000000034c5cc658000000000000010000010036ffffffffffffffff0000000900000000root/usr0707010005d1f5000041ed0000000000000000000000064c5cc658000000000000010000010036ffffffffffffffff0000000f00000000root/usr/local0707010005d201000041ed0000000000000000000000034c5cc658000000000000010000010036ffffffffffffffff0000001300000000root/usr/local/man0707010005d202000041ed0000000000000000000000024c5cc658000000000000010000010036ffffffffffffffff0000001800000000root/usr/local/man/man10707010005d204000081a40000000000000000000000014c5cc64300000e210000010000010036ffffffffffffffff0000001f00000000root/usr/local/man/man1/luac.1.\" $Id: luac.man,v 1.28 2006/01/06 16:03:34 lhf Exp $ .TH LUAC 1 "$Date: 2006/01/06 16:03:34 $" .SH NAME luac \- Lua compiler .SH SYNOPSIS .B luac [ .I options ] [ .I filenames ] .SH DESCRIPTION .B luac is the Lua compiler. It translates programs written in the Lua programming language into binary files that can be later loaded and executed. .LP The main advantages of precompiling chunks are: faster loading, protecting source code from accidental user changes, and off-line syntax checking. .LP Pre-compiling does not imply faster execution because in Lua chunks are always compiled into bytecodes before being executed. .B luac simply allows those bytecodes to be saved in a file for later execution. .LP Pre-compiled chunks are not necessarily smaller than the corresponding source. The main goal in pre-compiling is faster loading. .LP The binary files created by .B luac are portable only among architectures with the same word size and byte order. .LP .B luac produces a single output file containing the bytecodes for all source files given. By default, the output file is named .BR luac.out , but you can change this with the .B \-o option. .LP In the command line, you can mix text files containing Lua source and binary files containing precompiled chunks. This is useful to combine several precompiled chunks, even from different (but compatible) platforms, into a single precompiled chunk. .LP You can use .B "'\-'" to indicate the standard input as a source file and .B "'\--'" to signal the end of options (that is, all remaining arguments will be treated as files even if they start with .BR "'\-'" ). .LP The internal format of the binary files produced by .B luac is likely to change when a new version of Lua is released. So, save the source files of all Lua programs that you precompile. .LP .SH OPTIONS Options must be separate. .TP .B \-l produce a listing of the compiled bytecode for Lua's virtual machine. Listing bytecodes is useful to learn about Lua's virtual machine. If no files are given, then .B luac loads .B luac.out and lists its contents. .TP .BI \-o " file" output to .IR file , instead of the default .BR luac.out . (You can use .B "'\-'" for standard output, but not on platforms that open standard output in text mode.) The output file may be a source file because all files are loaded before the output file is written. Be careful not to overwrite precious files. .TP .B \-p load files but do not generate any output file. Used mainly for syntax checking and for testing precompiled chunks: corrupted files will probably generate errors when loaded. Lua always performs a thorough integrity test on precompiled chunks. Bytecode that passes this test is completely safe, in the sense that it will not break the interpreter. However, there is no guarantee that such code does anything sensible. (None can be given, because the halting problem is unsolvable.) If no files are given, then .B luac loads .B luac.out and tests its contents. No messages are displayed if the file passes the integrity test. .TP .B \-s strip debug information before writing the output file. This saves some space in very large chunks, but if errors occur when running a stripped chunk, then the error messages may not contain the full information they usually do. For instance, line numbers and names of local variables are lost. .TP .B \-v show version information. .SH FILES .TP 15 .B luac.out default output file .SH "SEE ALSO" .BR lua (1) .br http://www.lua.org/ .SH DIAGNOSTICS Error messages should be self explanatory. .SH AUTHORS L. H. de Figueiredo, R. Ierusalimschy and W. Celes .\" EOF 0707010005d203000081a40000000000000000000000014c5cc64300000e230000010000010036ffffffffffffffff0000001e00000000root/usr/local/man/man1/lua.1.\" $Id: lua.man,v 1.11 2006/01/06 16:03:34 lhf Exp $ .TH LUA 1 "$Date: 2006/01/06 16:03:34 $" .SH NAME lua \- Lua interpreter .SH SYNOPSIS .B lua [ .I options ] [ .I script [ .I args ] ] .SH DESCRIPTION .B lua is the stand-alone Lua interpreter. It loads and executes Lua programs, either in textual source form or in precompiled binary form. (Precompiled binaries are output by .BR luac , the Lua compiler.) .B lua can be used as a batch interpreter and also interactively. .LP The given .I options (see below) are executed and then the Lua program in file .I script is loaded and executed. The given .I args are available to .I script as strings in a global table named .BR arg . If these arguments contain spaces or other characters special to the shell, then they should be quoted (but note that the quotes will be removed by the shell). The arguments in .B arg start at 0, which contains the string .RI ' script '. The index of the last argument is stored in .BR arg.n . The arguments given in the command line before .IR script , including the name of the interpreter, are available in negative indices in .BR arg . .LP At the very start, before even handling the command line, .B lua executes the contents of the environment variable .BR LUA_INIT , if it is defined. If the value of .B LUA_INIT is of the form .RI '@ filename ', then .I filename is executed. Otherwise, the string is assumed to be a Lua statement and is executed. .LP Options start with .B '\-' and are described below. You can use .B "'\--'" to signal the end of options. .LP If no arguments are given, then .B "\-v \-i" is assumed when the standard input is a terminal; otherwise, .B "\-" is assumed. .LP In interactive mode, .B lua prompts the user, reads lines from the standard input, and executes them as they are read. If a line does not contain a complete statement, then a secondary prompt is displayed and lines are read until a complete statement is formed or a syntax error is found. So, one way to interrupt the reading of an incomplete statement is to force a syntax error: adding a .B ';' in the middle of a statement is a sure way of forcing a syntax error (except inside multiline strings and comments; these must be closed explicitly). If a line starts with .BR '=' , then .B lua displays the values of all the expressions in the remainder of the line. The expressions must be separated by commas. The primary prompt is the value of the global variable .BR _PROMPT , if this value is a string; otherwise, the default prompt is used. Similarly, the secondary prompt is the value of the global variable .BR _PROMPT2 . So, to change the prompts, set the corresponding variable to a string of your choice. You can do that after calling the interpreter or on the command line (but in this case you have to be careful with quotes if the prompt string contains a space; otherwise you may confuse the shell.) The default prompts are "> " and ">> ". .SH OPTIONS .TP .B \- load and execute the standard input as a file, that is, not interactively, even when the standard input is a terminal. .TP .BI \-e " stat" execute statement .IR stat . You need to quote .I stat if it contains spaces, quotes, or other characters special to the shell. .TP .B \-i enter interactive mode after .I script is executed. .TP .BI \-l " name" call .BI require(' name ') before executing .IR script . Typically used to load libraries. .TP .B \-v show version information. .SH "SEE ALSO" .BR luac (1) .br http://www.lua.org/ .SH DIAGNOSTICS Error messages should be self explanatory. .SH AUTHORS R. Ierusalimschy, L. H. de Figueiredo, and W. Celes .\" EOF 0707010005d1ff000041ed0000000000000000000000024c5cc658000000000000010000010036ffffffffffffffff0000001300000000root/usr/local/lib0707010005d200000081a40000000000000000000000014c5cc643000490000000010000010036ffffffffffffffff0000001c00000000root/usr/local/lib/liblua.a! / 1281148481 0 0 0 4456 ` R$R$R$R$R$R$R$R$R$R$R$R$R$R$R$R$R$R$R$R$R$R$R$R$R$R$R$R$R$d666666666kkkvvvvvvvvvllD\\\\\\\\\\\8888GG_T_T_T_T_T_T_T_TT+\4Qlua_identluaA_pushobjectlua_checkstacklua_xmovelua_setlevellua_atpaniclua_newthreadlua_gettoplua_settoplua_removelua_insertlua_replacelua_pushvaluelua_typelua_typenamelua_iscfunctionlua_isnumberlua_isstringlua_isuserdatalua_rawequallua_equallua_lessthanlua_tonumberlua_tointegerlua_tobooleanlua_tolstringlua_objlenlua_tocfunctionlua_touserdatalua_tothreadlua_topointerlua_pushnillua_pushnumberlua_pushintegerlua_pushlstringlua_pushstringlua_pushvfstringlua_pushfstringlua_pushcclosurelua_pushbooleanlua_pushlightuserdatalua_pushthreadlua_gettablelua_getfieldlua_rawgetlua_rawgetilua_createtablelua_getmetatablelua_getfenvlua_settablelua_setfieldlua_rawsetlua_rawsetilua_setmetatablelua_setfenvlua_calllua_pcalllua_cpcalllua_loadlua_dumplua_statuslua_gclua_errorlua_nextlua_concatlua_getallocflua_setallocflua_newuserdatalua_getupvaluelua_setupvalueluaK_nilluaK_codeABCluaK_jumpluaK_codeABxluaK_concatluaK_retluaK_getlabelluaK_patchlistluaK_patchtohereluaK_checkstackluaK_reserveregsluaK_stringKluaK_numberKluaK_setreturnsluaK_setoneretluaK_dischargevarsluaK_exp2nextregluaK_exp2anyregluaK_exp2valluaK_exp2RKluaK_storevarluaK_selfluaK_goiftrueluaK_indexedluaK_prefixluaK_infixluaK_posfixluaK_fixlineluaK_setlistlua_sethooklua_gethooklua_gethookmasklua_gethookcountlua_getstacklua_getlocallua_setlocallua_getinfoluaG_checkopenopluaG_checkcodeluaG_typeerrorluaG_runerrorluaG_concaterrorluaG_aritherrorluaG_ordererrorluaG_errormsgluaD_seterrorobjluaD_reallocCIluaD_throwluaD_rawrunprotectedluaD_reallocstackluaD_growstackluaD_callhookluaD_precallluaD_poscallluaD_calllua_resumelua_yieldluaD_pcallluaD_protectedparserluaU_dumpluaF_newCclosureluaF_newLclosureluaF_newupvalluaF_findupvalluaF_freeupvalluaF_closeluaF_newprotoluaF_freeprotoluaF_freeclosureluaF_getlocalnameluaC_separateudataluaC_callGCTMluaC_freeallluaC_stepluaC_fullgcluaC_barrierfluaC_barrierbackluaC_linkluaC_linkupvalluaX_tokensluaX_lexerrorluaX_initluaX_token2strluaX_syntaxerrorluaX_newstringluaX_setinputluaX_nextluaX_lookaheadluaM_growaux_luaM_realloc_luaM_toobigluaO_nilobject_luaO_int2fbluaO_fb2intluaO_log2luaO_rawequalObjluaO_str2dluaO_pushvfstringluaO_pushfstringluaO_chunkidluaP_opnamesluaP_opmodesluaY_parserluaE_newthreadluaE_freethreadlua_newstatelua_closeluaS_resizeluaS_newlstrluaS_newudataluaH_nextluaH_setnumluaH_setluaH_resizearrayluaH_newluaH_freeluaH_getnumluaH_getstrluaH_getluaH_setstrluaH_getnluaT_typenamesluaT_initluaT_gettmluaT_gettmbyobjluaU_headerluaU_undumpluaV_tonumberluaV_tostringluaV_gettableluaV_settableluaV_lessthanluaV_equalvalluaV_concatluaV_executeluaZ_fillluaZ_lookaheadluaZ_initluaZ_readluaZ_openspaceluaL_argerrorluaL_errorluaL_typerrorluaL_whereluaL_checkoptionluaL_optlstringluaL_checklstringluaL_newmetatableluaL_checkudataluaL_checkstackluaL_checktypeluaL_checkanyluaL_checknumberluaL_optnumberluaL_checkintegerluaL_optintegerluaL_getmetafieldluaL_callmetaluaL_registerluaL_openlibluaL_findtableluaL_gsubluaL_buffinitluaL_addlstringluaL_addstringluaL_pushresultluaL_prepbufferluaL_addvalueluaL_refluaL_unrefluaL_loadfileluaL_loadbufferluaL_loadstringluaL_newstateluaopen_baseluaopen_debugluaopen_ioluaopen_mathluaopen_osluaopen_tableluaopen_stringluaopen_packageluaL_openlibslapi.o/ 1281148464 0 0 100644 16444 ` ELF=4(.shstrtab.text.rodata.rodata1.annotate.debug_info.debug_line.debug_abbrev.symtab.strtab.rela.text.rela.annotate.rela.debug_info.comment @ *`  `@# @g@3 ?`@@*` + ?`@H? #``@ @  X  ` " X" `?`@ 2@  H ?`#@  *@ !  d  (  2@  H`  Z`s `#  " 㿠#@@@&#@  #: ` :@@`H `.``$@@``@@H ``&  @`* @#``  `   `" X q` !`&O` 42`4 `X #`X㿠 `@ `D @@@ %%&  # :` @ :  @*`  @ @     @ *O "  `+` " 㿠  @ ^v& *O^ ' & 㿠 @ ^v&&8O^ _`r `" 㿠'?@@  ( @-@֒@2@  `` ?"`  `@2 `"@-  ` "H)  @# [?@ r ?@"  ?&@   `"H   ` "H    @ '`& 㿠 Z w  '  & 㿠`2@ ?@*`` 㿠e `@  ` @  㿐T `@ @@  㿠@ @ @  㿠6 `@ `@  㿠;%!`@ 1 @@ 㿠; `@-@@ @@   㿠;`@@7@@ 㿐֒ `"@  @@;` 㿐Ò `"@  @2@  B#\\㿠  @ `2@  ``@   㿘 `@@@`f@&`  @ D @@"@`` &``㿠r `@`@`"@  `@ `"H ` @@@  㿠E  @ `@`` 㿠2 `@`"@  ` 㿠 `"@  㿠 `@ `@`"H `"@   `@ `"H  @ #` `" #H #L H; #  "   #\\; #  " `㿠 `@ `D*@ @ @% % `& 㿠@@@@㿠 `@ `D @@@㿠'L'P'T'X `@ `D @L@L@㿠 `@ `D @@ǐ@" . " @&  ,` ]?s`#`#`2O   %% &  2`  3p?"" `"   # #  "   # #  `"  p@1` 0?㿠= '` '`@㿐 1@@'' @ & 㿠  @'` Z v &㿠  @ Z w  '  & 㿠 `@ `D*@ @ @% % `& 㿠 `@`"@       .``2@  '  '  &  㿠 `@`@`"@      #`#`     $$   ^`Hv`P& & `& 㿠 '`  '`@ ' & 㿐 @@'' ' @ && 㿠k  '` '` @^r "  @   "@  ` ` "H `@ ' & 㿠C  @'`_`r `"  @   "@  ` ` "H `@ ' & 㿠 `@    @"@ %  @%#  `"H"  "H  @ @$` "H  "H   @  .`%` ' &  㿠 ڐ `@`@ `"@    "`   #   $ H$ P@  ` "@   `"H   @ '`& 㿠 `/`&@@   @ @  &  ``@㿘@ ``} " .`'%'' %@@  `  @  ' 㿠@ ` "   ' '  &   `%`%`  &  $ @㿘'7'  '@ 㿈`d@@@ `@ @ !`   ` @  L\l| 㿠7`  @=.`@@?' @ D' @@ D3  D c D. 8@' @ D$' @ D D @@@ `"@  D @O P' P T' T?㿠@ 㿠  '`@"@  & ' & 㿠`@`  @ D@ *@ @  %< `<@ .`#& H; `@ '  '  &  "@  `"` `  #` #` 㿠 `@ `D @@@  && &   `"@  `@`&@  @4H *` @# "` @ $@@ *` @?"  㿘ϒ@  _`v`& & 㿘@  % &  \t $  ` @  `@ `H `@$Lua: Lua 5.1.4 Copyright (C) 1994-2008 Lua.org, PUC-Rio $ $Authors: R. Ierusalimschy, L. H. de Figueiredo & W. Celes $ $URL: www.lua.org $ no calling environmentno value?anotate`,$p XB t\\T84(DD4@XTPTLL0,4\,0P, <,`<D\@dXBt8BDTBBT$dP LB  (((8HXlapi.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lapi.o lapi.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.771 /var/tmp/lua-5.1.4/srclapi.c DD%!,,CJtR i  u<$`$p X Pt\( \3|T?M[8i4rL(tDD40@pX TT&L3PA LTO ]k @v L @L 0  < T, 4 \ , L0); |PK \m,} <,@`<D \|  ,@9GdT\_hy|X8@D T'.:(DR<T[ep|l$dPlapi.cDrodata.rodataindex2adrgetcurrenv___const_seg_900002401f_callf_Ccall___const_seg_900006501aux_upvaluelua_identluaO_nilobject_luaA_pushobjectlua_checkstackluaD_growstacklua_xmovelua_setlevellua_atpaniclua_newthreadluaC_stepluaE_newthreadlua_gettoplua_settoplua_removelua_insertlua_replaceluaG_runerrorluaC_barrierflua_pushvaluelua_typeluaT_typenameslua_typenamelua_iscfunctionlua_isnumberluaV_tonumberlua_isstringlua_isuserdatalua_rawequalluaO_rawequalObjlua_equalluaV_equalvallua_lessthanluaV_lessthanlua_tonumberlua_tointegerlua_tobooleanlua_tolstringluaV_tostringlua_objlenluaH_getnlua_tocfunctionlua_touserdatalua_tothreadlua_topointerlua_pushnillua_pushnumberlua_pushintegerlua_pushlstringluaS_newlstrlua_pushstringstrlenlua_pushvfstringluaO_pushvfstringlua_pushfstringlua_pushcclosureluaF_newCclosurelua_pushbooleanlua_pushlightuserdatalua_pushthreadlua_gettableluaV_gettablelua_getfieldlua_rawgetluaH_getlua_rawgetiluaH_getnumlua_createtableluaH_newlua_getmetatablelua_getfenvlua_settableluaV_settablelua_setfieldlua_rawsetluaH_setluaC_barrierbacklua_rawsetiluaH_setnumlua_setmetatablelua_setfenvlua_callluaD_calllua_pcallluaD_pcalllua_cpcalllua_loadluaZ_initluaD_protectedparserlua_dumpluaU_dumplua_statuslua_gcluaC_fullgclua_errorluaG_errormsglua_nextluaH_nextlua_concatluaV_concatlua_getallocflua_setallocflua_newuserdataluaS_newudatalua_getupvaluelua_setupvalue  (     #,$$  T \ d' h' +&x    /     1\ x   3+   + 8  : 8 ,<  C 0? 8E DB l tG  G J8OXEhCORT@TVZE C@Z]^`|^$^h$`$dd4 < TfJd  0fH $L $ditjl $ \o,qXsu$ (, (4Cyd ,t ,$ ,8<D`P$\ht P |Lt0p(T4@ LL X @d p @|   < T    L |  $@0<H T|` lx\|@( <,8lDP\ht , 0 D t84cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)assert.h 1.10 04/05/18 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/034 $-"T,"l8#;D#WR#p Z+0b1  m5D  |:4  :Llcode.o/ 1281148465 0 0 100644 16276 ` ELF=`4(.shstrtab.text.rodata1.annotate.debug_info.debug_line.debug_abbrev.symtab.strtab.rela.text.rela.annotate.rela.debug_info.comment @ `@`@     @1  `2@ 2 @'( `  )`@ ?`H `0@H 3  a` H   H `?+ * !`   @㿘 ?&  @ '@    @㿠@@㿠 &` .`9#@@# @ @1?,-@ @& "   *`? ?`   ?2)@@`d@  *``` @  ` ?H#` 㿠@ `? 2@  ͒?O 㿠Ӓ  ?@ @`1 @ !?` ?.# @   '``3-`c6 @'` 㿠@  ̔?O㿠@}@NHO㿠 ?  ޖ &   @@  ͞㿠@ @㿠@`?2H`&`5?@  /?2O 㿠 $ K@ @/` @`/`K㿠@ $@& $a@  2@ @ $" $`` @`㿠  @ `( 2@ ( D#\\:  " `( ( @ `(` #@ $``(@ @ /`` `# `(@ &O` (`^-@u$ @`"@  ( ` "H (@ (`& (㿐' '㿈'H 'LH?'㿐' '㿀' ' '`` @ ) ` @ `+  )@   `*` ``H) ?*` `+ @  (  ?`)`?  ` `+`c  $ * `*` "@`` @  "` `* @3  "`` H ?@` `+   ) ` `+`" "`P\㿠`7% @0/ @@ *&``  `@ $ &`` @ ` %`&`` `ΐː  @ %&`@㿠@ @h P㿠9@` % @L.@@@ `@'`` ``1 0?`@ 2'`` @`*'```` @ @'` '?? .`` -  @ " '``@`` @ '` &`㿠`` @@  $㿠`` @```@``@6?`?X2@ ``RH` @?@ Z  T @@``?&` &`$`&`㿠@@  $㿠@`` @``2@ 2``H ``@``` @@@㿠@` @' `(H  (@ @- H3 (`@/`2@`+`$ @ ``` @ $``5 3p?` $ &``a`@`@㿠``@`@ `"H-`@` "H&r`@` @ @`@  @`` @ O㿠`@ F $@ @` @6'`&`㿠 3` 3? -`?7` d@. " 㿠`` @  `- `?@ 4` &  d@ ʁ ` 㿠@``@ `"@"?`H`"@ ?`"@?` "@ `@ ``` `?@`@&`㿠@``@ `"@?`@ `"@?` "@ ` @ `` `?@`@&`hxhxx㿠7@`% @"/ @@ &`` &``A`` g`  @ % &```&`&```㿠 @&` &`DXP8@Q@L+& `` @:/ @@D7 @4 @D1 @- J#@+ā / HP ;x;#`#d`@dx D @#p#t#h#lhpt@l @ @ 1 @`bP `P> 㿠@(`@ `@@ @@ Β˒ǒĒ  @&&㿠@@@`f@ f@f@ c&&㿈?'' '@ w`@`"H@@ @ x`l㿠9` @.`@@@@@@@,@Th|h㿠;``@.`@  @_ u _ u _ u @  @_ u _ u _ u @ @$ `  .@`?@ %??   -  ,@,  @  *`!%  % @    ށ ف ԁ ρ             ` +` "㿠 `,`@ `,` ``#@ $` `` -`$``0@ `0`-`#@ $```.`%` '`* + @ *@ Ǟ *@ *` 㿠z? K 2 ?`? %d@@  "@ ` "`@   & $control structure too longfunction or expression too complexconstant table overflowcode size overflowanotate@L@BH B$BpDHTDp,B(BtH$0$@(4(0,B48B8$BtBXB$BB,$BpB\BB\x\BT$000<< ,@h8$$\|$$$$$8||||(<<, ,HD,,,,,, PPPPPPD@Th|Dlcode.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lcode.o lcode.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.782 /var/tmp/lua-5.1.4/srclcode.c DD% @$p$\D,H;TFLSD`Xpm,zH0$@H(p0 X$ \, 0 \ 4 H8X 806h>`0U\blu8<<T P,@H@$Xt  L)&6(E,VHf$w(4  |8 8$\"p0Tt:H<$U[_@k$xv\8dlcode.cisnumeralcondjumpfixjumpgetjumpgetjumpcontrolneed_valuepatchtestregremovevaluespatchlistauxdischargejpcfreeregfreeexpaddkboolKnilK___const_seg_900002901code_label___const_seg_900003101discharge2regdischarge2anyregexp2reginvertjumpjumponcondluaK_goiffalse___const_seg_900004401codenot___const_seg_900004601constfoldingcodearithcodecomp___const_seg_900004901___const_seg_900005001___const_seg_900005101luaK_codeluaK_nilluaK_codeABCluaK_jumpluaK_codeABxluaK_concatluaK_retabsluaX_syntaxerrorluaK_getlabelluaP_opmodesluaK_patchlistluaK_patchtohereluaK_checkstackluaK_reserveregsluaH_setluaM_growaux_luaC_barrierfluaK_stringKluaK_numberKluaK_setreturnsluaK_setoneretluaK_dischargevarsluaK_exp2nextregluaK_exp2anyregluaK_exp2valluaK_exp2RKluaK_storevarluaK_selfluaK_goiftrueluaK_indexedfloorpowluaK_prefixluaK_infixluaK_posfixluaK_fixlineluaK_setlist8-`/t0--.2  3 5 5 704@0 3 8: @( @4;< 9  X  X - / 8- L@ `4 -  A  , 4- P/ p> / - (9 t0 .7$4A9A$BLCTAdDC>hCC-C/(ED-`C9E-A(.h0t7A.0$7p 8tA 8-HE ` `   $ ( XJK  E8E-EECC( 0 LHdBEE   A0HAX0D$B X X; X X;-- ,P8@DP\hLt\LX,XH(4@HLpXd p \|  H8\pT  <$08<THT@`dp |x X  h8`@8$ X 8`8 ,<8@DHL$P@TX\ ` Ld h 8lpLtTx|hL4LXd8L`t(8\  X   X\8`@ )(cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/034 k,P$$|0%/<<%kJ% ,R*Z.0 e3 t9 9 ldebug.o/ 1281148466 0 0 100644 11868 ` ELF,,4(.shstrtab.text.rodata1.annotate.debug_info.debug_line.debug_abbrev.symtab.strtab.rela.text.rela.annotate.rela.debug_info.comment` @ `` ` @ @ 2@` #` `` ` #@8 8`??㿠ߒ@?` `@ `* ` @ @ 2H" D " D " < <" @* 8  D 8 <  @( @`  @`"@ `@ (8O`@`(@ (UU~ 9 H0 9 ;`" "`h` d ``d # h  @ `` ` @`` 㿠@ V@"@  @2@` ``%@>`@=@@` 㿠`` (/ '@.Δ@.$@㿠`` (/ '@.@ . `\t?$? &&  ` @ `? ?  $``    ` <$ `@  d@  <@㿠;?`&  $&  & & & & &  @ <& 㿠"@& @! @ `0 @  ``@" `"  0@&O`  %`%`  "  &@@@  `& 㿘2@N` `@u @?N``l@ L@0SHf2H+ *`l@ nHu"H b`&`&`@Q&`d@ d@"`! ``N` 2ON`59?N` `l@ `L@'`SH`f2H" !``l"@&`n"H&`u"H #`&`` d@d@%`$```N`2ON`㿠N``>@   ` " ' `@  ` (/`$@, @ b@ f@`2@  $ $ $  %`@@  ' @ L@ K @ `J `I `K $@ `J `"@ `H `J2@ `H `$ $@`, `0@"@`,`0"@`, @ `,` *@  ?`@  ?`@`#``@ 2  @`"H2 ! f@ @@ `! @ "Ha @  K@ @  @ ~ ( &@   K@ @   h||||||||||||H|||||tt,,,|x㿠#\ ,Y2@\ `@| ? ` ,c  @?`&@k0 K @d@`@ @@! @+ U 00 ! !8`~@  :  `u2H?   0: `@3  (@ &H0  0 @8` @%`@ ,@ $H @ )  @ ? "@ 2@`@&O `"H   @@d@ @ ,@    `? H&`  &` #@+ @ @ۘ , 6@   `? "2@Ѧ 0`Hʦ @Ād¦ H@H  -` `H  K 6@ d@@H &@  K  6@ f KH @@\d`@  K@H? ??@  @H @  K H fa@]  K? HY `@ K@H  @K ,HF  4@6@O  -` H ,6@F H    ?`@ @ ` @$O f@! f@ J @ J`@@  @ H  K6@ \O,      ,㿠 ,p 2 3p?a@ ~ * ` @ @ `㿠`` @i`` `@c`` g@&@Q8 ?@ @@.@ 2 E@ @62 >  ?1((@& 2 2  @-`` "O`&2  !& 2 @  ,``&1 &3`&7- 㿠`` @ ` ``2@`@$` @` @&``* `  ? @ @ !@4 4a    @ @ "@    O@  㿘'`/`;` @    &@=  <93`@@`$@` @ ``H  @㿐;@ `d@@㿠`9+ /`.`JJ@`@ `$@ `  ``@  `@u5 Ē @ <Ē@㿠 t`@'   t` @@   ^v& _`u`%  $@@   `&  & @ @㿠'LL'P'T'X@@(*temporary)=[C]CmainLuatail=(tail call)?localglobalfieldupvaluemethodattempt to %s %s '%s' (a %s value)attempt to %s a %s valueconcatenateperform arithmetic onattempt to compare two %s valuesattempt to compare %s with %s%s:%d: %sanotateXt|`8DThPBX(D<<4`B@4  d|x|xxxxxxxxxxxDxxxxxpp(((xtldebug.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o ldebug.o ldebug.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.793 /var/tmp/lua-5.1.4/srcldebug.c DD% ||` LD,6?PM_jv H  x4D(<t 84Ldl'4T4DhQ^gs X&(@<4`->LWaldebug.ccurrentpccurrentlinegetluaprotofindlocalfuncinfoinfo_tailcallcollectvalidlinesauxgetinfogetfuncnameprecheckcheckArgMode___const_seg_900002002symbexecknamegetobjnameisinstackaddinfolua_sethooklua_gethooklua_gethookmasklua_gethookcountlua_getstackluaF_getlocalnamelua_getlocalluaA_pushobjectlua_setlocalluaO_chunkidluaH_newluaH_setnumluaD_growstacklua_getinfostrchrluaG_checkopenopluaP_opmodesluaG_checkcodeluaT_typenamesluaG_typeerrorluaG_runerrorluaG_concaterrorluaG_aritherrorluaV_tonumberluaG_ordererrorluaO_pushfstringluaG_errormsgluaD_throwluaD_callluaO_pushvfstring   x"  x$ ( ($%<&' D  D D DP)') +  +  *4* H H$ Hx  T T` \d \ H H d d l l L L- - P tX tl//   . 2 .-   $- L P/d/ $ 4$6p'7685 ,|8D4PL\dhltL4  H((4@LXdpt| x  x  cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/034 &h$<0=</JH R sZ#L` e& t( (yldo.o/ 1281148466 0 0 100644 10140 ` ELF%l4(.shstrtab.text.rodata1.annotate.debug_info.debug_line.debug_abbrev.symtab.strtab.rela.text.rela.annotate.rela.debug_info.comment㿠`@`@ +`@ & &`@/@ & & &``@ _?v?&&  0 " @`UU`(>"@ 9`H0p " @ :9`"@  @"  @㿠 ( &  `&  @ @ 66 4. 9Ґ& t& p㿠 p`"@ .  p%4  p@ X@ؒ `X @h'D'H'LD' p'# p@D2@LH&p  #@ : ` "  h@#@  8   2O ( 8@%   !  8` ?  ! 8` ?  ! 8` ?  (O  ;` `@ ? " 㿠5` @ ` ,-  -@& @& & ,-` & 㿠;` (b@ .` 0# (+`.'@.@& (@& (& 0UU &=K 2  (=>`%@,%,&  0* "@)` ( & $ ,@ @ ,+ @ ,@ @㿠 0/ @@   0 .`@ 0@@7@ `' 8 D`@9 9@5`   % '%@''  UU (~#9`J 2 @ : 9` '  $a@@@   @%. 9@ . 9  %` & 㿠`I@     $% &O`J@4& @ D@ @ @@ `@/`   "@`@^@r " &O  @@#\ \: "   @. #@  %`] u %%  &O` @  & &&㿠@   @&@! @ @ \t$$8O\  %@ @@  &  _ u & 㿠``@̒ `  "  @b&@    K"+ 4@  K@  J@ I (`@(@ $ I) &  $ $: ` :6  $@ @2@ ѐ" & " " &  K. "  & " "   @$ *O$ &  8`"@C   `& @?  &    " a@@@  $  2@  &  "   " &  @" "  8 @ @? `@*   '@ 㿠  &@?@  @ 8`"@   $ @ @ 8@   % O @㿠 8`@ϒ $& 耤 & & @ @@`]?v@ &` @*O` @ ?`'```?4O'`&  㿠 4`/ 7`@6 4 4`@%@  4H@ @@@  4&6 4 @ D @@㿠  `@ &`@?"@ . ` `@ @"@   &   `&   (UU'>K 2 >>`%@㿠  `&  @@&&  &@@  `&  㿠 `"@ 4  @! ( @"H 4! Ձ`@%ρ 4.`'6 46 6 %@@ .  @  &` 4  4' 6 4㿠 6 4@.`/@  && . ?㿠 4  ( 9 t&& t@@ @@@6 4 (@&  &   & . 9& t㿠@` `@ `D @@````d@ @ H H@" `H@   @ $```HO  %%  %@@  & 㿈'3'`''   t'@@ not enough memoryerror in error handlingstack overflowncallC stack overflowcannot resume non-suspended coroutineattempt to yield across metamethod/C-call boundaryLuaanotatet t\hd,l0tlD\B (ldo.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o ldo.o ldo.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.760 /var/tmp/lua-5.1.4/srcldo.c DD%t$\&L,3t:XIS @` |g<lt\ }hdxl 0$2`@JS_k{  |D (P\ldo.crestore_stack_limitresetstackcorrectstackgrowCIadjust_varargstryfuncTMcallrethooksresumeresume_errorf_parserluaD_seterrorobjluaS_newlstrluaD_reallocCIluaF_closeluaD_throwlongjmpexitluaD_rawrunprotectedsetjmpluaD_reallocstackluaM_realloc_luaM_toobigluaD_growstackluaG_runerrorluaD_callhookluaC_stepluaH_newluaH_setnumluaH_setstrluaT_gettmbyobjluaG_typeerrorluaD_precallluaD_poscallluaD_callluaV_executestrlenlua_resumelua_yieldluaD_pcallluaZ_lookaheadluaU_undumpluaY_parserluaF_newLclosureluaF_newupvalluaD_protectedparser$ ( 0T X `DT 0 (< ,@ ,D! #$%, <4 <8H&' @ @(l   H" |  " ,* X" "  H  H !  () <, l# ) *4,T-d  \ \ \ H H | |,H  !`1#3 2 2 3 454 X \d \0 ,8$DP\Lhxt`X @   |<|(\4PDH0L$P T\`dhlpt lx4|cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)setjmp.h 1.38 04/09/28 SMI@(#)setjmp_iso.h 1.2 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/034 p0$0a:<Jp R$=Zd eT t!4 !Lldump.o/ 1281148467 0 0 100644 3820 ` ELF 4( .shstrtab.text.annotate.debug_info.debug_line.debug_abbrev.symtab.strtab.rela.text.rela.annotate.rela.debug_info.comment㿠`@@&㿘/ 㿠'DD 㿐'D'HDH?ے 㿠7`6`K ΁㿘@`@`  `'' 㿠 ( @*   ``@@"H `@ "H` ``&O  4`@      @M&O 㿠` `@   0  ` @  8l @    @ ^ @` X&O ` @  $K`@     d&O 㿠 @@  `@  S <, @) H I J K   ,,Q㿐@ 㿈'''''’ anotatex4  0,d(@ ldump.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o ldump.o ldump.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.782 /var/tmp/lua-5.1.4/srcldump.c DD% 44 T $t0/,:dEDSl`Tj(u8@ldump.cDumpBlockDumpCharDumpIntDumpNumberDumpVectorDumpStringDumpConstantsDumpFunctionDumpDebugDumpHeaderluaU_headerluaU_dump ,48TDtP\hDtTl8 cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/034 x4'<3APIDQ  \ k  | 8 lfunc.o/ 1281148467 0 0 100644 4340 ` ELF4( .shstrtab.text.annotate.debug_info.debug_line.debug_abbrev.symtab.strtab.rela.text.rela.annotate.rela.debug_info.comment㿠/` `( @ @ / ' / 㿠/`  @ @ -`% @ -/`%`%`2O%`㿠  @ @ &' 㿠  h@" h` @@ @`:O  `  @ .  @  *   *  " `" '` x"  "  % '   #   "㿠``@  @㿠  h`@) h  @$  & h  @@@@ h֐  ]t $ $ @ h@ h :O 㿠  @ L@ '`'`('`'`4'` '`,'`0'`$/`H'`/`I/`J/`K'`'`8'`'`<'`@'` 㿠` `,/`@ `4`/`@ `(`/ @ `0`. @ `8`-& L-@ `$`-`@ @ ``"@ ` `)` ( +  @ 8 @$`` @  `  6@"@(`8@ `  @ $O``"*`@ anotate4LtD,D lfunc.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lfunc.o lfunc.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.782 /var/tmp/lua-5.1.4/srclfunc.c DD% L&4>LtOD]l,{H@Dlfunc.cunlinkupvalluaF_newCclosureluaM_realloc_luaC_linkluaF_newLclosureluaF_newupvalluaF_findupvalluaF_freeupvalluaF_closeluaC_linkupvalluaF_newprotoluaF_freeprotoluaF_freeclosureluaF_getlocalname 0 d x    @  (       ( |  ,L8DP\hHt@@(|cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/034 4'W<3Ap I Q  \  k  | 8 lgc.o/ 1281148468 0 0 100644 11756 ` ELF+4( .shstrtab.text.annotate.debug_info.debug_line.debug_abbrev.symtab.strtab.rela.text.rela.annotate.rela.debug_info.comment  `` f "hDX(8㿠/``/``&`@@.`ƀ```@/` ` "@` ` `@,` ```@ ``` H```ϐ`H` /` $'` & $ $'` & $ $'`l& $ $'`D& $㿠 0@` ``. 02O㿠  p`@ "@?```"@`2 @ ` `@   `@ @ `/```/``& 0@@'`' 0  0'` 0 `' 0`2O` "@8`"@`2`@ `` @  ``@ `@ ``/``` /``& 0 @@'`' 0  0'` 0"`' 0`2O`㿠` `@  ` `"@`` `@ ` `@ ` @ @'@#@ k2  3p?@ v2 @2? H`./  .```.` ,&`& ,@ @  @ `@/``  `@ `  ` H` ?2O`  `,`@x@0 @, ` `@??2O`f, ` `@ @ ` @  m?2O`H@, ` `@ `@  @  cN?2O`)`@2@?&@  `"@C @  @7?2O`@ @  㿠` `"@`(` `)``(`@  ` &@ `@ `"@``( &O``$ @  `@``@` (``$@&O``4`@  `"@ `` ` "@``@`ؐ`4&O``8@  `@ @ `   -`8 &O`㿠` ``"@`` ` "@```@0 `` &@ `` ` "H````&O` "@````@ `` @ `&O㿠 7 (   0@-#@UU&@ 09 >J 2p 9`9  > .@@ ?  0 $@ -  04<`@-  ,@  ,Z@ ,7 >`@㿠`P`@  H "@  H7  ( @8@   `@*H` `@(O`  @&@ "@ *O@&(O&㿠 $` /``@@ "@`a @- "HA`DZ `& $Ӓ@ ``/```*@ )`*  & $`"@``, `(?,`l& $ ('`l& (` /` z`0`,./`&@. x@& $`$`,`4`$. -`0- `(@, `8+`L*  "@ )`㿠 $`@   $`O  @ ` 2@``( ` @` 2@  `2H  ` @   㿘@;   `@ @?,` ?ƒ `f@#2O  /@`@. `@@ H%2O   2O hPtD\ `!` @$+ @ @ @@@@@    ` `@`  @㿠  ``@-&@(? `@`h ``"@ ` `    ,`  & @@`$ `@$8O `㿠 ? `>:@ <`@$@ <4 ;@<@@<5`?@ 44<@%@4%&<㿠  0` 0@2@`' 0 p 0% p &` p! ` .``@ ` `@   `@ @ 9 @. 9 D-' @ ^u %  $ $  &  # @ . 9' @㿠 `0`@   0O㿠  C?.@`@  @6 &O㿠   "@ ``"@$O㿠 &$&(&,p``"@pppP`&@  pH ` "@ pH `h @  `` @ `Ґ .㿠  x@ @`2@&H ` `"H`2O㿠 ې,&$&, `@( &$&(@ Ր-, .&& .D%&H㿘  `@ `@`"H $`"@ DU `@+`"H? 0N e @V  &  + g?  `   f )  D H @& H  D S (&  2@ D .  D H&@& H!"@ .  Hd(@  d H'`d& H d& L 㿠 5 T D @. L@/`%`' Ld@ @@O "@ H Ld:@ L D' @"$' L D' @z P6 K 2 4`R' @㿘 `   $(`,dd' d&`d%d$d$`-  @B O @6  OHzaP2J10 0P@$@  `@  `  @ *`  ` `*` ("`" (  "`#   *`*`  "`"  `@( `@$ @  + ` @` H ``H` @   ` `+ anotate$P(X<B <BlXBB< $ 0 0$X$D,l8 lgc.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lgc.o lgc.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.760 /var/tmp/lua-5.1.4/srclgc.c DD%((*D0;tXCQ_ \o ` < 8 <D8 XXh%8CJYkzX<l <# 44$>Xlgc.cremoveentry___const_seg_900000201reallymarkobjectmarktmutraversetabletraverseprototraverseclosurecheckstacksizestraversestackpropagatemarkpropagateallisclearedcleartable___const_seg_900001401freeobjsweeplistcheckSizesGCTMmarkmtmarkrootremarkupvalsatomicsinglestepluaC_separateudataluaT_gettmstrchrluaD_reallocCIluaD_reallocstackluaF_freeprotoluaF_freeclosureluaF_freeupvalluaH_freeluaE_freethreadluaM_realloc_luaS_resizeluaM_toobigluaD_callluaC_callGCTMluaC_freeallluaC_stepluaC_fullgcluaC_barrierfluaC_barrierbackluaC_linkluaC_linkupvalH (T (T!P!\!"" # ,$   0%<&H'T(`)**+ *,!@- 2 ,t8DP\ \h `t < 8 D8XXh(4@LX4dXtD|(( , 00<HT`x($cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/034 4':3A` I"pMQ$, \%d k(P |(hyllex.o/ 1281148469 0 0 100644 13500 ` ELF2<4(.shstrtab.text.rodata.rodata1.annotate.debug_info.debug_line.debug_abbrev.symtab.strtab.rela.text.rela.rodata.rela.annotate.rela.debug_info.comment㿠 <``@%` @'@ `- @ `4``@$`@`4$`$``$``/㿠; ``@@ ` * * $Oa@    ` @ 4@ 4` @*` 㿠&a`@  <`@P @`;@ P 4` @@ / 4@ 4@  @㿘 4@ 0 `@ ` d@d@&%㿠  8&@ & 8``"`I` & @ 8&  "@  2H  @"@  8 #@ $  8 % L & @ 8&  3 c@& ;`@㿠 ..`D &`4! &` &`8&`0&`&`&`@`<`<`4@ `<%``<$`8`$  @ $``8` #`K &`@`8&`㿠@ 2@   8%@ & 8 ' N`& @ 8&   <` <``@*`!`*@; J: `8` { ""`)`2OJh㿠@N D@ . O . DN Dې <`@@ N D;!ϔ .`@㿠; ` 8%@ % 8` H` & @ 8&  @ 2G  `."O @` 2@  `_@  k 8 #@ $  8 % L & @ 8&  G _"O N N Ds . < @@㿠   9 8&@ & 8"J `& @ 8&  `=@ ! 8`#@ $` 8` %`M & @ 8&   ="O  ?'@@d@㿠  8 '``@ '  8 ! H& @ 8&  ` @ H``@2@e  [@ @ @@ "@?C [@ ]H0< @! 2G   8$  @"' 8`$`K `& @ [ @ 8'& @ [ `2O   6  8 @  8`"J` `&  @ 8&  [@ ?@2 @L "@K2 [@ ]H + *2G  a 8`$  @ #` 8$L `&  @ 8&  2O  @! > 8%``@%@ 8&   8`  `O `&  ' Ȑ @d [@ @X @: "@9? 8[@]H*8 8ϐ2G   8`%  @%`' 8 `' O` & @ [ @ 8'& @ [ 2O Y ޒ  <$` @ @ 8&   8`"J` `&  @!  [@ @o @Q "@PV 8[@]H O 8m2G   8 "@# @ 8&   8``"`I` &  Q2O   8`%  @ %` 8 `' O` `@ 8`@ &  <,  < & @&`e  <% `%  @ %` 8`$L` &  @ 8&  @! 㿠 B 8 '``@ '  8 `' O` & @ 8&  @7 ` @@ "@ @ \"@ 8 @! @! `&@ ` 8` !`I & @ 8&  `f@`a@ @` @9` "@8< `a"@ `b"H 4 `t@ `f"@ `n"H `r"H  ' `t"@ `v"H  А 8$``@ $ 8``%`O` & i @ 8& d  Z] @   8`#  @ #` 8`$L` & G @ 8& B  -` @ 8)  @'``@ '  8"J ` @ 8  @&  `O-``@! @!p l 8`'  @ ` 8` !`I & @ 8&  2O0  T 8`#  @ #` 8`$L` & @ 8&  <` <`% @&㿠 <7'  .@ "@ ?"@! @# @! "@E '@C -"@ 8w >@ .@A <@ =@l >@ۀ [@o ~@c  ``@  8``!`O` & @ 8&  -@P 8#  @ " 8` $`L & @ 8&  [2@  <@ % Β  <%`  "G  "O  "O  8`'  @ ` 8` !`I & @ 8&  ` "O{  "Ow  ?"Os  8 -_@!@ [`@! 8 #@ $  8 % L & @ 8&  =@ = 8&@ % 8` H``& @ 8& ! 8`!  @ !` 8`&O` & @ 8&  =@ < 8#``@ # 8$L `& @ 8& ! 8%``@ % 8` &`O & @ 8&  =@ > 8 @ !  8`'`J `& @ 8& ! 8 &@ #  8` $`L & @ 8&  =@ ~ 8`%  @ %` 8 ' N & @ 8& ! ! Ԑ 8 ``@  8``"`I` & @ 8& ɐ@ Đ!!f@ @ .!  `@ 8`$  @ $` 8` %`M & c @ 8& ^  @! @ 2@  `_"@   8 $@ %  8`&`M 3& @ 8&  d 8 @  8`"J` `& @ 8&  @ G _"O  < <`@  $@&` !!㿠 &  a@ !^ v ^ (v &  & 㿠 (& andbreakdoelseelseifendfalseforfunctionifinlocalnilnotorrepeatreturnthentrueuntilwhile.....==>=<=~=lexical element too longchar(%d)%c%s:%d: %s%s near '%s'chunk has too many linesmalformed numberEe+-unfinished long stringunfinished long commentnesting of [[...]] is deprecatedunfinished stringescape sequence too largeinvalid long string delimiter.anotateX\4|B`xhx8P llex.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o llex.o llex.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.771 /var/tmp/lua-5.1.4/srcllex.c DD%l4%3,x>hJ xVc l}8(  |X\ 1,`@LVdkv$Ptllex.cDrodata.rodatasavetxtTokeninclinenumbercheck_nextbuffreplacetrydecpointread_numeralskip_sepread_long_stringread_stringllexluaX_tokensluaX_lexerrorluaM_realloc_luaM_toobigluaX_initstrlenluaS_newlstr__ctypeluaX_token2strluaO_pushfstringluaO_chunkidluaD_throwluaX_syntaxerrorluaX_newstringluaH_setstrluaZ_fillluaX_setinputstrchrlocaleconvluaO_str2dluaX_nextluaX_lookahead4 8 @l|      $ , @ P \ `  !      "$<X%&@&h l p#&4(&)H*` ,p ,t  & @ @&*\&&@&h Ht H| H , x 4 x T d& l x t x | & &  (&  x  x 0 @& H x P x X &  & &T$&8&P T X ` &&&&( , 4&&$0 4 0&&@&  &t&& &p&&&x&&  &X&&$  $, 0$<(@,D0L4P8T<X@`DhHpLxPTX\`dhlptx ,8DlP\h,t,  ($t@ P$pt cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)libintl.h 1.16 04/09/28 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/034 h"$,8 ;D R! Z#b%l  m+0t  z,D  -  .:lmem.o/ 1281148469 0 0 100644 2732 ` ELFx4(.shstrtab.text.rodata1.annotate.debug_info.debug_line.debug_abbrev.symtab.strtab.rela.text.rela.annotate.rela.debug_info.comment㿠7 =&@ @ @?/   d? w@ @ 67 K@ K @&@&㿠;@` 㿠 `` @@@ `D&&`Dmemory allocation error: block too biganotate< $Xlmem.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lmem.o lmem.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.771 /var/tmp/lua-5.1.4/srclmem.c DD% $X2>lmem.cluaM_growaux_luaG_runerrorluaM_realloc_luaM_toobigluaD_throw0      ,8H cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/034  ' L$X0;<CJ\ RLIZT e< t( @8 lobject.o/ 1281148470 0 0 100644 5996 ` ELF4(.shstrtab.text.rodata.rodata1.annotate.debug_info.debug_line.debug_abbrev.symtab.strtab.rela.text.rela.annotate.rela.debug_info.comment  @ `2`O``+` e@ :  `  `?* d@ ! @?2 !:O`  `  @  ``@ `"@) `"@```@`"H`` @b` @1 0?`` 3 2p?`  1` 0?C0㿘@>`@2@ J``x@JX2H@ #\ "\D>`L` 2@ M`' @@  'N  2O O f@㿠  @@' '   &`@@  & 㿀; `@ %@~   &@% %   # @@  `& Nf@ %@Oc"Hd"@ M %f@)p"H:s@E %`d@E //= 8   &@ @@   & +  :"  " `@@   &   @w r  / N//h@ %2O ^   / &=`=`?@ $&   㿠'L'P'T'X@L㿠N``=@ `&@.N`; @@``&@@@%@@@&@g@N@@ @@@@(null)%p%... [string ""]anotate`H(4`|,  lobject.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lobject.o lobject.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7:4 /var/tmp/lua-5.1.4/srclobject.c DD% 1`  9IHUX(a4k||x, "*lobject.cDrodata.rodata___const_seg_900000502pushstrluaO_nilobject_luaO_int2fbluaO_fb2intluaO_log2luaO_rawequalObj__ctypeluaO_str2dstrtodstrtoulstrlenluaS_newlstrluaD_growstackluaO_pushvfstringstrchrsprintfluaV_concatluaO_pushfstringluaO_chunkidstrncpystrcpystrcatstrcspnstrncat     D H   HpD T   !"$"4#L!h$t""" ,X8DP\hxt$  cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/034 hx/", X8 >D OR hP Z 2b   m  |8  P lopcodes.o/ 1281148470 0 0 100644 2972 ` ELF 4( .shstrtab.rodata.rodata1.debug_info.debug_line.debug_abbrev.symtab.strtab.rela.rodata.rela.debug_info.comment`qT`Pql1  0@  { }@+ a@`[@@ `=@ C ?Β ,Gڐɒ ;2O  } {1?ܖq@/`* ` .@ $@@*  +  @ 㿠 0 / J`)@5 7  ,a@a@ Ő` J@@ `/ J J/ J J@ J@h2O  2 J`&/ I 2@`ĺĐ' <f (@ -@ ה  S )@ !Ĕ! ' @Oʐ2㿠@ " , ,@ 0@ @ڒ2O 0㿈 0  (@{@$"@' O9 @ @@@ `)@' Ɛ@? ) ( `Ԑ`'@`耤 @耥 @ 耥@?@ $&`?` @  @$ $ @㿠 `(@a@; @@f ) ( 0@7`@p 0  [@ (@0 .H :H [@ {@$!"H#Œ @͐@ @@P @H 㿠 a@a @`{@Ra"H3a @Ma "H!a@a@a"H( 0a@a"H   p  >`@o@ d @ ^ @ Y @ J`@/@  %  J.J@ A @@  !"@   -@`#  f@  !@' /@ +@ %"@N  *@?I  +"@F -H5A  >@ /"@<  <H57  >"@4 ^H'/ !@!@ !"@( !H## !"@  !H !"@ !"H !H         㿈 U @@ 0@ @#%. @@ @0@ѐ0@@. O44'`64 !@"!`@   !"@ !H  㿐 0 @Ð 㿘 0 $@ ` 2@``@`&` ` `d@d@%``2O``@  $  @ @h``@` H`@ߒ ,@"'C耢@ 4 4# @   4# 4 0$`ѐ 0ϒ ="H 0]$H 0 0&`$%`$ 0 $  0`@@ 0`@㿀O` `d@& 0@㿠 0`@ ` @ `` ``@` "O` `@5@ @` # @ @`@㿐 0@@/ \!!@@!!U'@㿈 0@   @@ǐ!!8`@  0@ 0@@ 0@㿈`0@㿐 0 ! @  @@ |@@ @  @  ! @@ @`@`@?㿠 0`  $@ ) ` @ ! `@    = ,~v ,@v @ $@@q㿈 0` $ ,@  `@ ۔ `@ Ӕ ϔ : ,@pÔ`-O=!  Β @ & 㿐 0 @D `=@ `,@ a @  ;X `@!! ې㿠@T!㿘 0?' @@@@ݐ O @@@@@@@!! p 0֐) $ג @ 4  А/ @2/``-&-$`㿈  , gOa =@2' 㿠 `.@ .O`:@ p@і 0@ 0@㿀 0耧` @/+/ ` @- $@' 㿈 0@ @6  ;@1ʐ耤 @耤@ @@"@2@?耥 @ 2@ 2` /`  %@2?  @`xxxxxxxxPxxx㿠 5 %@C.@@Ò B @n!! v R K @v! @Ԑ  h @ A 㿠/"  @ ;L 02 0@%$`O 4 4'`7 4 '%s' expectedmain function has more than %d %sfunction at line %d has more than %d %s'%s' expected (to close '%s' at line %d)too many local variableslocal variablesupvalueschunk has too many syntax levelsconstant table overflowitems in a constructorarg or '...' expectedselfambiguous syntax (function call x new statement)function arguments expectedunexpected symbolcannot use '...' outside a vararg functionsyntax errorvariables in assignmentno loop to break(for index)(for limit)(for step)(for generator)(for state)(for control)'=' or 'in' expectedanotateh,$<0hB(B |B((X`hp\`H@(TBTT@0BX\BptBp B<\H0BxHB0$B4B8dPt  B<P X0\plparser.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lparser.o lparser.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7:4 /var/tmp/lua-5.1.4/srclparser.c DD% #<0L0?|hJ(S Y<cT|o(}(8P,X`hLp\8`\H <@%|(0T;TG LQ HT\+|b@h\0ot}\XT\h@pt$p 4<\ HX0+0x6H;EO $Z 0_!($g"P~"X#l4$%H8%&p''d(P(lt( )P*@<  "3DR\iw(4 @GTbr *8BN\kxlparser.cDrodata.rodatapriorityanchor_tokenerror_expectederrorlimittestnextcheckchecknextcheck_matchstr_checknameinit_expcodestringchecknameregisterlocalvarnew_localvaradjustlocalvarsremovevarsindexupvaluesearchvarmarkupvalsinglevarauxsinglevaradjust_assignenterlevelenterblockleaveblockpushclosureopen_funcclose_funcchunkfieldyindexexprrecfieldcloselistfieldlastlistfieldlistfieldconstructorparlistbodyexplist1funcargsprefixexpprimaryexpsimpleexpgetunoprgetbinoprsubexprblock_followblockcheck_conflictassignmentcondbreakstatwhilestatrepeatstatexp1forbody___const_seg_900005701fornumforlistforstattest_then_blockifstatlocalfunclocalstatfuncnamefuncstatexprstatretstat___const_seg_900006801statementluaX_newstringluaX_token2strluaO_pushfstringluaX_syntaxerrorluaX_lexerrorluaX_nextluaK_stringKluaM_growaux_luaC_barrierfluaK_setreturnsluaK_reserveregsluaK_exp2nextregluaK_nilluaK_codeABCluaK_patchtohereluaK_codeABxluaF_newprotoluaH_newluaD_growstackluaK_retluaM_realloc_luaM_toobigluaY_parserstrlenluaS_newlstrluaX_setinputluaK_exp2anyregluaK_indexedluaK_exp2valluaK_exp2RKluaK_setlistluaX_lookaheadluaO_int2fbluaK_fixlineluaK_dischargevarsluaK_selfluaK_prefixluaK_infixluaK_posfixluaK_setoneretluaK_storevarluaK_goiftrueluaK_jumpluaK_concatluaK_getlabelluaK_patchlistluaK_numberKluaK_checkstackDST XThUl tV  UUWXLXTT \ \UVXY|  Z[H L     Zx[Y^]_\,]\ d lW`a $ 0 8Z [ b (` \c d e ,e tf g h g h Hg Xh g h g h Lg \h j k l X(m0XLn`Xxo  p,pH`t^q^q \8qx  ` ^Xrs,s  XS,V|] 8 8Sx^ t @ @VX8\|X^`t tVD LXxu Vm8nHXdv^HX\XpXXX  V`X XX$wT X xXxy` ]@ T X \V  x{z{|D H LVl`t}~X} a , XX  a } !^!`b!t}!]!a!b!`" t"(}"<"`  "h  "xS"S"S#8#Lb#X]#t 0#| 0#S#S#S$x$X$ \% \%V%LX%}%~%a&}&~&a&$X&@~&La&]&{( X(P{(\t(X)Hm)\^)x\)f*H )*P )*X+X+PX ,L8|DP\<hTt8P,L8\<(|4@L LX Hd p|\\Th@$ 4$0<HTX`l0x $ !(#l$%H%&p''( (l,(8+|H"XP"PX*@`)l"Px)Dt,L0H,l |x (H\p  #d *h$)POcg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/034 ,,,q"/dx,384>D4R40 SZ=bB  mM<L  |R  Rylstate.o/ 1281148472 0 0 100644 4716 ` ELF84(.shstrtab.text.rodata1.annotate.debug_info.debug_line.debug_abbrev.symtab.strtab.rela.text.rela.annotate.rela.debug_info.comment㿠   @ & (   - (& & 0 0 (.&-@% & $@"& & , &  , , @# `&   "`  & !    &   a@' 㿠`0`(/ '@/`@ `,` . @㿠  H @ '` '` / @  `&`&`@ @@@   * D- &@"  " " ," p" D* 8" <* 9 <" @" h" 02 62 4* " " (" " t" P㿠  @@`4```/ @ 4<@ &!x&<  㿠  @ x@  N^ HvH P&P 8.8 <&< D&D<&@㿠`  x @k@㿠  !x@`x '`  !/` x/` ` /` ```/`$ !x $   $ p$ $ $ @$ $ $ `$h$ 4$ <$ X, $ $ $ $ $$ ($ ,$ 0$ D$ P$ T$ L"$O"9 @ @l @㿠 9 `p @@ & t (&  `& & 6 66 4@ 2O (Enot enough memoryanotatex<X|,8 Bt  lstate.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lstate.o lstate.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.793 /var/tmp/lua-5.1.4/srclstate.c DD% < )X7C|  O]fr||,48tlstate.cstack_initfreestackf_luaopenpreinit_stateclose_statecallallgcTMluaM_realloc_luaH_newluaS_resizeluaT_initluaX_initluaS_newlstrluaF_closeluaC_freeallluaE_newthreadluaC_linkluaE_freethreadlua_newstateluaD_rawrunprotectedluaC_callGCTMlua_closeluaC_separateudata\,H Phpx  DX,8  @  D | | ,8 DP\ht4|,  cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/034 $0F=<J R !Z \ e  t   8 lstring.o/ 1281148472 0 0 100644 3460 ` ELF |4( .shstrtab.text.annotate.debug_info.debug_line.debug_abbrev.symtab.strtab.rela.text.rela.annotate.rela.debug_info.comment㿠 ` @@` c@ .` @  @ `@  $ `&O"``@  ` "@ ` -"# 2O ` &O```.@ $`$`㿠@@ @ "  " @   *  * *  @, , @ '`" ` @ 7@/ @㿠6` @ K6 .@ @ O    , @ @ @ @@ 2O    `@@ / 㿠@@`  @  ``* `* " " "  p`"   p%`anotateL0| lstring.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lstring.o lstring.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7:4 /var/tmp/lua-5.1.4/srclstring.c DD% -9@MT|lstring.cnewlstrluaS_resizeluaM_realloc_luaM_toobigmemcpyluaS_newlstrmemcmpluaS_newudata4 H  , @    ,  ,8DTXcg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/034 <\'Q>3A IbQx \T k |yltable.o/ 1281148473 0 0 100644 9516 ` ELF"4(.shstrtab.text.rodata.rodata1.annotate.debug_info.debug_line.debug_abbrev.symtab.strtab.rela.text.rela.annotate.rela.debug_info.comment㿘'H7'LH@@ H@  `` '$O   - $@ @H.` t@W@$@.` ` @@"@$ 6 @"H  /  `*   (`   )@ ?( (@ " @ H(` r Q@ "(`  +@ !`@ @ `H* pS@ *   `@  DDP#\\`?`㿠`@?@`@@ @@` 2@ ``&H``@ ``O`9 @ ``'@= =`㿠”` @/ ` ` @ ` &O` ` #\ / \>&` _@v& `` ' )@ @ ) `  @  ` )@&O``) _v`&`_v`&  ` `@    `@ 1` @ : ff `@  )``1`@ ;  &O "`㿠D@/@@ @* ``&  㿠     ` @`@@- `   ={$O` ```, &``O 㿠   /@@ ,`@ 2O&㿠;c@ .` `-`@&` @&` `@ -` %&O` &`㿠@#`&` +.`@  @ %@.+c@. @ @@&` ` % %%&O`.``.&`㿠```@@)@$.  @  @_ r  " O!# @/` .@$ @$  - @.`@ `@]`r `" %` 6O`;`@@, @`` @  ` )@ 0'  ` $O%`'̐'%y㿠   @ @ ' / ;' `' / ' #㿠``@  ``--@ ` ` . @ @ # "   @  ` @ "`  @ 8O   㿠Y @! @ 2@-^ڐ@y@`C@@@2O&_`w _`w _`w _`w '`'`^`' '`^w`'` @ @ `H@㿈 @.` %`#pp#`#d;h`dh 2@`` B#h``2O`7  ` +  @ ) ` 2@``@ 2H``2O`` 㿠`@ @ "H `5`@B#\`Dp\@ @@   O ;`㿠@`@.`@/@/@ @H9 @ 㿀9@ @#\ \?' 㿐9@ @' '㿠`@ `@#7,`@ @ O,`$@@   `"@$@  2O$$@ @@6@ f@d@$@`O@ `@"` +`@`@ @ 2 ! )``; yTyD"@ O@   ` H  invalid key to 'next'table overflowtable index is niltable index is NaNanotate8,L@<PB|`8x`d4h`T  (ltable.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o ltable.o ltable.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.793 /var/tmp/lua-5.1.4/srcltable.c DD%  $;CLP$@[derP{`|`  d \4  P<&2`>XG T8X xak `u  0h DTltable.cDrodata.rodatadummynode____const_seg_900000101hashnummainpositionarrayindexfindindexcomputesizescountintnumusearraynumusehashsetarrayvectorsetnodevectorresizerehashgetfreeposnewkeyunbound_searchmemcpyluaO_rawequalObjluaG_runerrorluaH_nextluaO_log2luaM_realloc_luaM_toobigluaH_setnumluaH_setluaH_resizearrayluaH_newluaC_linkluaH_freeluaC_barrierbackluaO_nilobject_luaH_getnumluaH_getstrluaH_getluaH_setstrluaH_getn  @  4!"#  $ 8!P T X"#t$"# % , 0 D" X \ 4" H( ` h   " " " |  % * + $+ + + + + -,@+ D+ `.h+ l+  ( ( < <+ ,+ L+ P-X+ ,,,,X,   ,$8dDPP\h`t T     \  0 X(D4@PXdtx D|    0cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/034 8 (O"x,8=DR  Z0bl  ml  |@  Xyltm.o/ 1281148473 0 0 100644 3716 ` ELF 4(.shstrtab.text.rodata.rodata1.annotate.debug_info.debug_line.debug_abbrev.symtab.strtab.rela.text.rela.rodata.rela.annotate.rela.debug_info.comment㿠 ` `@ `@ ` &`  ` ,$O 㿠@ `@  /@  . ``@`"@`  `` ```*``@ *   @`nilbooleanuserdatanumberstringtablefunctionthreadprotoupval__index__newindex__gc__mode__eq__add__sub__mul__div__mod__pow__unm__len__lt__le__concat__callanotate<D$t@ ltm.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o ltm.o ltm.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.760 /var/tmp/lua-5.1.4/srcltm.c DD%  ,%t/6Ct@NZjltm.cDrodata.rodataluaT_typenamesluaT_initstrlenluaS_newlstrluaT_gettmluaH_getstrluaO_nilobject_luaT_gettmbyobj ,  , ,,|08 @   (0 <$D(L,T0\4h8p<x@DHLPTX\`dhl ,t8H0 cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/034 Dp"pL,8i:DR@ Zzbxl  mP  z4<  p  ylundump.o/ 1281148473 0 0 100644 6036 ` ELFd4(.shstrtab.text.rodata1.annotate.debug_info.debug_line.debug_abbrev.symtab.strtab.rela.text.rela.annotate.rela.debug_info.comment㿠 ;  @` @㿠@ @;`㿘 O㿘 `@;`֐㿘ٔ 㿘є `2@   @Ò '`@㿠ΐ; c@    / @&` @ / &` &`,` 㿠; c@  - @ &`@ &`@ &`(`  @  "``&O`@9  `   ` @ "@%%  @  @ Hp2 3p?% % `~= %  `% % `C`&O`\% @  /` @ &`@ &``@ &`4  `%@ &O``@   ` @`%&O` 㿠-; c@    -`@&`@ -`&`&`0`UU aU@ -  (@ &`@ &`@ &`8  ` "@` &O`@  `#`@ # `@ ` "Oܐ' @@  ,  @ &`@ &` @ &`$  ` %`&O` @   и `&O㿘  4`.7`@7 47@   "`"` `   `@ @   $ '` `` ` d@ # '`<'`@u/`Hr/`Io/`Jl/`K<@@'B &`%  4& 5 4㿈@; @ @;`&㿈N`@@N =@`Nf@d@%`7$'''';'А`@ p㿠 #\; Q` @ .  . K\. . . . . . %s: %s in precompiled chunkunexpected endbad integerbad constantcode too deepbad codebad headerLuabinary string=?anotatel,4 < hd dPX lundump.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lundump.o lundump.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7:4 /var/tmp/lua-5.1.4/srclundump.c DD% ,,4` $<, 7hBDdK Ydfp(P {Xx"lundump.cerrorLoadBlockLoadCharLoadIntLoadNumberLoadStringLoadCodeLoadConstantsLoadFunctionLoadDebugLoadHeaderluaO_pushfstringluaD_throwluaZ_readluaZ_openspaceluaS_newlstrluaM_realloc_luaM_toobigluaF_newprotoluaD_growstackluaG_checkcodeluaU_headermemcmpluaU_undumpmemcpy   $8H L  , , 4x4 8L 8<L dt<L H H8 X X0P ` dd d x x  $ p, p4" ,,8`DP\hDt(x$Pcg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/034 l 0 $ 0 A>< J 0 R )Z e t ylvm.o/ 1281148475 0 0 100644 15948 ` ELF<4(.shstrtab.text.rodata1.annotate.debug_info.debug_line.debug_abbrev.symtab.strtab.rela.text.rela.annotate.rela.debug_info.comment㿘  @`2@ `@@ >`&` p``"@` ';'` @@@&`&` 㿠 8 `@ &  @`@ < & @@?`@+  `  &@ :`  :`?@ ) @@@  @  '>`H @㿠 &@ ^w`'` ^u`%` _ t  $(  $0@@  0&  " 0@   !`&  X`p`#㿠 ^`w``'` ^u`%` ^t $( _ t`0 $`8  "@@ @  `@&  !`@@㿠;` `@&`@  @``@ ``  @  ` `@ `2H`] v` &`@  @@`@ d&O`@f㿠;`  ``@5@ @`@ `` ` @  `  `@`2H#`_ t $  @  @` H@@ @@`@ ``d&O@:㿠@ `@@`@  㿠@  ` ,@@   .@ @@ @@ ` -@@  ` .@ @`@ @f@㿠@ `@?@@@?  `@ `2@   @  㿠  `` @@@@"@? &@%O d@㿠`"@`@@`a `@`2  ?H@㿠`"@`@@`c``@ `: #3p?c ?@Y ?H d@@HpT㿠`9 @_-@ `@b``5` 2? `@6 3p? `@ `` Ӗ ` @ `– @   @  ` 2@  `@  `@4 3p? 㿠 ?  . 耣@ 耠`@ % @%@2@% %[@S@O? 2@ 耡`HF?% @A?` `@ ` @@@`$ @@ %`&O`  `4@ @- %  @  @@`6O @%' ' ?&@&`4O tP(@@N@@I%`'  @N.@ B>`&` >`&`  B>`&` ¬ >`&` ;x ;#p#tp@tx B>`&`#h #l#`#d`hl@d>`&` >`&`@@<h4 x,|P  p ( t  x PD`t`C0#\  #` ##d   )?`    ` 8 @ @@& @ 8`H5  `@ 5 $& 5  ` ?-`%@Gݓ*`@@5  !(X@v`&5  *`]v &5 a&d&5 f@5 a)`@#`#`@ G#`5  ' Xv& 5  '-'@& @ 5 &  5  ( (@@+`@f@@  5  '* '& @ s5 g`^u%&Gf"Ga ` "G]@X5 & 5  a)`- @+@ `@ a-`f@f@ @ =5 a5 @ a@@&&&  @ D *G& @ "5  !+ 5 ]@)`v@`-`&& f@@  5  a ` a- -@ 5 f@- `*`@f@`2@ & `2@ & U>&C  5  -`* @ 5  ! f@ !- (`@@f@ 2@ & `2@ & >&  5  a ` a-`.`@5 @ ! f@ !- (@f@`2@ & `2@ & T>&  5 -`*`@5  a `f@ a-  -@ f@2@ & 2@ &  >&hŘ  a5  ! !-(`@5 @ f@ * `+ @ f@ 2@& 2@& I;;x#h#lh@lx [H>&3  ,5  - (@ 5  a `f@ a.``+`@f@ 2@&  2@& ''''@>&^  5 a+`@ 2@& >& H  5 (`@`@ @ @  &d&&d&5  + @@"@ & @#xx>&` `"½\>& 2G `@ 5 &  !5  !%@@ @ D@ @-@ ^@@u@ %}5  .` v5 &  .`*@ 5  ! !f@) @ -`f@`@@  @@ @ @2@  5 ( G5 & 5  !+* @.`@ `  !-`f@ f@@2@   5 ) #5 & 5  ! !(` !(. @@ !+`f@@f@ >2@  5` *``"@  `2@  @ 5  5  "G0@-5  !*`@  @   2@   `@ 5  5  a@"GɦZ v &0` . 5 p a `+`f@  ! 5 &  @"H\ "H#\ &G  &  5 p (f@% & @?"H  "H6 $ h`"@``@`#`<`  '`&  @ \q`!``  *O\-@& '` '` `'`  `& F N5 p a ,f@  "!  h@@& @\@ #\"G)  `& $ 3 ` @V+W!5  +o5 > &>0)`&8&  @  @@`@@ @@@`@ @@  @`5  >&. ^ `0`0vP(&X^v@&H^v05  !&8& & @  @`& `"G[`s`#6 @- 5 5  a@   %8``& 8`?2@ G*# Ι+`  *@ @@G-@^`r `" ``@ `@ @@Gi&`@c5 @-  H @@"    ?`2@ 1`   % `1 `(@@%@&O&`&&  @ `D*G, @ ( 5  ! @;` I @; @"@& -   %@@@@ @& `G @ - 6@ &# [@@v &`@G @%.14gindexloop in gettableloop in settablestring length overflowget length of'for' initial value must be a number'for' limit must be a number'for' step must be a numberanotate<$ll$BhBhBBB0BBB$  ,(0Tppx$ 8Ph0XlPHP  X x <0 lvm.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lvm.o lvm.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.760 /var/tmp/lua-5.1.4/srclvm.c DD%"h-8EN X o  P lll $$/?N\<hjst  &3AMV`jwlvm.ctraceexeccallTMrescallTMcall_binTMget_compTMcall_orderTMl_strcmplessequal___const_seg_900001401___const_seg_900001601Arith___const_seg_900001702luaV_tonumberluaO_str2dluaV_tostringsprintfstrlenluaS_newlstrluaD_callhookluaD_growstackluaD_callluaV_gettableluaH_getluaT_gettmluaT_gettmbyobjluaG_typeerrorluaG_runerrorluaV_settableluaH_setluaC_barrierbackluaO_rawequalObjstrcollluaV_lessthanluaG_ordererrorluaV_equalvalluaV_concatluaG_concaterrorluaZ_openspacememcpyfloorpowluaG_aritherrorluaO_nilobject_luaV_executeluaC_barrierfluaO_fb2intluaH_newluaC_stepluaH_getnluaD_precallluaF_closeluaD_poscallluaH_resizearrayluaH_setnumluaF_newLclosureluaF_findupval4   ,L  4 L !"#$$@ \ t&!('<"\#$""h!!($"P"\() <)+ + (+ +    P.   8  8  $ / `0 |     12@3 P P4p%6H%h7t789\142\:  4 4  P P# -09,*; ;h<P<`=   ( 8 ` < ` @$ ` p t x$    $!4"$>"H?"'"<"@#PA#9$ ,l8DP\h<tt      P   P(,0$448(<@DH L (P X (\  Pcg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/034 $%X&L$(h0):<)OJ)h R-Z0Td e5 t7 7_lzio.o/ 1281148475 0 0 100644 2964 ` ELF 4( .shstrtab.text.annotate.debug_info.debug_line.debug_abbrev.symtab.strtab.rela.text.rela.annotate.rela.debug_info.comment㿘   @@@ '`& &  & N`?㿠 `2@ @?2@ ?&  &`&  O` "`"`"` "`"`㿠@@?@ @@   @@ @&&  & O 㿠`@`  e@`@``@&`@&`&``anotateT<`XBdlzio.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lzio.o lzio.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.771 /var/tmp/lua-5.1.4/srclzio.c DD%``X!+5<ddKYlzio.cluaZ_fillluaZ_lookaheadluaZ_initluaZ_readmemcpyluaZ_openspaceluaM_realloc_luaM_toobigt  ,  ,`8DPd` cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/034 d';3A IeQd< \T k | y lauxlib.o/ 1281148476 0 0 100644 13932 ` ELF484(.shstrtab.text.rodata1.annotate.debug_info.debug_line.debug_abbrev.symtab.strtab.rela.text.rela.annotate.rela.debug_info.comment0;@ @ `@@@2@ @`@```(d@`,%@㿠;@@`@@㿠@@8;@@`@`@@ @ 㿠'L'P'T'X@ L@@ @㿠@ @ @ @ @@  2O77@@㿠;?`@@?@ @? @ @?`@ 㿠@@@@9? @?@?@@?@ 㿠@@;`@㿠@@J㿠@?@;`@㿠@@1 㿠@@ @@ @&@㿘;@`;` B@ @@ `㿠'L'P@@LP@㿠@@ @@ 㿠@@@㿠@@ @@?@?@@? @? 㿠@ 9? @@@`@@@ @ @   @ `@    `2O 㿠?@3'@!? ?@ @@ @@?#?`@@%@@??@@?@@?'  @@ O@@O @㻐@@@@%@@@O%@@?@ 㿠?@?@ .@%@%@@@@@M   .d@@ @@@?@ @ @M  `.Oʐ @?㿠  @2@  @&  `&  㿠 `@!  ? @?@ %` @(@  `@O@ '& 㿠ɐ@Ԑ 㿠@&$  *@ @ & N``'`.2O 㿠@@㿠  @ & 㿘  @? 'd@ @ @& @?{@@? & "`` "`"`㿠@ 7?@@ @@?@@??@ @?@?`@ @@ @ @㿠@@ 5?@@ @ @ @@㿠``@ &`+&`` @ `` @$& g㿠;@`;@  `@@ 㻘@9`'  @ @ `' @ @@' ρ`@l$` %  `#@ ' @c' ` `@` 2O` H ``@V!`" `@`@ @@'@F#$ @`2O' $@?@ 7@` @ @`@ @ ,g@@`#@@`@``2@` ""``㿘';'`@㿠@@㿠@@ @㿠?@ ;`;@` 㿠;`@ @;`@bad argument #%d (%s)nmethodcalling '%s' on bad self (%s)?bad argument #%d to '%s' (%s)%s expected, got %sSl%s:%d: invalid option '%s'stack overflow (%s)value expected_LOADEDname conflict for module '%s' cannot %s %s: %s=stdin@%sropenLuarbreopenreadPANIC: unprotected error in call to Lua API (%s) anotatet8B@xLt0,04L8H,pt4T@(B\B(||TB(,,44T  Dlauxlib.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lauxlib.o lauxlib.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7:4 /var/tmp/lua-5.1.4/srclauxlib.c DD%  ,44 @@ ,L |Q<TY$(^,f4 lzL@(x+XL;$4Mt_lw0, 0)0TAN[8j<H|,p0tT(9<C 8QX \h Xw p( (  \ D| @"06?GNW^L,nx~4lauxlib.ctag_error___const_seg_900001401libsizeemptybufferadjuststackgetFerrfilegetSl_allocpanicluaL_argerrorlua_getstackluaL_errorlua_getinfostrcmpluaL_typerrorlua_typelua_typenamelua_pushfstringluaL_wherelua_pushlstringlua_pushvfstringlua_concatlua_errorluaL_checkoptionluaL_optlstringluaL_checklstringluaL_newmetatablelua_getfieldlua_settoplua_createtablelua_pushvaluelua_setfieldluaL_checkudatalua_touserdatalua_getmetatablelua_rawequalluaL_checkstacklua_checkstackluaL_checktypeluaL_checkanylua_tolstringstrlenluaL_checknumberlua_tonumberlua_isnumberluaL_optnumberluaL_checkintegerlua_tointegerluaL_optintegerluaL_getmetafieldlua_pushstringlua_rawgetlua_removeluaL_callmetalua_gettoplua_callluaL_registerluaL_openlibluaL_findtablelua_insertlua_pushcclosureluaL_gsubluaL_buffinitstrstrluaL_addlstringluaL_addstringluaL_pushresultstrchrlua_settablelua_objlenluaL_prepbufferluaL_addvaluememcpyluaL_reflua_rawgetilua_rawsetiluaL_unreflua_pushintegerfreaderrnostrerror__iobluaL_loadfilefopen__filbuffreopenungetclua_loadfcloseluaL_loadbufferluaL_loadstringfreereallocfprintfluaL_newstatelua_newstatelua_atpanic $ 4LX h h 8 |<L |Xx !# $@l x | &'()*,,-H&X.l'0     03`4$ 6 745H:\79-=>'?PAh<)BD   E0&<P'hEx | )*?F)G*4'@4TI`JxKLJLM3)N 4  (> 4 H' h( x ) O  ? '  PP `P  Q \4 hK  3 S ' F |A  ' U : ' U V P $V lA U V X V   Y@Z D[HZ P \3h t?A  \ \ ^`4aD3L X \b|c'?____T $d $hb|4dfg3\ \  8h 8   j  $ (k ,8 D(P\ht$X<0<(4 @ ,L X d Xp p|  8 \ D <$Lx $0@D HLPTX\4`dh4l hp tx(|cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/034 8jl$0><J RZ#| T e, t/ /Z lbaselib.o/ 1281148477 0 0 100644 19244 ` ELFH4(.shstrtab.text.rodata.rodata1.annotate.debug_info.debug_line.debug_abbrev.symtab.strtab.rela.text.rela.rodata.rela.annotate.rela.debug_info.comment㿠@79? @`@(` ?@@ @ @ @`@8@`@@?@O< @<@ C0H @ @ @ @ @F@''@  @ '`"@ @ @@&%M  @`@ 'M `2ONH#h9 hF#`#d`d@ @ 㿠 @ @  @ @ @ @@@ @㿠 @ @ @;@ `@ 㿠 @  @  @` @` @ @@`$@@ @ 8@  @` @@ @ @@3`@ ;@@`?@ @@?@ @㿠ƒ @?@;?`@ @? 㿠 @  @ @ @@ 9 B@ ?@@@ @?@@?H;`@ 㿠@ @  @ @ 㿠 @ @ @ @  㿠 @ @ @ @ @  㿠 @ @ ?P㿈;`;` @  @ / @@"@#p @ #p+#t`ptHL#h#lhl@ @ p#`#d`d@ 㿠@ @ @@ 㿠 @ @ @ @ @ 㿠 @ ;?`@@ @ 㿠@  `@ @ @ @? d@㿠 @ ;?`@@ @  㿠@ @@? 㿘@  @ @㿠  @ @ԁ㿠;`@ @  @ @?@& @?@@  @;`@ 㿠;` @  ;@ @ ` @㿠  @ @@@@ @?@"㿠@ @ @ ` @ @@㿠 @  @ @  @@@ @ %@@@H9@@ @@O9 @㿠@@   @ @ J `#@?@ @@f@;`@'㿠@ @??@ 2 3p?`@@ @㿠@ @ @  ?@ 2 3p?`@@ @㿠;@ `@  @C@ @ @& @) @ "H "@ @ @ @ 53`f@@ 7@  @;@@`@ 㿠 @ @ @ @3@ @ 7?@ @?@ @@ @ ;?`@@?@? @;`@ @@  8@ @ "@  "@ @ @ @  d@㿠@ @3`@ ;ђ* `@ 㿠;Œ@@`@@ 9- ?@@@@@ @?@ @ @@@@㿠@ @;`@ @?@ @ @? @ ?'@@ 㿠;?`@@@@?@ @ @?@ @㿠@@   @@H;`@@@ 㿠;`@  㿠@@㿠@@@ 㿠@ @ ?@㿠;?9`;`@@ @@  @/5-Ӑ+ `͐ @ ?@?'@(@ ,@@ 4@㿠;`;`@ tostring'tostring' must return a string to 'print' base out of range__metatablenil or table expectedcannot change a protected metatablelevel must be non-negativeinvalid levelfno function environment for tail call at level %d'setfenv' cannot change environment of given objectstoprestartcollectcountstepsetpausesetstepmultoo many nested functionsreader function must return a string=(load)%sassertion failed!too many results to unpackindex out of range__tostringtruefalsenil%s: %pboolean or proxy expectedassertcollectgarbagedofileerrorgcinfogetfenvgetmetatableloadfileloadloadstringnextpcallprintrawequalrawgetrawsetselectsetfenvsetmetatabletonumbertypeunpackxpcallrunningsuspendednormaldeadcoroutine expectedtoo many arguments to resumecannot resume %s coroutinetoo many results to resumeLua function expectedcreateresumestatuswrapyield_GLua 5.1_VERSIONipairspairskv__modenewproxycoroutineanotatepTP@@L(<P@dD4T0`lXXh@Xx((B8,0d$ 8lbaselib.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lbaselib.o lbaselib.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7;5 /var/tmp/lua-5.1.4/srclbaselib.c DD%  XX'; lGTpR(^PkT} 0 ` pTP LX@@4L d$ @2<< H hT<_iTxwD (X(8D@d$D0 <49 HLV`_@iv48~l  @ '6HV^jw*9DP]mx &/=HWao -;t,lbaselib.cDrodata.rodataluaB_assertluaB_collectgarbageluaB_dofileluaB_errorluaB_gcinfoluaB_getfenvluaB_getmetatableluaB_loadfileluaB_loadluaB_loadstringluaB_nextluaB_pcallluaB_printluaB_rawequalluaB_rawgetluaB_rawsetluaB_selectluaB_setfenvluaB_setmetatableluaB_tonumberluaB_tostringluaB_typeluaB_unpackluaB_xpcallbase_funcsstatnamesluaB_cocreateluaB_coresumeluaB_corunningluaB_costatusluaB_cowrapluaB_yieldco_funcs___const_seg_900000302getfunc___const_seg_900000901___const_seg_900001401luaB_pairsipairsauxluaB_ipairsload_auxgeneric_readerluaB_newproxycostatusauxresumeluaB_auxwrapauxopenbase_open__ioblua_gettoplua_getfieldlua_pushvaluelua_calllua_tolstringluaL_errorfputslua_settop__ctypeluaL_optintegerluaL_checkanylua_isnumberlua_tonumberlua_pushnumberluaL_checklstringluaL_argerrorstrtoullua_pushnillua_isstringluaL_wherelua_concatlua_errorlua_getmetatableluaL_getmetafieldlua_typeluaL_checktypelua_setmetatableluaL_checkintegerlua_getstacklua_getinfolua_iscfunctionlua_getfenvlua_pushthreadlua_insertlua_setfenvlua_rawequallua_pushbooleanlua_rawgetlua_rawsetlua_gclua_pushintegerluaL_checkoptionlua_typenamelua_pushstringlua_nextlua_rawgetiluaL_optlstringluaL_loadbufferluaL_loadfileluaL_checkstacklua_replacelua_loadlua_tobooleanlua_objlenlua_checkstacklua_pcallluaL_callmetalua_pushlstringlua_topointerlua_pushfstringlua_newuserdatalua_createtablelua_statuslua_tothreadlua_xmovelua_setlevellua_resumelua_newthreadlua_pushcclosurelua_yieldlua_setfieldluaL_registerluaopen_base=   $>,< 8< H?T?d@tACCDBCFG H4ILJhK @ @LME E    4JDN`FpDOP?QRGS TN TT$U8V@ TL T`LpTBDWU?FX  L( ,Y< HLXZdU|B[?\V ?H,I4 8 L]X^d_t[_  BGG`aV GD$b@VLGXGdDpcde D D  fFd0d< D pJaJGUghV Di4NPV`?l?tNXVejUV ? ? e TN `^ |K k l k m  t  t n ? @ ,U LO `o lA t  x  |B     k  V D  p k = m ,R <@ D= `G lq |    k B = V F U r X 8s H  Tj tj     B = U A e X ,  4  8L TG \= pt a ^ = G D ^ t a o= G  (u@UAh?q    h $ $vU (g(w4 (<xXDdypqUz?acSbq D 0  0(L4S@Wx{Y=| P P L ( 0hH \sl tB  x}~}=s$B4}L|\ P` PhLp=a^a^|=O$P0^<QDRXhU[  L?}  =]$N@Pdt <|  ? <v     D  D z ?, L0W@vPX L`l < <  4<D LT\h<L@ XDTHLdP TlXT\t`d|hlptx |  p L4   $ ,4 @HT D$,( ,048<@ ,T8DP\ht4D < p     X( 4 @ LL X dLp`|@DT 4lt $,8DP`dhl p lt x |   dl98cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/034 xLF" ,8`?DR` <Z(Hb.`  m> T  zAt  Dt  Dldblib.o/ 1281148477 0 0 100644 12492 ` ELF.L4(.shstrtab.text.rodata.rodata1.annotate.debug_info.debug_line.debug_abbrev.symtab.strtab.rela.text.rela.rodata.rela.annotate.rela.debug_info.comment㿠;?@` 㿠@ @ @@ 㿠 @ @ @;`@@@ @ 㿠@  㿠 @ @ @ @;`@ 㿠@?@㿠@?@㿠 @  2@&`&`@㿠@ @?@??@ ?@8;ِ``@ `@@`@@@@ @ 2Hq@?@ @@ @@( @ @ @ S@8w@sLxXthg@ l@pg@ u@|^@ n@ LH@ L@c@ f"@  Y  @8:`@@@ 3`@`@@@ @ @@? @ 8 `@@@ /`@`@ @@ @@@ 㿠@  @ @ @` @ @` @`@ @?'@@` Ԟ㿠 @ ́㿠;`;?@`@@@?@? @`/ @`@`@ @  @㿠 @ c@ @ r@ @ l@`  f  @  c*` @  r*@``@f@ f@  l* *@h㿠;`;?@`@@? @?5?@ @ @@@㿘#`@@   `@ /`@  @ `@ @@@?@?@ 㿐@@@ 9 @;`@ ?@@@a@@@ 㾠;`;`@?@ @13`  @@)@@@   @ H ?@ @(@@ @ @O֒  8 r@@  @@? d@@ @@  @H?@  `@ @@n @% @# @@ X @ @"@L  @2O B @  $@ (@ @ ,@K`@ 0@L`m@ D@M` C@ Mt@ X@ T@ @"@@O @"@ 㿠;`;@` hnil or table expected'setfenv' cannot change environment of given objectflnSu>%sfunction or level expectedinvalid optionsourceshort_srclinedefinedlastlinedefinedwhatcurrentlinenupsnamenamewhatactivelinesfunclevel out of rangecallreturnlinecounttail returnexternal hooklua_debug> cont =(debug command) stack traceback: ... Snl%s:%d: in function '%s' in main chunk ? in function <%s:%d>debuggetfenvgethookgetinfogetlocalgetregistrygetmetatablegetupvaluesetfenvsethooksetlocalsetmetatablesetupvaluetracebackanotateT 8dL$$8Hdd$ ldblib.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o ldblib.o ldblib.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.793 /var/tmp/lua-5.1.4/srcldblib.c DD% " +6 ALtXg8wL8Td x$@$d8H|dd(D  5CQbnw'1AN\iy%09DVfr@ \$ldblib.cDrodata.rodataKEY_HOOKdb_debugdb_getfenvdb_gethookdb_getinfodb_getlocaldb_getregistrydb_getmetatabledb_getupvaluedb_setfenvdb_sethookdb_setlocaldb_setmetatabledb_setupvaluedb_errorfbdblibsettabsssettabsigetthreadtreatstackoptionauxupvaluehookfmakemaskunmakemaskgethooktablelua_pushvalueluaL_checkanylua_getmetatablelua_pushnillua_typeluaL_argerrorlua_settoplua_setmetatablelua_pushbooleanlua_getfenvluaL_checktypelua_setfenvluaL_errorlua_pushstringlua_setfieldlua_pushintegerlua_tothreadlua_removelua_xmoveluaL_optlstringlua_isnumberlua_tointegerlua_getstacklua_pushfstringlua_tolstringlua_getinfolua_createtablestrchrluaL_checkintegerlua_getlocallua_setlocallua_iscfunctionlua_getupvaluelua_setupvaluelua_insertlua_pushlightuserdatalua_rawgetlua_calllua_rawsetluaL_checklstringluaL_optintegerlua_sethooklua_gethookmasklua_gethooklua_pushlstringlua_gethookcount__iobfputsfgetsstrcmpstrlenluaL_loadbufferlua_pcalllua_gettoplua_isstringlua_concatluaopen_debugluaL_register %$&0'D(`)x | *+,-./+0   1(283L4\3p)5%673 L L 849L:\;p()<=%7>*?(@@@@@,@`*A;  *AB7 2%((TAd;x  *&+7AC2A/ DHE`F2G&  HIHI)02L4\(lJ@@@H L XHdIp)+?H%K) + $  (  0L H/ \M H % K + N O P      8  8 Q 8H DI P6 h2 pR |4  H  H S S T U S S V W X Y 8= @T LT X+ dT tU 9 : + Z  t  t Q 4[ PQ dQ x; ; Q ; ; (Q 8> H< d< < < < QZ\(;<ZL\` h l p^t   $, $(, 048<t@DHLP,TX8\`@dhHl8pTtTxd|p  ,8TDP\h@tdt8|D  ( 4\D8H\LPTX\l`"!cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/034 Xz"dd,8~=DR %Z(bp  m'\  z(  *t  *liolib.o/ 1281148478 0 0 100644 14844 ` ELF7x4(.shstrtab.text.rodata.rodata1.annotate.debug_info.debug_line.debug_abbrev.symtab.strtab.rela.text.rela.rodata.rela.annotate.rela.debug_info.comment㿠;`@@  @@ @9 @ @;`@@ 㿠;@`;`@?@ @㿠;?@  @ `;`@@@@?@?@@7@  9 @  @ 㿠;`@  `@ @㿠;?@ " 9` @@?㿠@;`@  㿠;` @   " b㿠;` @ @ ' 2 3p?`Q㿠;@ `?@@㿠@ ?@;?`@ 㿠;`@  `@ؐ 㿠`@  @``@  `p@ 㿠 @ ;` @ y@'  @  㿠 @ ;` ;@ ]`@'  @ ځ 㿠M@'`` @  ˁ 㿠;?`@@? @ .`;/`@㿠 @ @";?@ @@'  @ `@`@`@ ` Ξ` Ȟ㿠;@`@ @㿠ѐ   㿠@  @ 3?`@;@ Ő`@&`@f@Ĕ㿘;`@ @  @㿠` @&``&`@ @ 7 3p?@㻐@@$@$@@@ " M 2H '@ '@@O@@?2 3p?㻐@$@@ g@@'O@@ @?@  㿠@` ??@ .` Y` )  @@M@ @@@e1+@ @`M`*"HM``@M`n@l@ a"H`$1 V ?@  O` @` ` @  H@@?@$㿠 r 㿠 }㿠7?@ @3`@ @ ;@`9 @@ @@ @ @ 㿈@? @2?@ @`@@'7'@@  @`@  @@  ?OӐ ǁ㿠  㿠# 㿠;`;`@  3@ `/ @@  @@ 㿠;` 9@ /` @$  @ 2 3p?v㿠 @ 2 3p?`j㿠ΐ@ 2 3p?`_㿠9`  @@?a@?@㿠" @ ?@?9? @@?@@㿠 @ @ ;?`@㿠Ɛ;9`;?` @73@`/ݐ  ?  + @@?`@@ @inputoutput%s: %s%sFILE*closed filefileattempt to use a closed filecannot close standard file__closefile (closed)file (%p)r'popen' not supportedstandard %s file is closedw%lftoo many argumentsinvalid optioninvalid formatfile is already closed%.14gsetcurendnofulllinecloseflushlinesopenpopenreadtmpfiletypewriteseeksetvbuf__gc__tostring__indexiostdinstdoutstderranotatep\DDH(0D<<8Tpp<X0$@l  x0,Hd8 h liolib.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o liolib.o liolib.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.793 /var/tmp/lua-5.1.4/srcliolib.c DD%  <)002;xDpL V8p_  g<rz @``,T$ 0 ( x <8tTPDDH((P0 D<X'<0$0: LF$@Rdl[ep 8w Hd88  $1BO_oz.9@OX_m}%+3:LYgs@pliolib.cDrodata.rodatafnamesio_closeio_flushio_inputio_linesio_openio_outputio_popenio_readio_tmpfileio_typeio_writeiolibf_flushf_linesf_readf_seekf_setvbuff_writeio_gcio_tostringflibpushresultfileerrortofilenewfileio_nocloseio_pcloseio_fcloseaux_closegetiofileg_iofileaux_linesio_readlineread_numbertest_eofread_lineread_charsg_readg_writecreatemetacreatestdfilenewfenverrnolua_pushbooleanlua_pushnilstrerrorlua_pushfstringlua_pushintegerlua_tolstringluaL_argerrorluaL_checkanylua_touserdatalua_getfieldlua_getmetatablelua_rawequallua_pushlstringluaL_checkudataluaL_errorlua_newuserdatalua_setmetatablefcloselua_getfenvlua_tocfunctionlua_typelua_rawgetiluaL_checklstringluaL_optlstringfopentmpfilelua_pushvaluelua_rawsetilua_pushcclosurelua_gettopfscanflua_pushnumber__filbufungetcluaL_buffinitluaL_prepbufferfgetsluaL_pushresultlua_objlenstrlenfreadluaL_checkstacklua_tointegerlua_settoplua_tobooleanlua_tonumberfprintffwriteluaL_checkoptionluaL_optintegerfseekftellsetvbuffflushluaL_newmetatablelua_setfieldluaL_registerlua_setfenvlua_createtable__iobluaopen_iolua_replace7 7 8(9<:D L T;d:l t x;<7 :7   ;=>?@   A B8C\ $` $dDt 0x 0|D9  EFG   AH,94 X< X@DT \ dE  EI tJ tAKL$M@ H LEt | ED;N  O PDNL T ` dOx |FQM@    $ ,FHLd=PRSM     , L0R< L@8LTLM N PU( 0 4VTWYDXZ[\ _<]X[h\|]^Z[` ] ^ <U t | a L b = ,> > c 9 X@ l  p  tF 7 : 7     F d c R U L <e H $ P $ \f N g 4 0 < 0 @  D  Lh `  di l  |j k <  0  0  $ h i  $l@mlm    nRopRSR(q0oDrTT\ td tho|    u @ @ (p (s s  Pc(A0 P@qLc,04084<8D@LDHTL0PTX\\x`ddhl plt8xt| | LT`\Tt 0 (  <t ,8DP\(hPt<t8< $Tx($4d@LX 8d p 0| L    ( 0`8px4 ($(,04L8< @ D (H DL P T X \ `(dXhlp0th|43cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/034 \4$",86=DsR` 7Zb# \  m-@  z0(<  3d  3| lmathlib.o/ 1281148478 0 0 100644 10492 ` ELF&|4(.shstrtab.text.rodata.rodata1.annotate.debug_info.debug_line.debug_abbrev.symtab.strtab.rela.text.rela.rodata.rela.annotate.rela.debug_info.comment㿐@ #h#lh@l#`#d`d@ 㿐@ #h#lh@l#`#d`d@ 㿐@ #h#lh@l#`#d`d@ 㿐@ #h#lh@l#`#d`d@ 㿐@ #h#lh@l#`#d`d@ 㿐@ #h#lh@l#`#d`d@ 㿐@ #h#lh@l#`#d`d@ 㿐@ #h#lh@l#`#d`d@ 㿐@ #h#lh@l#`#d`d@ 㿐@ #h#lh@l#`#d`d@ 㿈@ ;h@ h#p#tlp@t#`#d`d@ 㿐@ #h#lh@l#`#d`d@ 㿐@ #h#lh@l#`#d`d@ 㿈@ ;h@ h#p#tlp@t#`#d`d@ x@ ''@?@@ 㿐@ #h#lh@l#`#d`d@ 㿈@ ;h@ h#p#tlp@t#`#d`d@ 㿐@ #h#lh@l#`#d`d@ 㿐@ #h#lh@l#`#d`d@ 㿐@ #h#lh@l#`#d`d@ @ !TD-@f㿘;@ `;`  #`#d`d@ @ !TD-@f㿘;@ `;`  F#`#d`d@ x@ ''@''@@ 㿐@ ;h@ h@l#`#d`d@ 㿐@@ ?@ @`  ĵa>O@ 㿐@@ ?@ @`  ĵa>O@ @?p@) : K@30 : ? &-&@"#;`@@ @ "@*N'`d@ @  @`@ #`X#x#|x@|\##@ @ @ @'@! @ #` R#p#tp@t#V#h#lhl@ @㿠@ @ @ !TD-㿠;?`;`@H a@ @ @ @?@? @ interval is emptywrong number of argumentsabsacosasinatan2atanceilcoshcosdegexpfloorfmodfrexpldexplog10logmaxminmodfpowradrandomrandomseedsinhsinsqrttanhtanmathpihugemodanotate ,DDDDDDDDDD\DD\TD\DDDTPxx @HH0 lmathlib.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lmathlib.o lmathlib.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7;5 /var/tmp/lua-5.1.4/srclmathlib.c DD% D$ D.D8\CdDMDWDaDjHsdD|HD\XTP DDtxxT\H DDD<D"D,TD5=Tk     0BHSXfqw lmathlib.cDrodata.rodatamath_absmath_acosmath_asinmath_atan2math_atanmath_ceilmath_coshmath_cosmath_degmath_expmath_floormath_fmodmath_frexpmath_ldexpmath_log10math_logmath_maxmath_minmath_modfmath_powmath_radmath_randommath_randomseedmath_sinhmath_sinmath_sqrtmath_tanhmath_tanmathlib___const_seg_900002101___const_seg_900002201___const_seg_900002701___const_seg_900002901luaL_checknumberfabslua_pushnumbersinsinhcoscoshtantanhasinacosatanatan2ceilfloorfmodmodfsqrtpowloglog10expfrexplua_pushintegerluaL_checkintegerldexplua_gettoprandluaL_argerrorluaL_errorsrandluaopen_mathluaL_registerlua_setfieldlua_getfield-.4/L-`0x/-1/-2/-,3D/\-p4/-5/-6/(-<7T/l-8/--9/ - :8/P-d;|/--</-=/,/D-X>p/--?/-@/(-<AT/l-B/ -   / -$ ( , H/`-xC/D-EF/G-,-d/xG--/H  TG| /E  I;   / E (E @ H LI x; /   J E K     M $/ 4N D/ TN dO tN04  <D L$d(T,0\48d<@hDHlLdPpTHXx\`dXhlpt x|t D<T ,D8DP\Tht dH< dX(4t@ PX`hpx    *)cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/034   \ D" D,8?D R$ -Z$b  m  z p  "D  "\loslib.o/ 1281148479 0 0 100644 8980 ` ELF 4(.shstrtab.text.rodata.rodata1.annotate.debug_info.debug_line.debug_abbrev.symtab.strtab.rela.text.rela.rodata.rela.annotate.rela.debug_info.comment㿠;`@@  @@;`@@ 㿠  @ @@ 㿠 @ @2 3p?`ρ㿠 @  @ @2 3p?`㿀@2 3p?`@7@@ 㿠 @ @@ A.㿐@;#h`h#`#d`d@ 㿠@?@㿠@@?@㿠?@@@?@@?㿠?@@@@? @7@@? @ @ @@ '@ @#\\'N`!@@@@@ @@/ @ `{`w` s `o``j` 'le`(``0[ `8d  %//@N@*N %@N`@$N$ ȶ/@@쀤*@N@N-`'N`2ON@ P@ @@ 2? ;@ `@ 7 'ܒ2 '- '?''"?'8'4'@܀?2@#h@ h#`#d`d@ 㿈@ ;h  @ h@#pD#tt@p#`#d`d@ 㿠  ;@ `;`9@ *  @@ 㿠 @ @㿠;`;@` %s: %sunable to generate a unique filenamefield '%s' missing in date table%c*tsecminhourdaymonthyearwdayydayisdstallcollatectypemonetarynumerictimeclockdatedifftimeexecuteexitgetenvremoverenamesetlocaletmpnameosanotate d44LP0$,`|T,d $ @h loslib.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o loslib.o loslib.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.793 /var/tmp/lua-5.1.4/srcloslib.c DD% @"T*h6d4At Ih0S4]Lgdtp,|P4`d$,@`|   !1AQXjqx ")3:JXhq$loslib.cDrodata.rodataos_clockos_dateos_difftimeos_executeos_exitos_getenvos_removeos_renameos_setlocaleos_timeos_tmpnamesyslibos_pushresult___const_seg_900000701setfieldsetboolfieldgetboolfieldgetfield___const_seg_900001401errnolua_pushbooleanlua_pushnilstrerrorlua_pushfstringlua_pushintegerluaL_optlstringsystemluaL_checklstringremoverenametmpnamluaL_errorlua_pushstringgetenvclocklua_pushnumberlua_setfieldlua_getfieldlua_typelua_tobooleanlua_settoplua_isnumberlua_tointegertimeluaL_checknumbergmtimelocaltimestrcmplua_createtableluaL_buffinitluaL_prepbufferstrftimeluaL_addlstringluaL_pushresultluaL_checktypemktimeluaL_optnumberdifftimeluaL_checkoptionsetlocaleluaL_optintegerexitluaopen_osluaL_register   (!0"8 @ H#T$t%|&$'('') *< @ D+X,t'|-,.  /$0$ 00T1`234156 0 0+ 4  X( X4%D2X7h89:!;<=?@,>`Ax27 \B \4PCd!/8DE/  $%, 0 8 @ DFP XGd,HI     4K 4 $(,48<@DHLPdTXt\`hdhlpt x|p ,d8DP\hht@pt $0(,cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)libintl.h 1.16 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/034  $#" H0, x8 .=D kR  ZDbL8  mP  zP  $  <Xltablib.o/ 1281148479 0 0 100644 8436 ` ELFt4(.shstrtab.text.rodata.rodata1.annotate.debug_info.debug_line.debug_abbrev.symtab.strtab.rela.text.rela.rodata.rela.annotate.rela.debug_info.comment㿠 @  @   @ @ @@@@@?2@   @?O 㿠 @  @ @ @ @@ ?@@ @@?2@  @@O 㿐w @ @@ @@?@? @ @?` ¹a? @ O@ 㿠 @ @ @ 㿠 @ ;`@@  㿠 @  @  @ "@ "@;@ f@@@@O@ `@㿠 @  @  @ @@@@@@`@@O`@@  㿠 @@?@ @?;@`@@㻐;`@  @  @ @ @@ @ @@  @O@@ 㿠@  @㿠@ @@ @@ @ @?@?@㿠@@Ť?? @ @̔@&@?&@@2  : @ @@@ @@@?@{ @@ @y` @w@@`@@ @cO ??@V@@@?@? @B?O@1@? @ @!&$dfddf>@OB㿠 @ ;@ ` @ ( @ @@ @ 㿠;`;@` 'setn' is obsoletewrong number of arguments to 'insert'invalid value (%s) at index %d in table for 'concat'invalid order function for sortingconcatforeachforeachigetnmaxninsertremovesetnsorttableanotate 48d $$  ltablib.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o ltablib.o ltablib.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7:4 /var/tmp/lua-5.1.4/srcltablib.c DD% "*3848=EhMl8R LWPax(dx ($  *5@R^n{ $ ltablib.cDrodata.rodatatconcatforeachforeachigetnmaxntinserttremovesetnsorttab_funcs___const_seg_900000301addfieldset2sort_compauxsortluaL_checktypelua_objlenlua_pushvaluelua_pushintegerlua_rawgetilua_calllua_typelua_settoplua_pushnillua_nextlua_tonumberlua_pushnumberluaL_errorlua_gettopluaL_checkintegerlua_rawsetiluaL_optintegerlua_isstringlua_typenameluaL_addvalueluaL_optlstringluaL_buffinitluaL_addlstringluaL_pushresultlua_tobooleanlua_lessthanluaL_checkstackluaopen_tableluaL_register 4LXhx !"#$$4 @!X"d$#$"!% $(&DP\x  '( ),*L*\ `'t+*#*4@,T!` <d-p <x'. t t/+!)0<1h2**! 3"4HX""L"dt x x'"0X x\ x`'p"" X d h t 5 !  "    7   8 $(,04h8<l@D L ,88DlP\hh(tx( L `cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/034   P " , 8 >D R Zb  ml  zD  @  Xlstrlib.o/ 1281148481 0 0 100644 19724 ` ELFJ4(.shstrtab.text.rodata.rodata1.annotate.debug_info.debug_line.debug_abbrev.symtab.strtab.rela.text.rela.rodata.rela.annotate.rela.debug_info.comment㿘@ @ @ @ f 㿘@ @   @?d4H@ @"&@ 9 @  㻐@ @'  @'@*@@N@. $''O@ 㻐@ @ @ *@O`@O`@``-'*O@ 㻐@ @ @ *@O`@O`@``-'*O@ 㻐@ @ @`@ @?4O@ 㿘@   @ 0 @)`d8H@@ "+`@@`@@`@  @'`O@&OM㻐@@`@ @ @@-@ @ @. 'O@ 㿠@ 㻐 @ ;@ @`@@;`@@  @  @ @ )` @ `@ @)`  `@"`6O`  @㿠N` %@` ["HO`O``2@$` 1`@ )^ "H`O``2@O` @O`%@`O``f@O`]2OO``(@Xp㿠@" a7@L.@!  `7-  ` 1- +-+` %-/ -9 -`- ` -!  `-6 - 2?`@ @` d@@4 3p?㿠N`` `^d@d@`@@-O` %2@ O`O`` `H`-@`:@O`L 4H`L ` H `O` @ `@*OO` f@J` ."@  %@ ["@ " K`K` `Y  ` 2H㿠N`"@ N 2HN` #@`N`N"@N N` @@ O`2@O`?2H`` @`d@ @*OO` 㿠 @@ N` @` @@ M` O`@ @s@' O 㿠@d@ @@N` }@ `@R"O  㿠 ` @-``-@@%%`'` @5@` ?'` 㿘S*   ?&@' @ `d@% 㿠%*  ' @ @@@ 㿠7O (@ "@$"H`O %"@O d(@)"@ ]O  )@ ? ?b@f"@O 0O  "@  O [@   @` @ @ ' N'  2@b N` "@Z O @ HO  `"@K  O H @d@̒ @@ N` `@ N N-@*@+@-@?HGp`h"OjO ́"@ `ǁ@`WO  㿠@@@'` @@N@@@"@&&@ N@O 㿠 @@ `@ &@ -@.`@3 @`2@   '@ @㿠 `@`@    ;`@ @  ĖO㾈@ @  @ ?6@ ` 8H`@ @ @@2HL`#eHG"`@@ @ L`'^ ' `d@'d@@'@*O'~H`@$@&@ v  p@   㾈9? @ @  ''@'@@@'<@(O'%`d@@ @. 㿠 @  @ ;@ @ `@  `@㿘 @ `@B9 L`&d  %"@``*@`@` &`L`) '`L` `@`*@`@` &`L`- `L``0@@ `L``@*OL`㿠 @  @"  @   @ "H@ @   w@ @?@ @?&@@?H9@?@ @@㺀@   @ @  @ M ^d@d@@ @ @ H@ @''@@V'`@,'3@r`@(@@䀧@@: *@O`@O`@`+`'&O') @H  @(@䀧@:H*@O`@O``-`'#@@@ 㿘@`d  @ "@`&`( ``@I'5 \O``"@ `@)` @ ` "@ )``"@`\2H$``@*@`@``&`*``*@`@`&`O`*`@ `@  `*@`@`&`O``,%'2OO``*@`@` &`/ 㿠N``@N`-@@& N @ &N @2O & @9 @N  `2H N @ 2H N `.2@N N   2H N   @f@N `@ %/@.& @.㿠@" N9'`@ ..PPPPA8@  @@@O` %@@*@O`@O``-'@O`%@` @`@N`+ `'x@ܤܐ -J  $`E3@n-@ @ @@#\\@Ui@@#\\@H\'@ F@ ܃@#\\@7- ܁D#\\@,@'А'@ u!@ؐ@@ .@ ؀`d @@@ @ܒ@@ܔ@܀@*OeO` O;`@@ 㿠 @ ;`?@ ;@?@@@`@@㿠;`;`@?@??@?ѐ string slice too longinvalid valueunable to dump given functioninvalid capture indexinvalid pattern capturemalformed pattern (ends with '%%')malformed pattern (missing ']')unbalanced patterntoo many capturesmissing '[' after '%%f' in patternunfinished capture^$*+?.([%-'string.gfind' was renamed to 'string.gmatch'invalid replacement value (a %s)string/function/table expected\r\000-+ #0invalid format (repeated flags)invalid format (width or precision too long)linvalid option '%%%c' to 'format'bytechardumpfindformatgfindgmatchgsublenlowermatchrepreversesubupper__indexstringanotate!($tlP\plTXxX,,XP@|P hBh Pp$ 8$$$$$$$P$$$h$$$$$h44h hhlstrlib.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lstrlib.o lstrlib.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7:4 /var/tmp/lua-5.1.4/srclstrlib.c DD% L#@,l5>IUX\|Xe(mwt\<8$|P\8hhh  p' 84 ? 8E P l^ Tj XxXx$,P,xP@ |   /AQao*2>LZfw#0!DP?Mlstrlib.cDrodata.rodatastr_bytestr_charstr_dumpstr_findstr_formatgfind_nodefgmatchstr_gsubstr_lenstr_lowerstr_matchstr_repstr_reversestr_substr_upperstrlibposrelatwritercheck_capturecapture_to_closeclassend___const_seg_900001502match_classmatchbracketclasssinglematchmatchbalancemax_expandmatchmin_expandstart_captureend_capturematch_capturelmemfindpush_onecapturepush_capturesstr_find_auxgmatch_auxadd_sadd_valueaddquotedscanformataddintlen___const_seg_900004001createmetatableluaL_checklstringlua_pushintegerluaL_checkintegerluaL_optintegerlua_pushlstringluaL_buffinitluaL_prepbufferluaL_pushresulttolowertoupperluaL_addlstringluaL_errorluaL_checkstacklua_gettopluaL_argerrorluaL_checktypelua_settoplua_dump__ctypememcmpmemchrlua_tobooleanstrpbrklua_pushnillua_tolstringlua_tointegerlua_replacelua_pushcclosureluaL_addvaluelua_typelua_pushvaluelua_calllua_gettablelua_isstringlua_typenamestrchrstrncpystrlenstrcpyluaL_checknumbersprintflua_createtablelua_setmetatablelua_setfieldluaopen_stringluaL_registerlua_getfield 89h8x:;<  <8$=T>?8=>@,?H8\=>A?8:=$B<?X8p;;  CD 9DEX=p:  F>?B G H,=4 <IL ,P ,TC\? L LC$ d, d0Ct ||C |  Cl@x | J J J J J J J J J J J J J J  J J J $J (J ,J <J @J DJ TJ XJ \J lJ tJ J  ` dC h < @C D K <J  DJ $ (C, TLtKL< L LC  C   D9P<  D88;DMT  X  \N99d9p9OPP Q9R88 H9 S , ,C0PHJ \J |>>B,T\UVWXMH <0YH \LU\Zh \lCtT88U;   F0=>>B?98>, 4 >>BB>X>  [[  CJ J   C\] ^ 8=<>>  _`0_H`d h_p ``_` 8 ([ HV PT h` p] B     C ? a     <   V! b!H!$V!, !4c!<H!H !L !P !T !\e!lf!|c,L4 @<D L$(T,0\48d<|@lDHpLPxTX\`dhl\pt< ,88\DP\<htL@|8  8     ( 84@LXXdp|$P|x !Dh (4DH0L P T X \ `dhlptDxP|t!< 54cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/034 !"l""%,)|8*5>D*sR*p 8Z0Zb5X <  mAh  zBT  FP  Fh loadlib.o/ 1281148481 0 0 100644 12676 ` ELF/4(.shstrtab.text.rodata.rodata1.annotate.debug_info.debug_line.debug_abbrev.symtab.strtab.rela.text.rela.rodata.rela.annotate.rela.debug_info.comment㿠;`@ : 㿠;`@ : 㿠9 9?@ @@?@?@?@5?@ " @@@@@㿠;`@  `@ '  㿠 `@'  `2@  @ @  㿠 @  @ ֒@ @;@? `d@@ 㿠;@`@ @ 㿠N``;@`N`;"O`N` @ @ ;@'@@@'@@㿠;`9?@ @?@ @@(@ Ē@#??@ ,@@@0@@@ O 㿠 @ ?;@ `@㿠 @ ;`@ @@ޒ 㿠7@ -  f@|@@@?㿠 @ ;`r@ ْ@ 㿠 @ @ .@" ;@?@ `I@ Ғ@ @9| @  㿠 @ ;?`;`?@@ @@@@@,@ 㿠 @ @ ;?`;`@ @@?@#@?`@w%@ 7?4?@@ @-<@@  ?@@@ ?/@ @@ @ @ @@@@ `ِ@?`Ԑ5@ @@ @ @@ @ @@@ @ @ @ 8@ @9 @@@?H;`@?@@@㿠 ?`@ @ @@ O㿠;@?`?@ @ @@ .  d@&@?@㿠 @ ;?@7 `@@?@ @@?/?@ @9 @@?@3`@@@@?@?@_ 㿠 @  @ @ ;? @@?@`;@`@? 㿠@@@?9? @@@?@㿠;9`7?@ @ @@H)?@@? @ @ 0`@ 00`@ @``2O`\?/@P\<@ H@ (@ P@ @ ؐ@ @@ @ dynamic libraries not enabled; check your Lua installation%s%sLOADLIB: _LOADLIBabsentinitr;./'package.%s' must be a string? no file '%s'error loading module '%s' from file '%s': %spath-_luaopen_%scpath no module '%s' in file '%s'preload'package.preload' must be a table no field package.preload['%s']_LOADEDloop or previous error loading module '%s'loaders'package.loaders' must be a tablemodule '%s' not found:%sf'module' not called from a Lua function_M_NAME_PACKAGEname conflict for module '%s'__index;;;;loadlibseeallmodulerequire__gcpackageLUA_PATH./?.lua;/usr/local/share/lua/5.1/?.lua;/usr/local/share/lua/5.1/?/init.lua;/usr/local/lib/lua/5.1/?.lua;/usr/local/lib/lua/5.1/?/init.luaLUA_CPATH./?.so;/usr/local/lib/lua/5.1/?.so;/usr/local/lib/lua/5.1/loadall.so/ ; ? ! -configloadedanotateH   <x8|@BXdl`X4x loadlib.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o loadlib.o loadlib.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7:4 /var/tmp/lua-5.1.4/srcloadlib.c DD% $/ 9B 4L`W`lopXz,l 8 X,<hxd8|0@d ` X L x  #3CPYhs")0:HS^iw"1@Qah xloadlib.cDrodata.rodatasentinel_ll_loadlibll_seeallpk_funcsll_modulell_requirell_funcsloader_preloadloader_Lualoader_Cloader_Crootll_unloadlibll_loadll_symll_registergctmll_loadfuncreadablepushnexttemplatefindfileloaderrormkfuncnamesetfenvdooptionsmodinitsetpathlua_pushlstringlua_pushfstringlua_gettablelua_typelua_touserdatalua_settoplua_newuserdatalua_getfieldlua_setmetatablelua_pushvaluelua_settableluaL_checkudatalua_pushcclosureluaL_checklstringlua_pushnillua_insertlua_pushstringfopenfclosestrchrstrlenluaL_gsublua_tolstringluaL_errorlua_removelua_concatluaL_loadfilelua_tobooleanlua_rawgetilua_calllua_isstringlua_pushlightuserdatalua_setfieldlua_pushbooleanlua_getstacklua_getinfolua_iscfunctionlua_setfenvstrrchrlua_gettopluaL_findtableluaL_checktypelua_getmetatablelua_createtablegetenvluaopen_packageluaL_newmetatableluaL_registerlua_replacelua_rawseti $ (&< D H&\ <d <t'()*+,-.'/00 P8 P<1233,48 \<5H \T6l lp7t l89:& t$ t4;H-X<p=&<;>'>?<<P T<d h=|3  @ t9 t; '>83D H 39 &< 8 H T'x3 ( (-)=-)' 3+, x0 x8-H-TAh l*t   =-) = &B) <( 0=<6LCX)lD?+  EF6C) F - * 4G @/ PF pH     I J     = / K + / / 0C T $ X/ ` $ pF 6 F L & F 3 M  x  x - - ) 4+ LN \ < ` < d= p/ F  (  ( - ) + + / O P 8Q D/ P. \ \ `/ h \ pF R 6  d  d ; ; > F  P  ,  P   T  , $2 4F <  LU X/ dV tQ 2 W   F& F4NDFTQdFp/x U+p x   $(4l8p<,@ ,88DXP,\hhtd0p,l `  L  ( 4 DHhL P dT #"cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/034 tH"dX,8u>DR &ZLb 8  m)4  z)h  +,  +Dlinit.o/ 1281148481 0 0 100644 3080 ` ELF 4(.shstrtab.text.rodata.rodata1.annotate.debug_info.debug_line.debug_abbrev.symtab.strtab.rela.text.rela.rodata.rela.annotate.rela.debug_info.comment㿠;``@ @ @@  2Opackagetableioosstringmathdebuganotated dlinit.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o linit.o linit.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.782 /var/tmp/lua-5.1.4/srclinit.c DD% H  -=KVap}dlinit.cDrodata.rodatalualibsluaopen_baseluaopen_packageluaopen_tableluaopen_ioluaopen_osluaopen_stringluaopen_mathluaopen_debugluaL_openlibslua_pushcclosurelua_pushstringlua_call  $4D    $(,0$48,<   cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/034 d<H2",,8<DR Z|b@<  m|  z<  T  l0707010005d1f6000041ed0000000000000000000000024c5cc658000000000000010000010036ffffffffffffffff0000001300000000root/usr/local/bin0707010005d1f7000081ed0000000000000000000000014c5cc64300036a700000010000010036ffffffffffffffff0000001700000000root/usr/local/bin/luaELF94f84 (44-'-'-(-(81\1\/usr/lib/ld.so.1uv  !#%&'()*+./123569:;=>ABCDFGHIJKLMNOPQRUVWZ[\]^_bdfhlmnpqsuxyz~     "#$%'()*+/23679:=>@ABCEGHKLNOQSTUWXYZ\^`bcdehijklorstu "$,-0478<?@ESTXY`acegijkortvw{|} !&,-.01458;<?DFIJMPRV[]_afgmnpq0P 1-$,$ 2f T ;D F/J< T a4 kX yUP   `@ .p0k -a4x ^d J\ ht 2(T  B| ` 'lT 4OX BYP4 R\\ b pd x/|L Wl .Vp  />L `P UL `D , d  $ -(//50$ C_ Oj [ kA y1@/<D [\, Gd 1$ ]L ^@ 0 &N0 5X C0 L ]. dYdt n7L y14 6<@ F,  ; dD P t $ R8 .d 5  g\ / tT 'qd 33` =@ H{D( WA `N $ pal |S( .4 > XL  L V . . 0  $ 94  #6x .fp 9.@ @Q OW Z1\ c  i`h u8 :, H dH hP  , h4` [< 90 #9  *9L :sxX K8 XA f1( m` |T@   = @ 0  /l dd / . j8 x4  . %i 3- :t '-t K$ V c\D oZ <| 0D2`@ . VT 3 ; 03 ! H`  R4 .X - 0 p( 7\ 4X  Px e fX 'll 04< JP\ BeP$ OZ0 `/$k u4 < -X\0 -' [   l :H b .|IPH QLT {0tj / &SD 3Mht ?/D\` /QbLX ZM( i-q0vT@X /WL Y,   4$ 98, @l\ .2H; .L@ 0 , )l ;] G]L$ T<| c[, p.v<@ 2@Th , | .(( -2@! frexpluaM_growaux_tolowergetenvluaopen_tablelua_nextlua_yieldacosluaH_nextluaO_chunkidluaO_log2lua_topointerlua_tointegerluaC_barrierbackluaU_dumpmemcpymktimelua_getstackfgetsluaK_infixlua_setfieldluaK_getlabelluaT_init__environ_locklua_equalluaL_unrefluaG_ordererrorlua_getlocallua_newthreadlua_pushintegerlua_createtableluaV_lessthanlua_gcatanluaY_parserluaK_exp2RK__filbuflua_tolstringluaH_getnfabs.st_double_foreffluaK_prefixlua_tonumberluaF_newupvalluaO_pushfstringlua_statusluaC_link_GLOBAL_OFFSET_TABLE_atan2luaV_gettablelua_rawsetilua_gethookluaopen_packageluaL_buffinitstrrchrfscanfluaL_openlibluaX_nextlua_atpanicluaK_exp2valfseekluaO_nilobject_luaK_retluaK_setreturnsluaL_checknumberloglua_gettoplua_newuserdataluaZ_openspacelua_setallocflua_gethookcountsetlocalestrtodlua_pushfstringluaV_tostringlua_rawgetluaL_getmetafield_edata.ld_intluaK_stringKluaG_typeerrorluaL_newstateluaX_syntaxerrorluaP_opmodesluaZ_initlua_pushnumberstrtoulluaopen_stringluaD_poscall_get_exit_frame_monitorluaH_setnumluaF_freeclosurelua_xmovelua_isstringstrcollluaK_checkstackluaX_lexerrorstrchrluaD_throwluaK_dischargevarsluaD_pcallceilluaK_posfixsystemgmtimelua_setupvalueluaH_freefreopenluaK_exp2nextregluaL_optnumber_exitluaV_equalvalstrlenlua_setlocalluaD_protectedparserluaC_callGCTMluaK_setlistlua_cpcallluaL_prepbuffer__ioblua_iscfunctionluaM_toobig_PROCEDURE_LINKAGE_TABLE_luaK_numberKlua_setmetatableluaC_barrierflua_closeluaL_loadfileluaH_getnumluaK_patchtohereluaX_tokensmain__xargvluaK_goiftruelua_dumpluaK_reserveregsluaU_headerluaL_loadstringfprintfluaopen_mathluaH_resizearrayluaG_concaterrorluaL_newmetatableluaS_resizelua_getallocfluaH_setluaF_freeupvalluaO_int2fbtanhluaO_pushvfstringluaL_checkanyfwritelua_lessthanluaL_argerrortmpfilelog10lua_insertsrandluaX_lookahead__ctypeluaV_executeluaF_getlocalnameatexitluaD_growstack___ArgvluaL_pushresultlua_pushnilftelllua_pushlstringrenameluaK_codeABCluaL_callmetaluaC_linkupval__xargc.st_floatlua_removeluaM_realloc_strcmp.st_doubleldexplua_rawsetluaF_closeluaT_typenameslua_setlevel__fsr_init_valueluaL_findtablelua_pushbooleanluaL_openlibstoupperluaU_undumplua_getmetatablelua_settabledifftimelua_checkstackluaK_storevarstrftimeluaO_rawequalObjungetcluaK_selfluaL_errorstrpbrkluaL_typerrorluaL_loadbuffer_lib_version.ld_llonglua_loadlua_settopluaF_freeprotolua_pushvaluestrncat_endluaC_separateudataluaX_token2strcoshluaH_setstrlua_getinfoluaZ_fillluaT_gettmluaG_checkcodeluaL_refluaA_pushobjectlua_setfenvlua_typenamestrncpy.st_float_forefflua_touserdataluaD_seterrorobjluaF_newCclosureluaK_exp2anyregfloorfclosesqrtluaopen_debugluaL_checklstringluaD_callhookluaL_wherelua_concatstrcpyluaK_setoneretlua_objlen_DYNAMIC_finiluaH_getstrluaL_checkudata__1cG__CrunMdo_exit_code6F_v_luaL_optintegerluaP_opnamesluaK_fixlinelua_getupvalueluaH_getluaE_freethreadluaX_newstringlua_pushthreadluaL_checkstack_startluaL_optlstringluaG_checkopenoplua_newstateluaL_addvaluememchrluaD_reallocCIlua_isuserdataluaF_newprotoluaV_concatluaL_gsubluaD_callmodfluaC_fullgcsetvbufluaD_rawrunprotectedasinsetjmplua_sethookluaG_aritherrorluaD_precallstrerrorluaX_setinputstrstrluaF_newLclosurelua_resumeluaS_newlstrlua_rawgetilua_pushcclosure.st_intfopenlua_tobooleanerrno.ld_floatlocaltimeluaK_nillua_typestrcspnfflushtmpnamluaO_fb2intluaL_checkoptionluaZ_lookaheadluaH_newlua_errorluaX_initluaC_freeallluaL_registerluaK_codeABxlua_pushvfstringlocaleconvluaC_stepluaZ_read.st_llongfputslua_tothread_etextlua_pushlightuserdataluaG_errormsgluaV_tonumberluaL_checkintegerlua_pcallmemcmpluaK_jumplua_replacelua_gethookmaskrealloclua_isnumberluaK_concatsinhlua_getfieldlua_callluaK_patchlistlongjmpfmodlua_rawequallua_tocfunctionlua_pushstringluaF_findupvallua_identluaopen_osluaL_checktypeluaL_addlstringpow__cg92_used.ld_doublestrcatluaL_addstringclockluaopen_baseluaD_reallocstacklua_getfenvluaK_indexedluaE_newthreadlua_gettablefreadluaG_runerror_environluaV_settableluaT_gettmbyobjluaS_newudatasprintfluaopen_iosignalluaO_str2dlibm.so.2SUNW_1.2libc.so.1SISCD_2.3SUNWprivate_1.1libdl.so.1 ='zt Nq2T2`"33%-\-hr-t-s----t--?----d-T..J.Y.(q.4.@.Lb.X,.d.p.|G.a.._.k..#.o...%/W/ L/(/$;/0/<8/H/T=/`/l/xG//O///"//Q/O/e/1/i0U00 0,B080D!0P0\0h0tJ0k000.0d060l0'0001I111(141@71L\ @ "aD "a "bL, @' @ $@+`-` `?-) "D- =--% # @@Ð" "P  "T@@q@f@@ "      **`* @*  ""  "     + **      + **     **   㿘 "    //// 77㿘 "" "   ////    ////   7777 `" 2 2 *@2 *`2 *`*`2@2`""2 2 **2 **2`*2`*2`**222`22"㿘`" 6 6 6 6 .@.`.`.`'6@6`'㿘" &"6 6 6 6 ....6`6`6`....?6`6666?&`" 2 2 2 2 *@*`*`*`2@2`"""2 2 2 2 ****2`2`2`****2`2222"㿠  ;@  c@> 㿠; @ bX;O b @ ݁㿠; 9b\; #b@@㿠@; 9 "7@(b;Òa0@@㿠@@ǒ?@?9 @ À a4d@"\@?㿠@ @);?9Ò`!T@@? @@? ?@@ @@? @ @(  @c  㿠@ǐ;P"`@l 7O@@ ?f@@j @ @Ւ@ @ Âah w㿠``@  ```O`?%æ% @=ϐ@@ /`@`@&O@`@ ?`@@c`&O`㿠@@d@   @ D A㿠@@@@  | @ . +㿠;?`;Ôa@=@ f 㿠;À`a7? f@@)?@ @5À`غf@@?㿘`@7@?@q' @@?  㽘Ȓ bp@`@U@]"2 3p? @ @J@" `M@ d@,`@ O=@7Ò@`@D 㿠 @ɒ Œ @?@Q 9@t!@@Y@' "@$?`@@Ӓ?@0 @, @P@@6tOߐ@㿠; b\'b\;?@7a @  P @$@\@-?`@]@ @P? @ H?@ ` @א/ \z?O΀ 9 @> "p5 @@p3 &b\㿠;?`;êb$@ѐ.`@@@@`f@@??'@D`@6 @  @L ` `H` -@F`H`i@ `@?`-@`e"H*"9?`i@`l@#`v"H`0?+  J``@@(?` d@"`H2@?"``H` 2@?" ``HH``  "@ ?` `2O`  㿠@3 ;ø``b0`"@(  Me@l"@   L@  2H  M` @`  :2@  &O  㿠;öb@@2@O` @@` 㿐; @Y  w''bX @  K`@'  $\ @z @?* @t ϐ$ @A86@ $ `@`~`@x$@"`@$H`@` HH  HR~ 㿐@>@/` X'9R'"@אȒ@(@`@   @ *`  c8@# @g@3 ?`@@*` + ?`@H? #``@ @  X  ` " X" `?`@ 2@  H ?`#@ #8*@ !  d  (  2@  H`  Z`s `#  " 㿠#@@@&#@  #: ` :@@`H `.``$@@ ``@@H ``&  @`* @#``  `   `" X q` !`&O` 42`4 `X #`X㿠 `@ `D @@G@' %%&  # :` @ :  @*`  @ @     @ *O "  `+` " 㿠  @ ^v& *O^ ' & 㿠 @ ^v&&8O^ _`r `" 㿠'?@@  ( @-Ò@ ֒@2@  `` ?"`  `@2 `"@-  ` "H)  @-# [?@ r ?@"  ?&@   `"H   ` "H    @  '`& 㿠 Z w  '  & 㿠c82@ ?@Á*`aH 㿠e `@  ` @  㿐T `@ @.ܒ@  㿠 @ @  㿠6 `@ `@  㿠;%!c8@ 1#8@@U 㿠; c8@-8@@ @1 @   㿠;c8@@78@@0 㿐֒ `"@  @.^@;Uax 㿐Ò `"@  @.K2@  B#\\㿠  @ `2@  ``@   㿘 `@@.=@`f@&`  @ D @@"@`` &``㿠r `@`@`"@  `@ `"H ` @+R@-@  㿠E  @ `@`` 㿠2 `@`"@  ` 㿠 `"@  㿠 `@ `@`"H `"@   `@ `"H  Ł #` `" #H #L H; #  "   #\\; #  " `㿠 `@ `D*@ @̐ @&=% % `& 㿠@Á@܁㿠 `@ `D @@@t㿠'L'P'T'X `@ `D @L@L@b㿠 `@ `D @@ǐ@3" . " @&  ,` ]?s`#`#`2O   %% &  2`  3p?"" `"   # #  "   # #  `"  p@1` 0?㿠= '` '`@-㿐 1@_@%'' @-w & 㿠  @)P'` Z v &㿠  @) Z w  '  & 㿠 `@ `D*@ @ @(K% % `& 㿠 `@`"@       .``2@  '  '  &  㿠 `@`@`"@      #`#`     $$   ^`Hv`P& & `& 㿠 '`  '`@-* ' & 㿐 @@$'' ' @- && 㿠k  '` '` @(͐^r "  @   "@  ` ` "H `@ϐ ' & 㿠C  @(ʔ'`_`r `"  @   "@  ` ` "H `@ ' & 㿠 `@    @"@ %  @%#  `"H"  "H  @~ @$` "H  "H   @^  .`%` ' &  㿠 ڐ `@`@ `"@    "`   #   $ H$ P@  ` "@   `"H   @  '`& 㿠 `/`&@ @   @ @  &  ``@ 㿘@ ``} " .`'X⤨%'' %@ @  `  @  ' 㿠@  ` "   ' '  &   `%`%`  &  $ @ 㿘'7X'd  '@ O 㿈úbd@@4 @  `@ @ !`   ` @   L\l| 㿠7Y`  @=.`@@?' @ D' @@! D3  D c D. 8@' @ D$' @ D D @@@ `"@  D @O P' P T' T?㿠@ 㿠  '`@$V"@  & ' & 㿠`@`  @ D@ *@ @  %< `<@- .`#& H; b@" '  '  &  "@  `"` `  #` #` 㿠 `@ `D @@P@#  && &   `"@  `@`&@  @4H *` @Ö# "b @ $@@ *` @?"  㿘ϒ@  _`v`& & 㿘@  % &  \t $  ` @  `@ `H `@K` @ `` ` @ @ 2@` #` `` ` #@8 8`??㿠ߒ@?` `@ `* ` @ @ 2H" D " D " < <" @* 8  D 8 <  @( @`  @`"@ `@ (8O`@`(@ (UU~ 9 H0 9 ;`" "`h` d ``d # h  @ `` ` @`` 㿠@ V@ "@  @2@` ``%@>`@=@@úb 㿠`` (/ '@.Δ@.$?㿠`` (/ '@.@ . `\t?$? &&  `Æ @ bȔ? ?  $``    ` <$ `@  d@  <@+㿠;ø?b&  $&  & & & & &  @ <& 㿠"@& @! @# `0 @  ``@%" `"  0@&O`  %`%`  "  &@@@  `& 㿘2@N` `@u @?N`b􀠠l@ L@0SHf2H+ *`l@ nHu"H b`&`&`@Q&`d@ d@"`! ``N` 2ON`59ä?N`"`l@ `L@'`SH`f2H" !``l"@&`n"H&`u"H #`&`` d@d@%`$```N`2ON`㿠N``>@   ` " ' `@  ` (/`$@, @ b@ f@`2@  $ $ $  %`@@  ' @ L@ K @ `J `I `K $@ `J `"@ `H `J2@ `H `$ $@`, `0@"@`,`0"@`, @ `,` *@  ?`@  ?`@`#``@ 2  @`"H2 ! f@ @@ `! @ "Ha @  K@ @  @ ~ ( &@   K@ @   h||||||||||||H|||||tt,,,|x㿠#\ ,Y2@\ `@| ? ]` ,c  @?`&@k0 K @d@`@ @@! @+ U 00 ! !8`~@  :  `u2H?   0: `@3  (@ &H0  0 @8` @%`@ ,@ $H @ )  @ ? "@ 2@`@&O `"H   @@d@ @ ,@    `? H&`  &` #@+ @ @ۘ , 6@   `? "2@Ѧ 0`Hʦ @Ād¦ H@H  -` `H  K 6@ d@@H &@  K  6@ f KH @@\d`@  K@H? ??@  H @  K H fa@]  K? HY `@ K@H  @K ,HF  4@6@O  -` H ,6@F H    ?`@ @ ` @$O f@! f@ J @ J`@@  + H  K6@ \O,      ,㿠 ,p 2 3p?a@ ~ * ` @ @ Áb㿠`` @i`` `@c`` g@ &@Q8 ?@ @@.@ 2 E@ @62 >  ?1Ä((@&#2 2  @-`` "O`&2  !&ð  2 @  ,``&1è"&3Ác&7Á-Á 㿠`` @ ` ``2@`@$` @` @&``* `  ? @ @ !@4 4a    @ @ "@    O@  㿘'`/`;aH @    &@=  <93Àc$@@`$@` @ ``HÚ Ôd ƞ㿐;@# cpd@㿠`9+î!H/`.`JJ@c@U `$@P `  ``@  `@u5 Ē @ <Ē̐@㿠 t`@'   t` @@   ^v& _`u`%  $@@L   `&  & @E @r㿠'LL'P'T'X@Ȑ㿠`@`@ +Òcؐ@@ & &`@/Ò@4 & & &``@ _?v?&&  0 " @`UU`(>"@ 9`H0p " @ :9`"@  @"  @㿠 ( &  `&  @ʐ  66 4. 9Ґ& t& p㿠 p`"@ .  p%4  p@ X@ؒ `X @h'D'H'LD' p'# p@D2@LH&p  #@ : ` "  h@#@  8   2O ( 8@%   !  8` ?  ! 8` ?  ! 8` ?  (O  ;` `@ ? " 㿠5` @ ` ,-  -@ & @ ڐ& & ,-` & 㿠;` (b@ .` 0# (+`.'@.@ Ȑ& (@ & (& 0UU &=K 2  (=>`%@,%,&  0* "@)` ( & $ ,@ @ ,+  ,@ 㿠 0/ @   0 .` 0@@7Ē `' 8 D`@9 9@5`   % '%@''  UU (~#9`J 2 @ : 9` '  $a@@   @%. 9@ . 9  %` & 㿠`I@     $% &O`J@4& @ D@ @ @ '@ `@/`   "@`@^@r " &O Đ @~@#\ \: "   @. #@  %`] u %%  &O` @  & &&㿠@0   @&@!Đ < @ \t$$8O\  %@ @  &  _ u & 㿠``@̒ `  "  @b&@    K"+ 4@  K  J@ I (`@(@ $ I) &  $ $: ` :6  $@ @2@ ѐ" & " " &  K. "  & " "   @$ *O$ &  8`"@C   `& Ɣ?  &    " a@@  $  2@  &  "   " &  @" "  8 @ ? `@*   '@1 㿠  &@?  @ 8`"@   $ @ l 8@   % O @㿠 8`@ϒ $& 耤 & & @ @@`]?v@ &` @*O` @ ?`'```?4O'`&  㿠 4`/ 7`@6 4 4`@%Ē   4H ޔ@@$  4&6 4 @ D @@ {㿠  `@ &`”?"@ . ` `@ "@   &   `&   (UU'>K 2 >>`%@#؁㿠  `&  @u@&&  &@  `&  㿠 `"@ 4  @! ( @"H 4!IJ 4Ձ`@%IJ ρ 4.`'c6 46 6 %@ .  2  &` 4  4' 6 4㿠 6 4@.`/Ē\   && . ?㿠 4  ( 9 t&& t@ @@6 4 (@&  &   & . 9& t㿠@(` `@ `D @@s`b$`L`d@ @ H H@k" `H@   @~ $```HO  %%  %@  & 㿈'3d'aض''   t'@ i 㿠`@@&㿘/ 㿠'DD 㿐'D'HDH?ے 㿠7`6`K ΁㿘@`@`  `'' 㿠 ( @*   ``@@"H `@ "H` ``&O  4`@      @M&O 㿠` `@   0  ` @  8l @    @ ^ @` X&O ` @  $K`@     d&O 㿠 @@  `@  S <, @) H I J K   ,,Q㿐@ 㿈'''''’ 㿠/` `( @@ @ϔ / ' / 㿠/`  @. @ -`% @ -/`%`%`2O%`㿠  @ @ &' 㿠  h@" h` @@ @`:O  `  @ .  @ݖ  *   *  " `" '` x"  "  % '   #   "㿠``@  @㿠  h`@) h  @$  & h  @@@ h֐  ]t $ $ @0 h@ h :O 㿠  @ L@ '`'`('`'`4'` '`,'`0'`$/`H'`/`I/`J/`K'`'`8'`'`<'`@'` 㿠` `,/`@a `4`/`@[ `(`/ @U `0`. @N `8`-& L-@E `$`-`@? @= ``"@ ` `)` ( +  @( 8 @$`` @  `  6@"@(`8@ `  @ $O``"*`@   `` f "hDX(8㿠/g``/``&`@@.`ƀ```@/` ` "@` ` `@,` ```@ ``` H```ϐ`H` /` $'` & $ $'` & $ $'`l& $ $'`D& $㿠 0@` ``. 02O㿠  p`@ "@?```"@`2 @ ` `@   `@ @ `/```/``& 0@@'`' 0  0'` 0 `' 0`2O` "@8`"@`2`@ `` @  ``@m `@ ``/``` /``& 0 @@'`' 0  0'` 0"`' 0`2O`㿠` `@  ` `"@`` `@ ` `@ ` @* @'@#@" k2  3p?@ v2 @2? H`./  .```.` ,&`& ,@ @  @ `@/``  `@ `  ` H` ?2O`  `,`@x@0 @, ` `@??2O`f, ` `@ @ ` @  m?2O`H@, ` `@ `@  @  cN?2O`)`@2@?&@  `"@C @  @7?2O`@ @  㿠` `"@`(` `)``(`@  ` &@ `@ `"@``( &O``$ @  `@``@` (``$@&O``4`@  `"@ `` ` "@``@`ؐ`4&O``8@  `@ @ `   -`8 &O`㿠` ``"@`` ` "@```@0 `` &@ `` ` "H````&O` "@````@ `` @ `&O㿠 7 (   0@-#@UU&@ 09 >J 2p 9`9  > .@@ ?  0 $@ -  04<`f-  ,@  ,Z@ ,7 >`<㿠`P`@  H "@  H7  ( @8@   `@*H` `@(O`  @&@ "@ *O@&(O&㿠 $` /``@@ "@`a @- "HA`DZ `& $Ӓ@ ``/```*@ )`*  & $`"@``, `(?,`l& $ ('`l& (` /` z`0`,./`&@. x@& $`$`,`4`$. -`0- `(@, `8+`L*  "@ )`㿠 $`@   $`O  @ ` 2@``( ` @` 2@  `2H  ` @   㿘@;   `@ @?,` ?ƒ `f@#2O  /@`@. `@@ H%2O   2O hPtD\ `k!` @$+ @ @ '@g@`    ` `@מ`  @ў㿠  ``@-&@(? `@`h ``"@ ` `    ,`  & @@`$ `@$8O `㿠 ? `>:@ <`@$@ <4 ;@<@@<5`?@ 44<@v%@k4%&<㿠  0` 0@2@`' 0 p 0% p &` p! ` .``@ ` `@   `@ @ 9 @. 9 D-' @ ^u %  $ $  &  #  . 9' @㿠 `0`@   0O㿠  C?.@`@  @6 &O㿠   "@ ``"@$O㿠 &$&(&,p``"@pppP`&@  pH ` "@ pH `h @  `` @ `Ґ .㿠  x@ @`2@&H ` `"H`2O㿠 ې,&$&, `@( &$&( Ր-, .&& .D%&H㿘  `@ `@`"H $`"@ DU `@+`"H? 0N e @V  &  + g?  `   f )  D H @& H  D S (&  2@ D .  D H&@& H!"@ .  Hd(@  d H'`d& H d& L 㿠 5 T D @. L@/`%`' Ld@ @@O "@ H Ld:@ L D' @"$' L D' @z P6 K 2 4`R' @㿘 `   $(`,dd' d&`d%d$d$`-  @B O @6  OHzaP2J10 0P@$@  `@  `  @ *`  ` `*` ("`" (  "`#   *`*`  "`"  `@( `@$ @  + ` @` H ``H`    ` `+ 㿠7 =&@ @ F?/   d? w@ @ 67 K@ K @&@&㿠;$` 㿠 `` @@ `D&&`D  @ `2`O``+` e@ :  `  `?* d@ ! @?2 !:OcH  `  @  ``@ `"@) `"@```@`"H`` @b` @1 0?`` 3 2p?`  1` 0?C0㿘@Ґ>`@2@ J``x@JX2H@” #\n""\D>`L` 2@ M`' 㩚 @@  'N  2O O f@㿠  @y@ ' '   &`@  & 㿀;ĸ `@n %@~   &@ % %   # @l  `& Nf@ %@Oc"Hd"@ M %f@)p"H:s@E %`d@E //= 8   &@ @7   & +  :"  " `@$   &   @w r  / N//h@ %2O ^   / &=`=`?@ $&   㿠'L'P'T'XZL㿠N``=@ `&@ה.N`;Ā @@`ز`&@@ʐ@%@@Ɛ@ā&@Ðg@N@@ @@@@ a"@  !"@ ` `@*㿠;@)Đ 4b@*㿠 `<;Ā @ b$    `$<   @)ǁ㿠 @@ @0   @ @Ȟ㿠@0 㿠@ @@)x@)t;Ė 4bpK@)㿠В!`@/?" " " " 㿠@#`0 㿠㿠 0 `8`8W 0@ `8`  4b#m '``8@ @ -`%`-#@ ` `8@ &O`W 0`,%,$@`"@ W 0``@ 4W 0 7 0㿠 0 2@/Ĕ⸐J Ȑ 2@.7` 0 2@ @(22" *`(`!(` " 2O2 02@ @2# (2 *`(`!(` " 2@ 4O2㿠 `$`H @  3 @2@ @J`H&O`H`H <@ĔbȐ <`H`$ @ `$  `bԘ#ϖ '``$ @ -`# `$ &O``H`,`#``"@ `H`@ b`H. 3-`H-`. 4`H/`H 2@+ ` ``)  `( @@!`?6O`?  `@ ` @ ```@` ` 4O````  f@ *h㿠@ ϔ  @  Ĕ2@ Β   @  C& &㿠 0˖  @@"/&`㿠 0` @&@`@ @@#@ $@!@ -d@">@@! 44`+ 3`@24Ĕ b؂@'?"`*` 2*`*`  "`" 㿠 &   `@ # @'&  2& $@!'㿠 0`44`,@ 49 4"#Ö %4@ -!4&O`,`'`,`+`" ` `"@ `,  "@`, 4`Q`, $@&  ` H`@ `3`3  `  `d@@&Ә ` H&O `㿠 4  &&`  0&`?&` &`& 0&`&`&` &`$&`(&`,6`0.`2&` @" * K@  &` `% %   $`@   `'  ""  !@ @ג   ' 㿠 4/ 0    @  @ ` `, .`.Z'` O'`  '`, @@ `0 `)`) F'`;'` #'`0 (`@ @ `( (`,`, 1'`&'` ('`( , @ `4 ,`.-'`'` ,UUU'`4W 0@@`8W 0+ #@ )`"@`*) '`'`W 0'`8`H`@ `$`H`- ,'`'``H '`$ & 0% @&' @@ Q@'||/ J@,@bǒ!P|㿈 0@"<@,Ӑ@#Ԓ㿠@,ǐ@a 0@"H ]p 0 0`$ a@%`@-Ĕlؐ`ܐ`&` =@"+@4@"$`  @%$`$㿠` @@!ے'``$2@ `` `$@%'`$㿠`$ @#` @``@`@@!`` `$@%m?@ <``` @%c` ?'` 㿠;@` c@- 0c` &` `$ &`$x 0    @%* 'w 'Cشؒ >  0@!u  { }@+ a@`[@@, `=@ C ?Β ,Gڐɒ ;2O  } {1?ܖq/`* ` .@ $@*  +  @ 㿠 0 / J`)@5 7  ,,a@a@ Ő` J@+@%d `/ J J/ J J@%R J@h2O  2 J`&/ I 2@`ĺĐ' <f (@ -ĒL@%1 ה  S )@ !Ĕ! ' @Oʐ2㿠@ " , ,@ 0@  @ڒ2O 0㿈 0  (@{@$"@' O9 @ @ĒT@$ߐ@+ `)@' Ɛ@? ) ( `Ԑ`'@+`耤 @耥 @ 耥@?@ K $&`?` @#  @#$ $#@$㿠 `(@a@; @*̐@f ) ( 0@7c@$zp 0  [@ (@0 .H :H [@ {@$!"H#Œ @͐@! @*@ P @גH 㿠 a@a @`{@Ra"H3a @Ma "H!a@a@a"H( 0a@a"H   p  >`@*Mo@*H d @*C ^ @*= Y @*8 J`@/Ē@#  %  J.J@#$ A @* @*  !"@   -@`#  f@  !@' /@ +@ %"@N  *@?I  +"@F -H5A  >@ /"@<  <H57  >"@4 ^H'/ !@!@ !"@( !H## !"@  !H !"@ !"H !H         㿈 U @@) 0@!_ @#% . @@ @)0@!ѐ0@!@. O44'`64 !@"!`@   !"@ !H  㿐 0 @Ð 㿘 0 $@ ` 2@``@`&` ` `d@d@%``2O``@  $  @" @Uh``@` HĒc@"Ɛߒ ,@"'C耢@ 4 4# @   4# 4 0$cѐ 0ϒ ="H 0]$H 0 0&`$%`$ 0 $  0`@@ 0`@㿀O` `d@& 0@㿠 0`@ ` @ `` ``@` "O` `@5Œ @"J @` # @! @`@㿐 0@(y@Ð/ \!!@q@^!!U'@^㿈 0@   @(I@ǐ!!8`@  0@0 0@3@4 0@!㿈`0@r㿐 0 ! @  @!@  |@5@ @  @   ! @ ޘ@  @`@ސ`@ʒ?㿠 0Ő`   $@! ) ` @!{ ! `@!s    = ,~v ,@v @O $@ @ǒq㿈 0Ő`D $ ,@!=  `@!5 ۔ `@!- Ӕ ϔ : ,@pÔ`-O=!  Β @m & 㿐 0 @'1D `=@ `,@ a @  ;ŐX `p@ ֐!! ې㿠@' T!㿘 0?' @@@@ݐ O @@@@ܒ@&֐@ޔ@А!! p 0֐) $ג @ 4  А/ @~2/``-&-$`㿈  , gOa =@2' 㿠 `.@ .O`:@ p@&Wі 0@  0@㿀 0耧` @/+/ ` @- $@' 㿈 0@&% @6  ;@1ʐ耤 @耤@ @@t"@a2@?耥 @ 2@ 2` /`  %@2?  @`xxxxxxxxPxxx㿠 5z %@C.@@Ò B @%n!! v R K @%v! @Ԑ  h @% A 㿠/"  @ ;L 02 0@%$`O 4 4'`7 4㿠   > & (   - (& & 0 0 (.&-@% & $,"& & , &  , , @# `&   "`  & !    &   a@' 㿠`0`(/ '@/` `,` . 㿠  H @] '` '` / @T  `&`&`@ @@b@]   * D- &@"  " " ," p" D* 8" <* 9 <" @" h" 02 62 4* " " (" " t" P㿠  `4```/  4< &!x&<  㿠   x+  N^ HvH P&P 8.8 <&< D&D<&@㿠`  x Ȑkx㿠  !x@`x '`  !/` x/` ` /` ```/`$ !x $   $ p$ $ $ @$ $ $ `$h$ 4$ <$ X, $ $ $ $ $$ ($ ,$ 0$ D$ P$ T$ L"$O"9{ ܔ @l 㿠 9| ,`p f뒒 & t (&  `& & 6 66 4䵔 2O (E㿠 ` @@` c@ .`    `@  $ `&O"``@  ` "@ ` -"# 2O ` &O```.Ė $`$`㿠@  "  " @   *  * *  @, , @ '`" ` @ 7@/ 㿠6` @ K6 .@ @ O    , @ @ @ @є@ 2O    `@@ / 㿠@8`  9  ``* `* " " "  p`"   p%`㿘'H7}'L0H@@ H@  `` '$O   - $@ @H.` t@W@$@.` ` @@"@$ 6 @"H  /  `*   (`   )@ ?( (@ " @ H(` r Q@ "(`  +@ !`@ @ `H* pS@ *   `@  DDP#\\`?`㿠`@?@`@@ @` 2@ ``&H``@ ``O`9Œ | ``'@= =`㿠”` @/ ` ` @ ` &O` ` #\ / \>&` _@v& `` ' )@ @ ) `  @  ` )@&O``) _v`&`_v`&  ` `@    `@ 1` @ : ff `@  )``1`@ ;  &O "`㿠D@/@@ * ``&  㿠     ` @`@@- `   ={$O` ```, &``O 㿠   /@@ ,`@ 2O&㿠;c@ .` `-`x&` m&` `@ -` %&O` &`㿠@#a(&` +.`  @ %Œm.+c@. B 7@&` ` % %%&O`.``.&`㿠```@@)@$.  @  @_ r  " O!# @/` .$ $  - @.`@ `@U]`r `" %` 6O`;a(@@, ҁ`a( @  ` )@ 0'  ` $O%`'̐'%y㿠    % ' / ;' a(' / ' #㿠`a(@  ``--q ` ` . i g # "   @  ` @ "`  @ 8O   㿠Y @!!(@ 2@-^ڐ@y@`C@@@2O&_`w _`w _`w _`w '`'`^`' '`^w`'` @ @ `H폒㿈 @.` %`#pp#`#d;h`dh 2@`` B#h``2O`78  ` +  @ ) ` 2@``@ 2H``2O`c8 㿠`@ @ "H `58`ՁB#\`Dp\ @   O ;c8㿠Βc8@.`@/Œߝ/@ @H9Œ ߎ 㿀9h#8@#\ \?' 㿐9x#8@' '㿠`; `@#7,`@ 0 O,`$@&   `"@$  2O$$@ @@6 f@d@$@`O@ `@"` +`@`@ @ 2 ! )``; yTyD"@ O@   a( H  㿠 at at@  `F ` &`  ` ,$O 㿠ߐ `@  /@  . ``@`"@`  `` ```*``@ *   c8㿠 ;  a  㿠@ i @;Ųa㿘 O㿘 `@;Œa֐㿘ٔ 㿘є `2@   @ UÒ '`㿠ΐ; c@    / &&`  / &` &`,` 㿠; c@  -  &` &`@ &`(`  @  "``&O`@9 Ū `   b @ "@%%  @  @ Hp2 3p?% % `~= %  `% % `C`&O`\% @  /` 뵔 &` &``@ &`4  `%@ &O``@   ` @`%&O` 㿠-; c@    -`녖&`z -`&`&`0`UU aU@ -  (k &`` &`@ &`8  ` "@` &O`@  `#`@ # `@ ` "Oܐ' @@  ,  5 &`* &` @ &`$  ` %`&O` @   и `&O㿘  4`.7`@7 47Œ   "`"` `   `@ U   $ '` `` ` d@ # '`<'`@u/`Hr/`Io/`Jl/`K<n@'Œ(B &`%  4& 5 4㿈@9; @  @;Œb4&㿈N`@@N =@`Nf@d@%`7ŦH$'''';'АbX p㿠 #\;Ÿ Qb@ @ .  . K\. . . . . . 㿘  @`2@ `ݒ@ >`&` p``"@` ';Ÿ'b\ @@w&`&` 㿠 8 `@ &  @`@ < & @ݮ?`@+  `  &@ :`  :`?@ ) @@@  @  '>`H ݂㿠 &@ ^w`'` ^u`%` _ t  $(  $0@=  0&  " 07   !`&  X`p`#㿠 ^`w``'` ^u`%` ^t $( _ t`0 $`8  "@@    `@&  !`@㿠;Ÿ` bl@&`ْ  @``@ ``  @  ` `Ȓ `2H`] v` &`ϔ  @ޒ`@ d&O`ۀf㿠;Ť`  bd`@5 @`@ `` ` @  `  `~`2H#`_ t $  @  @` H諁v @څ`@ ``d&O':㿠Y `@Q`@  㿠@  ` ,@@   . @@ @@ ` -@@  ` .@ `@ f@㿠 `@?ڐ@?  `@ `2@   @  㿠  `` @ޒ@@@"@? &@͒%O d@㿠`"@`@`a `@`2  ?H㿠`"@`ہ@`c``@ `: #3p?c ?@Y ?H d@٭HpT㿠`9!@_-@ `@b``5` 2? `@6 3p? `@ `` Ӗ ` @ `– @   @  ` 2@  `@  `@4 3p? 㿠 ?  . 耣@ 耠`@ % @%2@% %[@SO? 2@ 耡`HF?% A?` `@ b @@`$ @L %`&O`  `4@5 @- %  @  @@~`6O %' ' ?&@&`4O tP(@N@I%`'  @N.@ B>`&` >`&`  B>`&` ¬ >`&` ;x ;#p#tp@7tx B>`&`#h #l#`#d`hl@(d>`&` >`&`@H<h4 x,|P  p ( t  x PD`t`C0#\  #` ##d   )?`    ` 8 @ @@& @ 8`H5  `@ 5 $& 5  ` ?-`%@hGݓ*`@@5  !(X@v`&5  *`]v &5 a&d&5 f@5 a)`@#`#`@ G#`5  ' Xv& 5  '-'@& N 5 &  5  ( (@@+`@f@9  5  '* '& s s5 g`^u%&Gf"Ga ` "G].X5 & 5  a)`- @+@ `@ a-`f@f@ = =5 a5 弬 a幐&&&  @ D *G& 䂐 "5  !+ 5 ]@)`v@`-`&& f@  5  a ` a- -@ 5 f@- `*`@f@`2@ & `2@ & U>&C  5  -`* @ 5  ! f@ !- (`@@f@ 2@ & `2@ & >&  5  a ` a-`.`@5 @ ! f@ !- (@f@`2@ & `2@ & T>&  5 -`*`@5  a `f@ a-  -@ f@2@ & 2@ &  >&hŘ  a5  ! !-(`@5 @ f@ * `+ @ f@ 2@& 2@& I;;x#h#lh@lx [H>&3  ,5  - (@ 5  a `f@ a.``+`@f@ 2@&  2@& ''''@>&^  5 a+`@ 2@& >& H  5 (`@`@ @ @  &d&&d&5  + @@"@ & #xx>&` c"½\>&8 2G Őbe 5 &  !5  !%@l @ D@ @- ^@@u@ %}5  .` v5 &  .`*@ 5  ! !f@) @ -`f@`@@  ʐ@ @ @2@  5 ( G5 & 5  !+* @.`@ `  !-`f@ f@;2@   5 ) #5 & 5  ! !(` !(. @@ !+`f@@f@ >2@  5` *``"@  `2@  @ 5  5  "G0@-5  !*`@  @   2@   `@ 5  5  a@"GɦZ v &0` . 5 p a `+`f@  ! 5 &  ["H\ "H#\ &G  &  5 p (f@% & 9?"H  "H6 $ h`"@```#`<`  '`&  @ \q`!``  *O\-@& '` '` `'`  `& F N5 p a ,f@  "!  h@& ׽\@ #\"G)  `& $ 3 c @V+W!5  +o5 > &>0)`&8&  @  @Œby@ @Œk`@ ڒ@ Œ#]`5  >&. ^ `0`0vP(&X^v@&H^v05  !&8& & }  @`& `"G[`s`#6 @- 5 5  a@   %8``& 8`?2@ G*# Ι+`  *@ @G-m^`r `" ``@ `@ @PGi&`c5 @-  H {@"    ?`2@ 1`   % `1 `(@ُ%@&O&`&&  @ `D*G,  ( 5  ! @;` I @; @"@& -   %@@@Ò @& `G @ - 6@ &# [@@v &`@G @㿘   @@@ '`& &  & N`?㿠 `2@ ?2@ ?&  &`&  O` "`"`"` "`"`㿠@?@ @@   @@~g @&&  & O 㿠`@`  e@`@``ޖ&`Ӑ&`&``0;` @ c<@[@~2@ @`@H```(d@`,%@9㿠;$2c㿠&8;@cΧ`@ِ ȡ 㿠'L'P'T'Xܒ Lȹ˒ ˫㿠@ @ @ @ @}@  2O7Ł7Œ㬐Ȗ[㿠;?`Ƭ?@ ? ' Ɛ?`ɖ 㿠@,@9? ֔?ޔ?@ђ?R 㿠H@;Ųcz㿠f@J㿠[?@;Ŵc㿠4@1 㿠B@ @@ @|&㿘;Ւb;` B@ P@ `㿠'L'P@LP߁㿠Œ@ /@ 㿠@㿠ȉ@ ǫH?ߒ?@,? E? 㿠@ 9? @@ `@Ҕ@ ū ɒ   @ `@    `2O 㿠?@3'@!?Ů ?@m ܔŋ @ؒ?#?`@[@%Œh??nޒ?@?'  @R OIOO ğ㻐@{@@{@%@@@{O%@@? 㿠??@{ .@%@{̐%ƾv @ZM   .d@dž Ƨ? @ \M  `.Oʐ 5?㿠  @2@  Ƃ&  `&  㿠 `@!  ? Ԓ?В %` @(@  `@Oɗ '& 㿠ɐ@Ԑ 㿠@&$  *@  & N``'`.2O 㿠@{6㿠  _ & 㿘  U? 'd@ @{K @& ð?{@ے? & "`` "`"`㿠@ 7?@Á @6?@Ã??Ơ ?v?`@ ƓW $ N㿠@@ 5?@E m 1 Ŏ+㿠``@ &`+&` ` @ `` @zȔ$& g㿠; @zc;Ƹĩ  `Ś) 㻘9ƀ`'  $@ V  b`' ŀ @z@' ρ`@l$` %  `#@ ' @c' ` `@` 2O` H ``@V!`" `@`@ @zf@'@F#$ @`2O' $@zN?/ 70Ǒ` @ @z?`@ ˆ ,gœ@z0`#@z+@z&`@z!``2@` ""``㿘';'bN㿠@y㿠@@y @y㿠?ɔ ; b;@y`X 㿠;cْ @;c@㿠;a`@ Ĵ ąƘ  2O @ `@`@     @1  `2@ 2 @'( `  )`@ ?`H `0@H 3  a` H   H `?+ * !`   @㿘 ?&  @ '@    @ݞ㿠@֐߁㿠 &` .`9#@yF@# @ @1?,-@ @& "   *`? ?`   ?2)@@`d@  *``` @  ` ?H#` 㿠@ `? 2@  ͒?O 㿠Ӓ  ?@ @`1 @ !?` ?.# @   '``3-`c6 @'` 㿠@  ̔?O㿠@}@NHO㿠 ?  ޖ &   @@  ͞㿠G @㿠@`?2H`&`5?@  /?2O 㿠 $ K@ @/` @`/`K㿠 $@& $a@  2@ @ $" $`` @`㿠   `( 2@ ( D#\\:  " `( ( @ `(`!#, $``(@ @ /`` `# `(@ &O` (`^-@u$ @`"@  ( ` "H (ٴ (`& (㿐' '㿈'H 'LH?'㿐' '㿀' ' '`` @ ) ` @ `+  )@   `*` ``H) ?*` `+ @  (  ?`)`?  ` `+`c  $ * `*` "`` @  "` `* @3  "`` H ?@` `+   ) ` `+`" "`P\㿠`7h% @0/ @@ *&``  `@ $ &`` @ ` %`&`` `ΐː  @w %&`㿠 @eh P㿠9`#% @L.@@ `@'`` ``1 0?`@8 2'`` @<`*'````  @/'` '?? .`` -  @ " '``@`` @ '` &`㿠`` @;  $㿠`` @`````@6?`?X2@ ``RH` @?ِ Z  T Ē ``?&` &`$`&`㿠ݒ  $㿠`` @``2@ 2``H ``ג``` @۞ʞ㿠` @' `(H  (́ @- H3 (`@/`2@`+`$ @ ```   $``5 3p?` $ &``a`@`㿠``@`@ `"H-`@` "H&r`x` @  m`@   `` @ O㿠`V F $% t` @ܔ6'`&`㿠 3` 3? -`?7` d@. " 㿠`` @  `- `?@ 4` &  d@ ʁ ` 㿠``@ `"@"?`H`"@ ?`"@?` "@ ` ``` `?|`n&`㿠``@ `"@?`@ `"@?` "@ ` W `` `?P`B&`hxhxx㿠7`H% @"/ @@ &`` &``A`` g`  @ % &```&`&```㿠 &` &`DXP8@Q@L+& `ap @:/ @@D7 @4 @D1 @- J#@+ā /ᘃ HP ;x;#`#d`@t dx D @#p#t#h#lhpt@sl @ @ 1! @`bP `P> 㿠@(`@ `@  @ Β˒ǒĒ  @`&&㿠@`f@ f@f@ c&&㿈?'' '@ w`@`"H@ } x`l㿠9` @.`@@[G@wr,@Th|h㿠;`a@.`  ϐ_ u _ u _ u    _ u _ u _ u - @$ `  .@`?@ %??   -  ,@,  @  *`!%  % ג    ށ ف ԁ ρ             ` +` "㿠 `,`@ `,` `a#Ӗ $` `` -`$``0@ `0`-`# $```.`%` '`* + @ *@ Ǟ *@ *` 㿠z? K 2 ?`? %d@@  "٘ ` "`ј   & $㿠 <``@%` @'ƒ@X `- @ `4``Ԓ$`ԇ`4$`$``$``/㿠; bb@q ` * * $Oa@  ƒ "` @ 4Ҟ 4` Ξ*a 㿠&a`@  <`ށP @`;տ P 4b  ծ@ / 4,բ 4ƺ  ߞ㿘 4⚐ 0 `Ŕ ` d@d@&%㿠  8&@ & 8``"`I` &  8&  "@  2H  @"@  8 #@ $  8 % L &  8&  3 c@& ;Ʋb<㿠 ..`D &`4! &` &`8&`0&`&`&`@`<`<`4ӻ `<%``<$`8`$  @ $``8` #`K &`b`8&`㿠@p 2@   8%@ & 8 ' N`& D 8&   <` <``@*`!`*@; J: `8` { ""`)`2OJh㿠@qN D@ . O . DN Dې <`ܒ@ N D;ƴ!ϔ .bX 㿠;  c 8%@ % 8` H` &  8&  @ 2G  `."O ƺl@` 2@  `_@  k 8 #@ $  8 % L &  8&  G _"O N N Ds . < t@㿠   9 8&@ & 8"J `&  8&  `=@ ! 8`#@ $` 8` %`M & y 8&   ="O  ?'@@d@㿠  8 '``@ '  8 ! H& X 8&  ` @ Hƀ`bt@2@e  [@ @ @@ "@?C [@ ]H0< /! 2G   8$  @"' 8`$`K `&  [  8'& ⤐  [ `2O   6  8 @  8`"J` `&   8&  [@ ?@2 @L "@K2 [@ ]H + *2G  a 8`$  @ #` 8$L `&   8&  2O  ! > 8%``@% 8&   8`  `O `&  ' Ȑ @d [@ @X @: "@9? 8[@]H*8 8ϐ2G   8`%  @%`' 8 `' O` & \ [ X 8'& ⤐R [ 2O Y ޒ  <$` @ 9 8&   8`"J` `&  )!  [@ @o @Q "@PV 8[@]H O 8m2G   8 "@#  8&   8``"`I` &  Q2O   8`%  @ %` 8 `' O` ` 8`@ &  <,  < & &`e  <% `%  @ %` 8`$L` &   8&  ! 㿠 B 8 '``@ '  8 `' O` &  8&  @7 Ƭ bȀ @@ "@ @ \"@ 8 }! w! `&@ ` 8` !`I & f 8&  `f@`a@ @` @9` "@8< `a"@ `b"H 4 `t@ `f"@ `n"H `r"H  ' `t"@ `v"H  А 8$``@ $ 8``%`O` & i ' 8& d  Z] @   8`#  @ #` 8`$L` & G  8& B  -` @ 8)  @'``@ '  8"J `  8  @&  `O-``@!ƒ"ܐ۔!p l 8`'  @ ` 8` !`I &  8&  2O0  T 8`#  @ #` 8`$L` &  8&  <` <`% Ɛ&㿠 <7 '  .@ "@ ?"@! @# @! "@E '@C -"@ 8w >@ .@A <@ =@l >@ۀ [@o ~@c  ``@  8``!`O` & \ 8&  -@P 8#  @ " 8` $`L & G 8&  [2@  <@ % Β  <%`  "G  "O  "O  8`'  @ ` 8` !`I &  8&  ` "O{  "Ow  ?"Os  8 -_@!@ [Ɛb! 8 #@ $  8 % L &  8&  =@ = 8&@ % 8` H``&  8& ! 8`!  @ !` 8`&O` &  8&  =@ < 8#``@ # 8$L `&  8& ! 8%``@ % 8` &`O &  8&  =@ > 8 @ !  8`'`J `& u 8& ! 8 &@ #  8` $`L & a 8&  =@ ~ 8`%  @ %` 8 ' N & J 8& ! ! Ԑ 8 ``@  8``"`I` & , 8& ƺɐ@ Đ!!f@ @ .!  `@ 8`$  @ $` 8` %`M & c  8& ^  @! @ 2@  `_"@   8 $@ %  8`&`M 3&  8&  d 8 @  8`"J` `&  8&  @ G _"O  < <`ϐ  $@&` !!㿠 &  a@ !^ v ^ (v &  & 㿠 (& 㿠79?  `@(bp ?0-   @`@8@j`@jw?@O< +<@jӒ C0H  @  4 @F''   '`"@Ɣ#\쓒 @j@&% M  @`@ 'M `2ONH#h9" hF#`#d`dV L 㿠     @ @ 왒 i㿠 ? 6 @;! cp 㿠    ƀ @cp @`  톒@`$} ͒ 8c  @` O@ _ H@3Ɛc ;P@c? ݐ7?@ ?㿠ƒ C?@;?` ޒ? 㿠 쫔   6 @ 9"x B@ ?1 ?@?H;ǒ` 㿠섒 쁒  4  㿠 h p  -  㿠 X ` ]   ɒ  㿠 / H ?P㿈;ǐ``;b 뽒  잔 / @"@#p  #p+#t`@ptHL#h#lhl  p#`#d`d 㿠 ] k 㿠    @ А 㿠 Ԕ ;?`*'  㿠"  `뿔 ’  ? d@㿠 뫔 ;?`   㿠@ ~? 㿘렒  맖 ߒ㿠  뗖 "ԁ㿠;ǐ`[    Œ?@& ?@U  ;ǒ`꿐 㿠;ǐ`Ԓ d  ;:  c 㿠  M ԐԒ@M ^?Ő"㿠 F @ Ǻ` ( v㿠   d Y  @aC @ %@@H9ǐ@ @O9Dz 7㿠l"   @  J `#@? @f@;ǐa騒'㿠Ꞓ ??? 2 3p?`q /㿠ꈒ 4 e  ?ז 2 3p?`n 㿠;m a$  @C @ @& @) @ "H " o  r 53ǒ8a0f@_ 7ǐ@=  ;aD^ 㿠 ̒  E @3o @ 7? W? t @ ;?`"?? @;ǔaL   8@  "@  "@ 2 @ f  d@㿠u @3ǔbl賒 ;ђ* cʐ 㿠;Œϒ@b@ 9-#?Ɛ0@ @?۔  @Րʔ㿠 @;ǔbl\ ?@ ̒ .? Œ ?'@& 㿠;?`ې@ɒ?@ w  ?g G㿠v   @H;ǐbWh 㿠;`hH  㿠ׁ㿠@Ԑ 㿠1 - ?3㿠;?9`;ǒc &"u͔  /5-Ӑ+ ܖa͐  ??'h( , 4㿠;ǒcX;c; 㿠;?ג` 㿠肒 y @d 㿠 В @ @;ǔcdm% ߐ 㿠y  㿠 I  P @;ǒc|糐 㿠d?㿠3?㿠   2@&`&`㿠@ k???w ?i8;ِc` `@`\@ِ F 2Hq?! (9 ђ@( ͐  @d S@8w@sLxXthg@dʒ l@pg@d u@|^@d n@ LH@d L@c@d f"@  Y  v8:`繐ː@ 3Ȓ`\^`秐+@  k? + 8 `爐@ /Ȓ`\-`$ ϐ j4 㿠]   { @` @ Ɣ` Ԕ`@ ?'@ʐ` Ԟ㿠 ܒ ́㿠;c;?\`V?$? @`/ `@`   㿠 @c˒ c@ @cŒ r@ @c l@`  f  @  c*` @  r*@``@f@ f@  l* *@h㿠;c;?`5̒? @?5? G ́㿘#`@   ` /`K  . `昔 u?ϒ?c 㿐sj@ 9"@;Ȓ`  ?ÒaU 㾠;ȶ`; b@b?@b @13 b`  @b@)@b!@    H ? @bђ(@bΒd @bȒ @bǔO֒  8 r(@  D? d@0Ȁ @ؒ  H?  `z Ւ@n @% @# ɒ@ X _ "@L  2O B I  $= (s @ ,lK`@ 0dL`m@ D[M` C@ Mt@ XL T "IiO "; 㿠;ȐaH;囔c 㿠; c@c  ː@ @b19Ȗ! @b';ȔaŒ 㿠; @bc;Ȗa? 㺁㿠;?䲒  Y `;ȮaS@@?T?@@7Ȓ  9Ȓ"  r 㿠;ȐaF  `@ 㿠;? " 9ȶ`!&?㿠J;Ȑb8c  㿠;Ȑa    " b㿠;Ȑa   @a ' 2 3p?`Q㿠;U bT?ݒǒ㿠 ?@;?` 㿠;Ȑaߒ  `@ؐ ȝ㿠aВ  @``   `p7 㿠  ;ȴbx  y@a@'  @  㿠  ;ȴbx ; ]b|7'  @ ځ 㿠M@a1'`` @  ˁ 㿠;?`V? @ .`;/ȸ`X 㿠  @";?Ք @@`'  @ `ɒ``D Ȃbx ΞȂb Ȟ㿠;aْ 㿠ѐ   㿠  @ 3?`;G Őbx@`&`@f͐Ĕ㿘;Ȑb@` @  㿠` @&``&`@`f   7 3p?@``㻐䦐$@`$@@_@ " M 2H '仐 '䉐@_O䫐4?2 3p?㻐А$o@ g@`@'O䊐@ ?@  㿠?` ??@ .` Y` )Ȓ" q@Mߒ @@e1+ @`M`*"HM``cM`n@l@ a"H`$1 V ?@  O` =` ` @  H@ݒ?$㿠 r 㿠 }㿠7? @3Ȓby @ ; @_Zc9ȴ!k@ '@  @ 㿈? @2?@ @`@'7'@^ސ@  Ԓ`@  @_;@  ?OӐ ǁ㿠  㿠# 㿠;ȶc;–`p  3 `d/ @_@  @_| 㿠;¶` 9 /` Ҕ$  @^ 2 3p?v㿠 @^h 2 3p?`j㿠ΐ@^] 2 3p?`_㿠9ºa  ?a?㿠" @ ?}?9? Ôt?#x㿠  d ;Ȳ?bTj㿠Ɛ;9Ȓ`8;?`#7’3᪐c/ ݐ`  ?  + ?`ݒ 㿐 #h#lh@^Ql#`#d`d 㿐 #h#lh@^Cl#`#d`d 㿐ޒ #h#lh@^5l#`#d`d 㿐͒ #h#lh@^'l#`#d`d 㿐༒ #h#lh@^l#`#d`dr 㿐૒ #h#lh@^ l#`#d`da 㿐 #h#lh@]l#`#d`dP 㿐 #h#lh@]l#`#d`d? 㿐x #h#lh@]l#`#d`d. 㿐g #h#lh@]l#`#d`d 㿈V ;hR h#p#tlp@]t#`#d`d 㿐? #h#lh@]l#`#d`d 㿐. #h#lh@]Fl#`#d`d 㿈 ;h h#p#tlp@]t#`#d`d͐ x ''@]}? 㿐 #h#lh@]ll#`#d`d 㿈 ;hܒ h#p#tlp@\t#`#d`d 㿐ɒ #h#lh@]Gl#`#d`d 㿐߸ #h#lh@]9l#`#d`dn 㿐ߧ #h#lh@]+l#`#d`d] @ !TD-@f㿘;ߑ c;cȍ  #`#d`dG @ !TD-@f㿘;{ `;`  F#`#d`d1 xj ''@\''' 㿐U ;ht h@\l#`#d`d 㿐> ?@ 7`  ĵa>O 㿐  ?@ `  ĵa>O̐ @?p@\)": K@30 : ? &-&@"#;`a@ @ "@*N'`d   @Ȑcݧ #`X#x#|x@[|\## ߒ ے @'@!Ȑ#݃ #` R#p#tp@[t#V#h#lhl[ с㿠޴ @\$ @ !TD-㿠;ɶ?`;”aLH a:  2 ??  㿠; c@  @[z;ɖ`Y 㿠  - @[  㿠  @[д2 3p?`ρ㿠    @[2 3p?`㿀@[2 3p?`@7ɒK 㿠  @Z A.㿐@[;#hb8h#`#d`d 㿠? 㿠@&?㿠?G@?<?㿠?/ @? @7ɲ܁?ɐ }  @@[1 '݆ @#\\'N`!@@[&@[$@, @ZZ@/  `{`w` s `o``j` 'le`(``0[ `8d  %//N@*N %@N`@$N$ ȶ/@ZҖޱ쀤*@NޚN-`'N`2ON޸ P0 @@Z 2? ;ܽ as 7 'ܒ2 '- '?''"?'8'4'@Z܀?2@#h h#`#d`d~ 㿈ܴ ;h  Ò h@#pD#tt@Z\p#`#d`da 㿠  ;܁ aT;¶bL9ޒ * "4@ZC{ 㿠 ܵ @YO㿠;ɐa;bh 㿠 5     + @ (_?2@   ʒ?O 㿠     0 @P ?LI 0P?2@  O 㿐w Д Ð @?+? @ В?` ¹a?  O 㿠 ۧ   㿠 ۚ ;ɒa   㿠 ی    3 "@ "@;ؒ f@@NO  aց㿠 [  ͒   @@@&@@`O`-ٔ  㿠 ͒?@ ?;bڐ 㻐;ɖbT4     v k @t V @  ܶO@Ȑ 㿠|  y㿠7 @$ !  ?s?㿠@@Ť??  ̔@&N?&@@2  : f b@1 P@?@{ < 4y` *w@@ɒbXٷ cO ?? V@@ɒXٖ?֒? B?O@1?  ܔ!&$dfddf>@OB㿠  ;T b| ̒ ( < @Δ  㿠;ɐb;ubȁ 㿘Β  @ @ f 㿘ٷ    ?d4H@ @"& 9ɐ"  㻐ٍ ۍ'  @'@*@$N@. $''O@ 㻐f f @ *@O`O`@W2``-'*O 㻐? ? @ *@O`אO`@W``-'*O 㻐 Z `@ ھ?4OՐ 㿘   M 0 F)`d8H@@ "+ɲ`@@bؒ6ذ`@  @'`O&OM㻐W`@  @@-ɔפ @ N. 'Oo 㿠K 㻐 w ;- ڋc42@;ɒcېM  @  @ @ )` @ c ׿ @)`  `@"`6O`  ɂ8פ㿠N` %@` ["HO`O``2@$` 1ɺ`ב#P)ɀ^#t"H`O``2@O` ׃O`%@`O``f@O`]2OO``(@Xp㿠@UՐ" a7P@L.@! # `7-  # ` 1-   +- + c %- /  - 9 #-  `-  c - ! # `- 6 - 2?`@ @` d@@4 3p?㿠N`` `^d@d@`@@-O` %2@ O`O`` `H`-@`:@O`L 4H`L ` H `O` @ `@*OO` f@J` ."@  %@ ["@ " K`K` `Y  ` 2H㿠N`"@ N 2HN` #֗cN`N"@N N` @@ O`2@O`?2H`` @`d@ @*OO` 㿠 @@ N` @` @@ M` O`@ @s@' O 㿠@d@ @@N` }@ `@R"O  㿠 ` @-``- @%%`'` @5@` ?'` 㿘S*   ?&@' @ `d@% 㿠%*  ' @ @SƔ@@ 㿠7 O (@ "@$"H`O %"@O d(@)"@ ]O  )@ ? ?b@f"@O 0O  "@  O [@   զc @ @ ' N'  2@b N` "@Z O @ HO  `"@K  O H @d@̒ @@ N` `@ N N-@*@+@-@?HGp`h"OjO ́"@ `ǁ@`WO  㿠@@@'` @@N@S@@R"@&&@ N@SO 㿠 @@ `@ & -ɲ .`@3 c2@   'o y㿠 `@`@    ;ɔcJ @  ĖO㾈Z U  ը ?6@ ` 8H`@ b @ɒ@S"2HL`#eHG"`@  L`'^ ' `d@'d@@'@*O'~H`@$& v  pŐ   㾈9?     ''@'א@@'<@(O'%`d@ . 㿠 Ԡ  Ԝ ;;  b(Ӕ  ʂ`㿘  `@B9  L`&d #%"@``*@`` &`L`) '`L` `@`*@`` &`L`- `L``0@ `L``#*OL`㿠   @"  @   @ "Hj M   w 4?@ ?&?H9O?\ 0Uс㺀    6  5 M ^d@d@@ @ @ HʐT ʐ''@@V'`@,'3@r`@(@@䀧@@: *@O`DO`@`+`'&O') @H  @(@䀧@:H*@O`O``-`'#6O 㿘Y`d  @ "`&`( ``@I'5ʠ \xO``"@ `@)` @ ` "@ )``"@`\2H$``@*@`֐``&`*``*@`̐`&`O`*`Д `ʔ  `*@`Ե`&`O``,%'2OO``*@`ԣ` &`/ 㿠N``@N`-ʪ@P@& N @ &N @O2O & @9ʒ 4N  㩄 `2H N @ 2H N `.2@N N   2H N   @f@N `@ %/ʒ .& @O̔.㿠@O" N9ʐ'`@O ..PPPPA8V  T@@O` %@@*@O`O``-'@O`%@` @`֐N`+ `'x@ܤܐ -J  X$`E3@n-@ @ 5@#\\@O1Ui(@#\\@O$H\'( F@ ܃@#\\@O7- ܁D#\\@O,'А'@N u!@ؐ˒@Nݒ .@ ؀`d @Ӛ @ܒ@Nܔ@Nܔg܀@*OeO` O;ʒ`v 㿠 s ;ʐal? ;Ւ?C.˒apђ%㿠;ʸax;”c????ѐ 㿠;ʐa^ : 㿠;ʐaV : 㿠9ʐ!9?} ߐ?@??5? " ҐYkb㿠;ʐaؒ  `@ '  㿠 `@'  `2@  @ :  㿠    ֒@ ;? aܒd@ 㿠;@Na쐐@ @N 㿠N``;@`N`;"O`N` @ @Mʒ ;@'@@M@'@㿠;ʒa9?ѥ 9?͔ @( Ē@#?? ,у9@0. O 㿠  ?; b4ϱ㿠 M ;ʒbd@ ޒ@ޒ 㿠7@MM -  f@|3W?㿠  ;ʔbr@ ْ@ 㿠  @M .@" ;?* bI@ Ғ@ @9ʐ|"  㿠 Δ ;?`;ʴb?d @X@,ޔ 㿠 ϩ H ;?`;ʦb= 9?@#0?c@w%ʒ 7?4? ϒ @-ʒ<אXp  ?5@ ?/ \οt   @ߒ@ `ِ?`Ԑ5² O b @ x ƔÒ@  _ e 8l @9ʒ#x@p?H;ʒc|\?<㿠 ?`@ + ' O㿠;?c?  @L .  d@&?㿠 ζ ;?I7ʪ `KG? @B?/?Ŗ @9ʲ#Ӓ?ٔ3ʐc&Ւ@"??_ 㿠 R  S @ ;? 5? `;cܐ? 㿠@K^@[?9ʲ?#A<?}㿠;9a7’?Ő!e @l㜒H)?ιY?   0`@ 00`G ``2O`\?/CP\< H1 (  P(  ؐ  㴐l l 㿠 㿠$Lua: Lua 5.1.4 Copyright (C) 1994-2008 Lua.org, PUC-Rio $ $Authors: R. Ierusalimschy, L. H. de Figueiredo & W. Celes $ $URL: www.lua.org $   ,8DP\hptx| `qT`Pql1 >> ''return %s=stdin printerror calling 'print' (%s)arg---=(command line)LUA_INIT=LUA_INITcannot create state: not enough memoryno calling environmentno value?(*temporary)=[C]CmainLuatail=(tail call)?localglobalfieldupvaluemethodattempt to %s %s '%s' (a %s value)attempt to %s a %s valueconcatenateperform arithmetic onattempt to compare two %s valuesattempt to compare %s with %s%s:%d: %snot enough memoryerror in error handlingstack overflowncallC stack overflowcannot resume non-suspended coroutineattempt to yield across metamethod/C-call boundaryLuamemory allocation error: block too big(null)%p%... [string ""]MOVELOADKLOADBOOLLOADNILGETUPVALGETGLOBALGETTABLESETGLOBALSETUPVALSETTABLENEWTABLESELFADDSUBMULDIVMODPOWUNMNOTLENCONCATJMPEQLTLETESTTESTSETCALLTAILCALLRETURNFORLOOPFORPREPTFORLOOPSETLISTCLOSECLOSUREVARARG'%s' expectedmain function has more than %d %sfunction at line %d has more than %d %s'%s' expected (to close '%s' at line %d)too many local variableslocal variablesupvalueschunk has too many syntax levelsconstant table overflowitems in a constructorarg or '...' expectedselfambiguous syntax (function call x new statement)function arguments expectedunexpected symbolcannot use '...' outside a vararg functionsyntax errorvariables in assignmentno loop to break(for index)(for limit)(for step)(for generator)(for state)(for control)'=' or 'in' expectednot enough memoryinvalid key to 'next'table overflowtable index is niltable index is NaNnilbooleanuserdatanumberstringtablefunctionthreadprotoupval__index__newindex__gc__mode__eq__add__sub__mul__div__mod__pow__unm__len__lt__le__concat__call%s: %s in precompiled chunkunexpected endbad integerbad constantcode too deepbad codebad headerLuabinary string=?%.14gindexloop in gettableloop in settablestring length overflowget length of'for' initial value must be a number'for' limit must be a number'for' step must be a numberbad argument #%d (%s)nmethodcalling '%s' on bad self (%s)?bad argument #%d to '%s' (%s)%s expected, got %sSl%s:%d: invalid option '%s'stack overflow (%s)value expected_LOADEDname conflict for module '%s' cannot %s %s: %s=stdin@%sropenLuarbreopenreadPANIC: unprotected error in call to Lua API (%s) packagetableioosstringmathdebugcontrol structure too longfunction or expression too complexconstant table overflowcode size overflowandbreakdoelseelseifendfalseforfunctionifinlocalnilnotorrepeatreturnthentrueuntilwhile.....==>=<=~=lexical element too longchar(%d)%c%s:%d: %s%s near '%s'chunk has too many linesmalformed numberEe+-unfinished long stringunfinished long commentnesting of [[...]] is deprecatedunfinished stringescape sequence too largeinvalid long string delimiter.tostring'tostring' must return a string to 'print' base out of range__metatablenil or table expectedcannot change a protected metatablelevel must be non-negativeinvalid levelfno function environment for tail call at level %d'setfenv' cannot change environment of given objectstoprestartcollectcountstepsetpausesetstepmultoo many nested functionsreader function must return a string=(load)%sassertion failed!too many results to unpackindex out of range__tostringtruefalsenil%s: %pboolean or proxy expectedassertcollectgarbagedofileerrorgcinfogetfenvgetmetatableloadfileloadloadstringnextpcallprintrawequalrawgetrawsetselectsetfenvsetmetatabletonumbertypeunpackxpcallrunningsuspendednormaldeadcoroutine expectedtoo many arguments to resumecannot resume %s coroutinetoo many results to resumeLua function expectedcreateresumestatuswrapyield_GLua 5.1_VERSIONipairspairskv__modenewproxycoroutinenil or table expected'setfenv' cannot change environment of given objectflnSu>%sfunction or level expectedinvalid optionsourceshort_srclinedefinedlastlinedefinedwhatcurrentlinenupsnamenamewhatactivelinesfunclevel out of rangecallreturnlinecounttail returnexternal hooklua_debug> cont =(debug command) stack traceback: ... Snl%s:%d: in function '%s' in main chunk ? in function <%s:%d>debuggetfenvgethookgetinfogetlocalgetregistrygetmetatablegetupvaluesetfenvsethooksetlocalsetmetatablesetupvaluetracebackinputoutput%s: %s%sFILE*closed filefileattempt to use a closed filecannot close standard file__closefile (closed)file (%p)r'popen' not supportedstandard %s file is closedw%lftoo many argumentsinvalid optioninvalid formatfile is already closed%.14gsetcurendnofulllinecloseflushlinesopenpopenreadtmpfiletypewriteseeksetvbuf__gc__tostring__indexiostdinstdoutstderrinterval is emptywrong number of argumentsabsacosasinatan2atanceilcoshcosdegexpfloorfmodfrexpldexplog10logmaxminmodfpowradrandomrandomseedsinhsinsqrttanhtanmathpihugemod%s: %sunable to generate a unique filenamefield '%s' missing in date table%c*tsecminhourdaymonthyearwdayydayisdstallcollatectypemonetarynumerictimeclockdatedifftimeexecuteexitgetenvremoverenamesetlocaletmpnameos'setn' is obsoletewrong number of arguments to 'insert'invalid value (%s) at index %d in table for 'concat'invalid order function for sortingconcatforeachforeachigetnmaxninsertremovesetnsorttablestring slice too longinvalid valueunable to dump given functioninvalid capture indexinvalid pattern capturemalformed pattern (ends with '%%')malformed pattern (missing ']')unbalanced patterntoo many capturesmissing '[' after '%%f' in patternunfinished capture^$*+?.([%-'string.gfind' was renamed to 'string.gmatch'invalid replacement value (a %s)string/function/table expected\r\000-+ #0invalid format (repeated flags)invalid format (width or precision too long)linvalid option '%%%c' to 'format'bytechardumpfindformatgfindgmatchgsublenlowermatchrepreversesubupper__indexstringdynamic libraries not enabled; check your Lua installation%s%sLOADLIB: _LOADLIBabsentinitr;./'package.%s' must be a string? no file '%s'error loading module '%s' from file '%s': %spath-_luaopen_%scpath no module '%s' in file '%s'preload'package.preload' must be a table no field package.preload['%s']_LOADEDloop or previous error loading module '%s'loaders'package.loaders' must be a tablemodule '%s' not found:%sf'module' not called from a Lua function_M_NAME_PACKAGEname conflict for module '%s'__index;;;;loadlibseeallmodulerequire__gcpackageLUA_PATH./?.lua;/usr/local/share/lua/5.1/?.lua;/usr/local/share/lua/5.1/?/init.lua;/usr/local/lib/lua/5.1/?.lua;/usr/local/lib/lua/5.1/?/init.luaLUA_CPATH./?.so;/usr/local/lib/lua/5.1/?.so;/usr/local/lib/lua/5.1/loadall.so/ ; ? ! -configloaded1\00<0H0T0`0l0x00000000000000 0,080D0P0\0h0t0000000000000~0{0x(0u40r@0oL0lX0id0fp0c|0`0]0Z0W0T0Q0N0K0H0E0B0? 0<09$06003<00H0-T0*`0'l0$x0!0000000 0 00000 0  #   o|Ro5o55l, oo-,1L  #55l5x59      -(-,1\2(2`d5j 2P02TC2DQ] lr2X}2X2\>( >0 ?, ?TH ?d @ @ Ah A BhH BX CD CLh  CX D D0 'F 8 -GX ;HH GIt OJTL ^J d] kL uM, Ux b cdt d  g i| j` kD l( m nP nx 'o` 2}| >r Gs Tt ku4 |{|D { ~L<   ,t \ , ht  `   l  &(4 0\  9|  A0 L, Wd bl p }| 8(  (  0 LX   4 8 $ 2 @< M W b y  \   X 0   @ ]8  ` ]H ]   !< .0 =,h H( A  Q [| t( g p( x { X 4` Ôh p |\ ` X  H T @ ,( TT ȨT ' 1T <, E@ O 0 Y۠ ^< g X vd z\ `  4 p `t p D  P < 0\ Vڌ H  0 8 x XH ޠ  @ * 50 $ : Q X4 `P h8 x0    hd P t   P <  <  `X  ,  '6 >]( G(  R0 i8 qL KT@ ~  @P  8|  D $`  (d 4  ]H  , 4 )  2,< :h  Eh Pd YT  g pd t t ~ P     h 4 0  ( b    h   %6| b: /<$4 7?\@ C? OC0| TCT \F( aG, oG@4 u] }H  H @ I$ Ip JlD JH KT K\ LD Lhp L, NX0 N$ N@ PX( P0 Rh$ 5Sl, @S0 WS\ eU$4 vUX8 ~YX  Z0 [ \H0 \x ]p0 ]\ ^ _ `H `< a< 3dd =] Df Igt4 Rh `j4x kjh wkx k m n t8 y0 ] X H l p ( $P \T \0 *$` 4T DP NX Y dL@ r@ ~L <   d @ P< H <h   x  $( 3X Ad( M X8 a xD x b@ @ d D 4   8  h 8  ]    # ., 9 E8 TT8 d rL } p d   x T$ x$ 8 H 0  d d  | ]\ "\ )< 20 ; D0 Mp U _p h  p`< {   ` ,  $   px  8 ,T P  LD TD H (  0 8D |< )X 3 <0 F R@ ^l g q\ |  DH d 8 ] L D 8D D \ |D D (D D H |D `D #\ -pT 8P C8D ND Wx `x iT s\ |(H    D \D TD D lD  L     ] 4 '@@ 0üT 8Hh D4 O  W0 a84 klL uǰd , P  h` d 8 €$ ´, ` @| b@ ]   X ʐ4   ! )8 1Ѥ 6 P @ B̀d W  \ .΀$ f]  p՜ y֐ Pl  0 ` X X P(   (t T Ҭ Ԍ   ҈$  4 P ",\ 3؈ <Ph Sٸh _  qp }܈ < ߈  pl T 0X d  x   ( t,  , $ !P ,@ 6X M| ]] g  q |   4 `   P TX l |      < <  Lx H8 | 0 9@ d uD CX M0 Udx ]20Pr 1Z-,$ f T D /<  4 X UP   `@ .p0k -"a4x ^d -J\ ;ht E2(TT ^B| i` ylT OX YP4 \\  d /L Wl .Vp   />L `P UL (`D 6, Gd R $ \-(/r0$ _ j  A 1@/<D [\, Gd 1$ ]L ^@ ;0N0 X 0  . "Ydt ,7L 714 ?6<@ MF, ] j; tdD }P t $ R8 .d 5  g\ / tT qd 3` @ !{D( !A !N $ !)al !5S( !B.4!J> ![XL !j !{L !V ..0 !$ !94 ! !6x !fp !.@!Q !W "1\"   "`h "8 ", "J:, "ZH "gdH "thP " ", "h4` "[< "90 "9  "9L "sxX "8 "A # 1(#` ##T@ #2 #@ #L= #V@ n0#` /l#ldd /#.#j8 #x4 # .#i #-#t Q-t#$ 1 #\D #Z #<| 40D2`@$.$ VT $3$!; $+0w3 !$5H` ? $>R4 $G.X$O-$V0$]p( $i7\ $z4X $Px $e $fX $ll 0$< $P\ $eP$ $Z0 $/$$ $4 % < %-%X\0 %&-' %-[  %C %Ql %_:H %qb %{.|%IPH %QLT a0t%j %/ %SD %Mht /\` /%bLX %M( %-(0%T@X /%WL &Y, & &$ &.4$ &998, &H@l\ x.&X2H&d; &o.L&v@ *0& , &l &] &]L$ &<| &[, &.&<@ &2@&Th ', '| '".('*( '5-&2@!'< luacrti.scrt1.s__get_exit_frame_monitor_ptr__do_exit_code_ptr__crt_scratchvalues-Xa.cDrodata.rodatalua.cDdata.dataglobalLprognamelstoplactionprint_usagel_messagereporttracebackdocallprint_versiongetargsluaB_dofiledostringdolibraryget_promptincompletepushlineloadlinedottyhandle_scriptcollectargsrunargshandle_luainitpmainlapi.cindex2adrgetcurrenv___const_seg_900002401f_callf_Ccall___const_seg_900006501aux_upvalueldebug.ccurrentpccurrentlinegetluaprotofindlocalfuncinfoinfo_tailcallcollectvalidlinesauxgetinfogetfuncnameprecheckcheckArgMode___const_seg_900002002symbexecstr_checknamegetobjnameisinstackaddinfoldo.crestore_stack_limitresetstackcorrectstackgrowCIadjust_varargstryfuncTMcallrethooksauxresumeresume_errorf_parserldump.cDumpBlockDumpCharDumpIntDumpNumberDumpVectorDumpStringDumpConstantsDumpFunctionDumpDebugDumpHeaderlfunc.cunlinkupvallgc.cremoveentry___const_seg_900000201reallymarkobjectmarktmutraversetabletraverseprototraverseclosurecheckstacksizestraversestackpropagatemarkpropagateallisclearedcleartable___const_seg_900001401freeobjsweeplistcheckSizesluaC_callGCTMmarkmtmarkrootremarkupvalsatomicsinglesteplmem.clobject.c___const_seg_900000502pushstrlopcodes.clparser.cpriorityanchor_tokenerror_expectederrorlimittestnextchecknextcheck_matchinit_expcodestringregisterlocalvarnew_localvaradjustlocalvarsremovevarsindexupvaluesearchvarmarkupvalsinglevarauxsinglevaradjust_assignenterlevelenterblockleaveblockpushclosureopen_funcclose_funcchunkaddfieldarrayindexsubexprrecfieldcloselistfieldlastlistfieldconstructorparlistforbodyexplist1funcargsprefixexpprimaryexpsimpleexpgetunoprgetbinoprblock_followcheck_conflictassignmentjumponcondbreakstatwhilestatrepeatstatexp1___const_seg_900005701fornumforlistforstattest_then_blockifstatlocalfunclocalstatmkfuncnamefuncstatexprstatretstat___const_seg_900006801statementlstate.cstack_initfreestackf_luaopenpreinit_stateclose_statecallallgcTMlstring.cluaS_newlstrltable.cdummynode____const_seg_900000101hashnummainpositionfindindexcomputesizescountintnumusearraynumusehashsetarrayvectorsetnodevectorluaS_resizerehashgetfreeposnewkeyunbound_searchltm.clundump.cstrerrorLoadBlockLoadCharLoadIntLoadNumberLoadStringLoadCodeLoadConstantsLoadFunctionLoadDebugLoadHeaderlvm.ctraceexeccallTMrescallTMcall_binTMget_compTMcall_orderTMl_strcmplessequal___const_seg_900001601Arith___const_seg_900001702lzio.clauxlib.ctag_errorlibsizeemptybufferadjuststackgetFerrfilegetSl_alloclua_atpaniclinit.clualibslcode.cisnumeralcondjumpfixjumpgetjumpgetjumpcontrolneed_valuepatchtestregremovevaluespatchlistauxdischargejpcfreeregfreeexpaddkboolKnilK___const_seg_900002901code_label___const_seg_900003101discharge2regdischarge2anyregexp2reginvertjumpluaK_goiffalse___const_seg_900004401codenot___const_seg_900004601constfoldingcodearithcodecomp___const_seg_900004901___const_seg_900005001___const_seg_900005101luaK_codellex.csavetxtTokeninclinenumbercheck_nextbuffreplacetrydecpointread_numeralskip_sepread_long_stringread_stringllexlbaselib.cluaB_assertluaB_collectgarbageluaB_errorluaB_gcinfoluaB_getfenvluaB_getmetatableluaB_loadfileluaB_loadluaB_loadstringluaB_nextluaB_pcallluaB_printluaB_rawequalluaB_rawgetluaB_rawsetluaB_selectluaB_setfenvluaB_setmetatableluaB_tonumberluaB_tostringluaB_typeluaB_unpackluaB_xpcallbase_funcsstatnamesluaB_cocreateluaB_coresumeluaB_corunningluaB_costatusluaB_cowrapluaB_yieldco_funcs___const_seg_900000302getfunc___const_seg_900000901luaB_pairsipairsauxluaB_ipairsload_auxgeneric_readerluaB_newproxyluaB_auxwrapauxopenbase_openldblib.cKEY_HOOKdb_debugdb_getfenvdb_gethookdb_getinfodb_getlocaldb_getregistrydb_getmetatabledb_getupvaluedb_setfenvdb_sethookdb_setlocaldb_setmetatabledb_setupvaluedb_errorfbdblibsettabsssettabsigetthreadtreatstackoptionauxupvaluehookfunmakemaskgethooktableliolib.cfnamesio_closeio_flushio_inputio_linesio_openio_outputio_popenio_readio_tmpfileio_typeio_writeiolibf_flushf_linesf_readf_seekf_setvbuff_writeio_gcio_tostringflibos_pushresultfileerrortofilenewfileio_nocloseio_pcloseio_fcloseaux_closegetiofileg_iofileaux_linesio_readlineread_numbertest_eofread_lineread_charsg_readg_writecreatemetacreatestdfilenewfenvlmathlib.cmath_absmath_acosmath_asinmath_atan2math_atanmath_ceilmath_coshmath_cosmath_degmath_expmath_floormath_fmodmath_frexpmath_ldexpmath_log10math_logmath_maxmath_minmath_modfmath_powmath_radmath_randommath_randomseedmath_sinhmath_sinmath_sqrtmath_tanhmath_tanmathlib___const_seg_900002101___const_seg_900002201___const_seg_900002701loslib.cos_clockos_dateos_difftimeos_executeos_exitos_getenvos_removeos_renameos_setlocaleos_timeos_tmpnamesyslib___const_seg_900000701lua_setfieldsetboolfieldgetboolfieldlua_getfieldltablib.ctconcatforeachforeachiluaH_getnmaxntinserttremovesetnauxsorttab_funcs___const_seg_900000301set2sort_complstrlib.cstr_bytestr_charstr_dumpstr_findstr_formatgfind_nodefgmatchstr_gsubstr_lenstr_lowerstr_matchstr_repstr_reversestr_substr_upperstrlibposrelatwritercheck_capturecapture_to_closeclassend___const_seg_900001502match_classmatchbracketclasssinglematchmatchbalancemax_expandmin_expandstart_captureend_capturematch_capturelmemfindpush_onecapturepush_capturesstr_find_auxgmatch_auxadd_sadd_valueaddquotedscanformataddintlen___const_seg_900004001createmetatableloadlib.csentinel_ll_loadlibll_seeallpk_funcsll_modulell_requirell_funcsloader_preloadloader_Lualoader_Cloader_Crootll_unloadlibll_loadll_symll_registergctmll_loadfuncreadablepushnexttemplatefindfileloaderrordooptionsmodinitsetpathcrtn.s_END__START_luaM_growaux_tolowerluaopen_tablelua_nextlua_yieldluaH_nextluaO_chunkidluaO_log2lua_topointerlua_tointegerluaC_barrierbackluaU_dumpmemcpymktimelua_getstackfgetsluaK_infixluaK_getlabelluaT_init__environ_locklua_equalluaL_unrefluaG_ordererrorlua_getlocallua_newthreadlua_pushintegerlua_createtableluaV_lessthanlua_gcluaY_parserluaK_exp2RK__filbuflua_tolstringfabs.st_double_foreffluaK_prefixlua_tonumberluaF_newupvalluaO_pushfstringlua_statusluaC_link_GLOBAL_OFFSET_TABLE_luaV_gettablelua_rawsetilua_gethookluaopen_packageluaL_buffinitstrrchrfscanfluaL_openlibluaX_nextluaK_exp2valfseekluaO_nilobject_luaK_retluaK_setreturnsluaL_checknumberlua_gettoplua_newuserdataluaZ_openspacelua_setallocflua_gethookcountstrtodlua_pushfstringluaV_tostringlua_rawgetluaL_getmetafield_edata.ld_intluaK_stringKluaG_typeerrorluaL_newstateluaX_syntaxerrorluaP_opmodesluaZ_initlua_pushnumberstrtoulluaopen_stringluaD_poscall_get_exit_frame_monitorluaH_setnumluaF_freeclosurelua_xmovelua_isstringstrcollluaK_checkstackluaX_lexerrorstrchrluaD_throwluaK_dischargevarsluaD_pcallluaK_posfixsystemgmtimelua_setupvalueluaH_freefreopenluaK_exp2nextregluaL_optnumberluaV_equalvalstrlenlua_setlocalluaD_protectedparserluaK_setlistlua_cpcallluaL_prepbuffer__ioblua_iscfunctionluaM_toobig_PROCEDURE_LINKAGE_TABLE_luaK_numberKlua_setmetatableluaC_barrierflua_closeluaL_loadfileluaH_getnumluaK_patchtohereluaX_tokens__xargvluaK_goiftruelua_dumpluaK_reserveregsluaU_headerluaL_loadstringfprintfluaopen_mathluaH_resizearrayluaG_concaterrorluaL_newmetatablelua_getallocfluaH_setluaF_freeupvalluaO_int2fbluaO_pushvfstringluaL_checkanyfwritelua_lessthanluaL_argerrorlua_insertsrandluaX_lookahead__ctypeluaV_executeluaF_getlocalnameatexitluaD_growstack___ArgvluaL_pushresultlua_pushnilftelllua_pushlstringluaK_codeABCluaL_callmetaluaC_linkupval__xargc.st_floatluaM_realloc_.st_doublelua_rawsetluaF_closeluaT_typenameslua_setlevel__fsr_init_valueluaL_findtablelua_pushbooleanluaL_openlibstoupperluaU_undumplua_getmetatablelua_settablelua_checkstackluaK_storevarstrftimeluaO_rawequalObjungetcluaK_selfluaL_errorstrpbrkluaL_typerrorluaL_loadbuffer_lib_version.ld_llonglua_loadlua_settopluaF_freeprotolua_pushvaluestrncat_endluaC_separateudataluaX_token2strluaH_setstrlua_getinfoluaZ_fillluaT_gettmluaG_checkcodeluaL_refluaA_pushobjectlua_setfenvlua_typenamestrncpy.st_float_forefflua_touserdataluaD_seterrorobjluaF_newCclosureluaK_exp2anyregluaopen_debugluaL_checklstringluaD_callhookluaL_wherelua_concatstrcpyluaK_setoneretlua_objlen_DYNAMIC_finiluaH_getstrluaL_checkudata__1cG__CrunMdo_exit_code6F_v_luaL_optintegerluaP_opnamesluaK_fixlinelua_getupvalueluaH_getluaE_freethreadluaX_newstringlua_pushthreadluaL_checkstack_startluaL_optlstringluaG_checkopenoplua_newstateluaL_addvaluememchrluaD_reallocCIlua_isuserdataluaF_newprotoluaV_concatluaL_gsubluaD_callluaC_fullgcluaD_rawrunprotectedsetjmplua_sethookluaG_aritherrorluaD_precallluaX_setinputstrstrluaF_newLclosurelua_resumelua_rawgetilua_pushcclosure.st_intfopenlua_tobooleanerrno.ld_floatlocaltimeluaK_nillua_typestrcspnfflushtmpnamluaO_fb2intluaL_checkoptionluaZ_lookaheadluaH_newlua_errorluaX_initluaC_freeallluaL_registerlua_removeluaK_codeABxlua_pushvfstringlocaleconvluaC_stepluaZ_read.st_llongfputslua_tothread_etextlua_pushlightuserdataluaG_errormsgluaV_tonumberluaL_checkintegerlua_pcallmemcmpluaK_jumplua_replacelua_gethookmaskrealloclua_isnumberluaK_concatlua_callluaK_patchlistlongjmplua_rawequallua_tocfunctionlua_pushstringluaF_findupvallua_identluaopen_osluaL_checktypeluaL_addlstring__cg92_used.ld_doublestrcatluaL_addstringluaopen_baseluaD_reallocstacklua_getfenvluaK_indexedluaE_newthreadlua_gettablefreadluaG_runerror_environluaV_settableluaT_gettmbyobjluaS_newudatasprintfluaopen_iosignalluaO_str2danotate anotate@ <2P2T 9:L 9:Tanotate`>>(>0?,?TH?d@@AhABhHBXCDCLhCXDD0F 8GXHHItJTLJL8 8>??<?AxBBBCCDHHJJanotateL H ?>@@@>LlJ ?>@@A>LxJanotateL`LM,N $N0NpOt OOXBO P tP\P\QLTR8R4S(SDDSDS4T@T@XTU$TUPVTVpWWLXLX\0XY Y$,YP4Y\Y,Z0ZLPZ[\,[ [<[,\`\p<\D\\]L]^@^d_,_`halbLXbbBcdtc8BdDdTTBdeBf Tfpg<$g`gtdghPh ULUxddBUxd  (TUhXZZZD\bcd(ed(8HXanotateL H UUxcbccddd UUxc bccdddanotateXiti|j`j8jjjkkDl(lTm hmnPnxo`qdBrsxXs{D({|D{}|~L<~<<x4` B<@u4t t n~<p4wtd|x|xxxxxxxxxxxDxxxxxpp(((xtanotate  uTt uhtanotatet| ,t\hdd,l`80ht`l@l$D<\BP, ($\XP`d|anotateL H L $ $ Lanotate(x(4\ | 0,dl|8(`@H 0anotate4Lt`D,$D4 anotate$P(LX48<B\ 0<BllX0@BB<  $0 0 0 ,8`x$PX$D,l8 anotate, (   ,anotate< $Xanotate`(Hp(4`|,  <anotate    $anotateh,$<0,hB(B |B((X4`Ôhp|\`X HT@,(TTBȨTTL@ 0<B Xd\`B4p`tBpD PB<0\ڌ۠H08BxXHޠB@0$B4BP80 hdPt , B<P $0pǬȠ<4,(0<|ט׼  8Lجشۨ8X0\panotate   anotatex<`X<|,8, B8t 0 4anotate, ( @, D,anotateL0| \anotate08,LT@<@PB8|D$`8Px`(d4`h`tT80 0 (Lt  0 `anotate  @0 H0anotate<hD$ht@, anotate anotatel,4 ,<h hdT  t pd P$X Lanotate<$ll0$BThBhB40B(B0 BBhB$ h ,(<L@ @(@0Tppx$4 8Phh0XlPHP  X x <0 anotate\ X ((h(. (,h(.anotateT3<3`4XB4`45 d3anotatet5p85pB6<@6|6x7L7\8 t89098,9d0949L:t8:H:,; p;t<<$4D?\@?@4(B@l\B@@(AAAB|C0|CTBDF(F,FG,G@4Gt4: T: : D6t689(9T9: :;<=@C DpEFG8anotate\ X (:(:EC0FFGxGGG@ (:4:EC0FFG|GGG@anotateGd GdanotateH D@ ,(4anotate@HLH @H`BIPHI BI$BIpJ\JlDJHKTK\LDLhpL,BM(BM<MhtMHN$$NX0N$N@O(P$4PX(P0PQSl,BU$4UX8BV8VWH$WlXBYdtBYXZ0BZ[]L$^B_BdHdde$,eP$etBpRRhBS\SB\x\HB]\]p`P`Ha4x`a\aBTRh$S0\H0]p0`H`<a< IHIIM$M4MPMNQS\SUHVW\WdWXxXY\ZZ]D`a\ahataacHc\cpcccccccdd$d8eHel,RRh@h8SS$$\|$$$$$8\\H||||(<<,]]p ,HDaP`,,,,,, PPPPPPDba@Th|Danotate HRRhSS\\H]]p^]^4]^]a8`aa HRRhSS\\H]]p^]^8]^]a@`baanotatefffXg\gt4g|Bh$h4`hij4xjhkxkmnt8y0,P| gHgXgh,ixk|manotate anotatep\TD$PL@@L(P<P@dD4T\0$`lXH<X<h@Xhxd((B8 ,0dxH@$x@ 8dTd|8@44anotate H$\\$ (L08@<HPX`hPpHx<d Px@Lphhl| Px@dxhtxanotateT8 8T8dLT$x$8H,p0dd|$ p$anotate p,8T (08p@HP \4 `8anotatep\LDTDH(08D|<<8,Tpp`<X0 $0@l\  px0,DHd8( h0tPh|dL< anotate 0`       (p 0 8 @, 48h <8tanotate ,D\DDD(DlDDD8D|D\D`D\TTD\D8D|DpTPxx @H(H0 anotateP L P X8 ` h p| x (   | `  p  8      (    \ T  (l 00@   0<D (anotate d484lLP0€$´,`@|üT,ǰd 4$ @@8Hh@8@ dœà,anotatex tX l@ tü |H    8 l ǰ   H8 P8anotateX Xʐ48̀d ΀$Ѥ,$  ˸hanotateP LH   X ʐ     ѤanotateP!P(҈$ҬTԌ(t՜֐4PlP,\؈ p܈<plT0X߈dx (X`t,,X$P@|P ٸhPB0XPhX P؀Td ,4H lpP$ 8$$$$$$$P$$$h$$$$$@Xh44h hhanotate x ՜ $֐ ,P 4 <0 D` L T \P d l t( |T Ҭ Ԍ (h4P0( X( (ׄ4PH((X(anotateH   <<LxH8|@BTXdl|P`DX04dx LHanotate` \@     P T  |  lua.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lua.o lua.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7lapi.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lapi.o lapi.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7:,ldebug.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o ldebug.o ldebug.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7uBldo.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o ldo.o ldo.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7Xldump.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o ldump.o ldump.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7nlfunc.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lfunc.o lfunc.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7(lgc.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lgc.o lgc.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7dlmem.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lmem.o lmem.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7lobject.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lobject.o lobject.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7lopcodes.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lopcodes.o lopcodes.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7lparser.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lparser.o lparser.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7Vlstate.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lstate.o lstate.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7lstring.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lstring.o lstring.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7ltable.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o ltable.o ltable.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.74ltm.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o ltm.o ltm.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7LJlundump.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lundump.o lundump.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7`lvm.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lvm.o lvm.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7vlzio.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lzio.o lzio.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7lauxlib.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lauxlib.o lauxlib.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.79linit.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o linit.o linit.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7wlcode.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lcode.o lcode.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7llex.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o llex.o llex.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7lbaselib.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lbaselib.o lbaselib.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7*ldblib.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o ldblib.o ldblib.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7iliolib.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o liolib.o liolib.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7&lmathlib.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lmathlib.o lmathlib.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7<loslib.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o loslib.o loslib.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7"Rltablib.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o ltablib.o ltablib.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7_hlstrlib.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lstrlib.o lstrlib.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7~loadlib.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o loadlib.o loadlib.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.760 /var/tmp/lua-5.1.4/srclua.c71 /var/tmp/lua-5.1.4/srclapi.c93 /var/tmp/lua-5.1.4/srcldebug.c60 /var/tmp/lua-5.1.4/srcldo.c82 /var/tmp/lua-5.1.4/srcldump.c82 /var/tmp/lua-5.1.4/srclfunc.c60 /var/tmp/lua-5.1.4/srclgc.c71 /var/tmp/lua-5.1.4/srclmem.c:4 /var/tmp/lua-5.1.4/srclobject.c;5 /var/tmp/lua-5.1.4/srclopcodes.c:4 /var/tmp/lua-5.1.4/srclparser.c93 /var/tmp/lua-5.1.4/srclstate.c:4 /var/tmp/lua-5.1.4/srclstring.c93 /var/tmp/lua-5.1.4/srcltable.c60 /var/tmp/lua-5.1.4/srcltm.c:4 /var/tmp/lua-5.1.4/srclundump.c60 /var/tmp/lua-5.1.4/srclvm.c71 /var/tmp/lua-5.1.4/srclzio.c:4 /var/tmp/lua-5.1.4/srclauxlib.c82 /var/tmp/lua-5.1.4/srclinit.c82 /var/tmp/lua-5.1.4/srclcode.c71 /var/tmp/lua-5.1.4/srcllex.c;5 /var/tmp/lua-5.1.4/srclbaselib.c93 /var/tmp/lua-5.1.4/srcldblib.c93 /var/tmp/lua-5.1.4/srcliolib.c;5 /var/tmp/lua-5.1.4/srclmathlib.c93 /var/tmp/lua-5.1.4/srcloslib.c:4 /var/tmp/lua-5.1.4/srcltablib.c:4 /var/tmp/lua-5.1.4/srclstrlib.c:4 /var/tmp/lua-5.1.4/srcloadlib.c DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD%cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)signal.h 1.43 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)assert.h 1.10 04/05/18 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)setjmp.h 1.38 04/09/28 SMI@(#)setjmp_iso.h 1.2 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)libintl.h 1.16 04/09/28 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)libintl.h 1.16 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03ld: Software Generation Utilities - Solaris Link Editors: 5.10-1.497.interp.hash.dynsym.dynstr.SUNW_version.rela.data.rela.bss.rela.plt.text.init.fini.rodata.rodata1.got.dynamic.symtab.strtab.annotate.debug_info.debug_line.debug_abbrev.comment.shstrtab    `"## o55P-B5l5l  8B5x5x$ BB55 L99RX ^ @f  !Go-(-(G-,-,0 t1\1\22(2(8=2`2`\}2`=0^ o'Go=tL-y&r? ee0707010005d1f8000081ed0000000000000000000000014c5cc64300026c540000010000010036ffffffffffffffff0000001800000000root/usr/local/bin/luacELF14h4 (44t/usr/lib/ld.so.1K?  "#$%&')/35789;<=>@ABCDEFGIJMNOPQRUVXY[\]`befgikmnoqstvwxz|~  !#$%&')*+-/01236789;<=> !(*+,-.01246:?HKLSTWZ^_acdhjlpruy{}    "(,.45:M hh ! , 1fd C!KT  \| m8tL ( y \4x P S h Q t$ b ȴ  h !44 3`:B|@ Q0V9 e $ s`$, dP Pb$ Tt N(  L8 J |  `t   \l 0| =( HND U6\, eH qT }   || ;\ UP $, ^4 4 4 5|  _xD 0` V  24 < H Vbd fKX ta \K <  z4 2xL Q8 2 Rx D@   [P P   +2( >/pX M2x XTdt b/ lxs|,P }= | P   { Rl HH _H < W<  l Q 1@ +|` 7;( GU U]duK$4 0 d`3H `  SxL c$ 7| D H< h Y@ %= 3_@8 >f4 JJ( WKt b50L r~d b\  < X v( \Wx` 6H BP I$$ ([ 9XL$ F0td U\ c oaX yN@4 Z0d Hht PL l 4, , PT XD | T\ #YD /D = (X ITR|  X eP<lU0 }8 h4T ]X B4 S,L DPH BD 4\ < 7T `P$ / KX  +0 :Gx ET, TLX\ _4p0 o2  wT4 L  5T }P nX RH$ C` dP 6p   O44 $5 6J\p @ H T, \H( kOh@ z| H | ~dh b|   LT d =4 It$ Q4P V   & 2 ;UX, J R?h `" x<0  l   e8  fL ~& z< `@/m@ 9N#0@ ` ` @`@,@Y 㿘&* @@/]X@Aj@9N17"p'#l'@w@?@ )@+ 㿠 7 ?@p&  "`& (@] /-QN` @ "@ "@ \@2 @Ԑ?G`@А?C` @ @% @ǐ :`@Ð 6` @ @ @ @ +`@ '` @! H @ @ ` @W"@  ?@'&  `& +` `@  `@ `@`*ON` ?@&   "`& -`@ "`@` "@} *` `@@ "@`!@"H`b@X đf@@O`b`@HR`Ԃ@@PP(XP(XXXXPXPPPPXXXPPPPPPP㿐  ,`@#\9#`!?c#P#  b``x5` `?5`#l! a#d#h5``` @`` @ @@-@ԇ-@ @ `@'`"H7@%@Ӓ 9` @ h@ h? >" @Ő ; @)d? a ~% f@@% 8`@ l?!@%@l %@@%@%#@l(@@lb`$`@h`(  @Ul`(@ @wLd!@H@od ~@hda@ !H8@_􀥠@h @U@S@d ސ"@I@`@Cl`+ @;d`@ ` #`@/`@+d@)$`\ #`@&O㿘 cO @@  L =@hL\d@ < < , ,#dt-`#``0d@`4d@#\ < @@ , J I K H H#\f@ d@`d@ ćd@#` I@ K 8`, ( 4d@ d@d@#\ 8 ( 4@ǐ㿠 (;`(@@  @D@@O 㿠 8;`@@@   @ `   `@`@&O 㿠 $`h@ @`@   @ @t&O 㿠 4NO`@ `א`@     &O  @ *`  aP@# @g@3 ?`@@*` + ?`@H? #``@ @  X  ` " X" `?`@ 2@  H ?`#@ !P*@ !  d  (  2@  H`  Z`s `#  " 㿠#@@@&#@  #: ` :@@`H `.``$@@ ``@@H ``&  @`* @#``  `   `" X q` !`&O` 42`4 `X #`X㿠 `@ `D @@G@' %%&  # :` @ :  @*`  @ @     @ *O "  `+` " 㿠  @ ^v& *O^ ' & 㿠 @ ^v&&8O^ _`r `" 㿠'?@@  ( @-@ ֒@2@  `` ?"`  `@2 `"@-  ` "H)  @-# [?@ r ?@"  ?&@   `"H   ` "H    @  '`& 㿠 Z w  '  & 㿠aP2@ ?@*`c` 㿠e `@  ` @  㿐T `@ @.ܒ@  㿠 @ @  㿠6 `@ `@  㿠;%!aP@ 1!P@@U 㿠; aP@-P@@ @1 @   㿠;aP@@7P@@0 㿐֒ `"@  @.^@;T` 㿐Ò `"@  @.K2@  B#\\㿠  @ `2@  ``@   㿘 `@@.=@`f@&`  @ D @@"@`` &``㿠r `@`@`"@  `@ `"H ` @+R@-@  㿠E  @ `@`` 㿠2 `@`"@  ` 㿠 `"@  㿠 `@ `@`"H `"@   `@ `"H  Ł #` `" #H #L H; #  "   #\\; #  " `㿠 `@ `D*@ @̐ @&=% % `& 㿠@Á@܁㿠 `@ `D @@@t㿠'L'P'T'X `@ `D @L@L@b㿠 `@ `D @@ǐ@3" . " @&  ,` ]?s`#`#`2O   %% &  2`  3p?"" `"   # #  "   # #  `"  p@1` 0?㿠= '` '`@-㿐 1@@%'' @-w & 㿠  @)P'` Z v &㿠  @) Z w  '  & 㿠 `@ `D*@ @ @(K% % `& 㿠 `@`"@       .``2@  '  '  &  㿠 `@`@`"@      #`#`     $$   ^`Hv`P& & `& 㿠 '`  '`@-* ' & 㿐 @ؐ@$'' ' @- && 㿠k  '` '` @(͐^r "  @   "@  ` ` "H `@ϐ ' & 㿠C  @(ʔ'`_`r `"  @   "@  ` ` "H `@ ' & 㿠 `@    @"@ %  @%#  `"H"  "H  @~ @$` "H  "H   @^  .`%` ' &  㿠 ڐ `@`@ `"@    "`   #   $ H$ P@  ` "@   `"H   @  '`& 㿠 `/`&@ @   @ @  &  ``@ 㿘@ ``} " .`'W %'' %@ @  `  @  ' 㿠@  ` "   ' '  &   `%`%`  &  $ @ 㿘'7W'̔  '@ O 㿈`d@@4 @  `@ @ !`   ` @   L\l| 㿠7X`  (@=.`@@?' @ D' @@! D3  D c D. 8@' @ D$' @ D D @@@ `"@  D @O P' P T' T?㿠@ 㿠  '`@$V"@  & ' & 㿠`@`  @ D@ *@ @  %< `<@- .`#& H; `@" '  '  &  "@  `"` `  #` #` 㿠 `@ `D @@P@#  && &   `"@  `@`&@  @4H *` @# "` @ $@@ *` @?"  㿘ϒ@  _`v`& & 㿘@  % &  \t $  ` @  `@ `H `@K` @ `` ` @ @ 2@` #` `` ` #@8 8`??㿠ߒ@?` `@ `* ` @ @ 2H" D " D " < <" @* 8  D 8 <  @( @`  @`"@ `@ (8O`@`(@ (UU~ 9 H0 9 ;`" "`h` d ``d # h  @ `` ` @`` 㿠@ V@ "@  @2@` ``%@>`@=@@` 㿠`` (/ '@.Δ@.$?㿠`` (/ '@.@ . `\t?$? &&  ` @ `Д? ?  $``    ` <$ `@  d@  <@+㿠;?`&  $&  & & & & &  @ <& 㿠"@& @! @# `0 @  ``@%" `"  0@&O`  %`%`  "  &@@@  `& 㿘2@N` `@u @?N``l@ L@0SHf2H+ *`l@ nHu"H b`&`&`@Q&`d@ d@"`! ``N` 2ON`59?N` `l@ `L@'`SH`f2H" !``l"@&`n"H&`u"H #`&`` d@d@%`$```N`2ON`㿠N``>@   ` " ' `@  ` (/`$@, @ b@ f@`2@  $ $ $  %`@@  ' @ L@ K @ `J `I `K $@ `J `"@ `H `J2@ `H `$ $@`, `0@"@`,`0"@`, @ `,` *@  ?`@  ?`@`#``@ 2  @`"H2 ! f@ @@ `! @ "Ha @  K@ @  @ ~ ( &@   K@ @   h||||||||||||H|||||tt,,,|x㿠#\ ,Y2@\ `@| ? [`",c# @?`&@k0 K @d@`@ @@! @+ U 00 ! !8`~@  :  `u2H?   0: `@3  (@ &H0  0 @8` @%`@ ,@ $H @ )  @ ? "@ 2@`@&O `"H   @@d@ @ ,@    `? H&`  &` #@+ @ @ۘ , 6@   `? "2@Ѧ 0`Hʦ @Ād¦ H@H  -` `H  K 6@ d@@H &@  K  6@ f KH @@\d`@  K@H? ??@  H @  K H fa@]  K? HY `@ K@H  @K ,HF  4@6@O  -` H ,6@F H    ?`@ @ ` @$O f@! f@ J @ J`@@  + H  K6@ \O,      ,㿠 ,p 2 3p?a@ ~ * ` @ @ a㿠`` @i`` `@c`` g@ &@Q8 ?@ @@.@ 2 E@ @62 >  ?1((@&! 2 2  @-`` "O`&2  !& 2 @  ,``&1!&3a&7$- 㿠`` @ ` ``2@`@$` @` @&``* `  ? @ @ !@4 4a    @ @ "@    O@  㿘'`/`;c` @    &@=  <93a,@@`$@` @ ``H l ƞ㿐;@# axd@㿠`9+#`/`.`JJ@a@U `$@P `  ``@  `@u5 Ē @ <ĒԐ@㿠 t`@'   t` @@   ^v& _`u`%  $@@L   `&  & @E @r㿠'LL'P'T'X@Ȑ㿠`@`@ +a@@ & &`@/@4 & & &``@ _?v?&&  0 " @`UU`(>"@ 9`H0p " @ :9`"@  @"  @㿠 ( &  `&  @ʐ  66 4. 9Ґ& t& p㿠 p`"@ .  p%4  p@́ X@ؒ `X @h'D'H'LD' p'# p@D2@LH&p  #@ : ` "  h@#@  8   2O ( 8@%   !  8` ?  ! 8` ?  ! 8` ?  (O  ;` `@ ? " 㿠5` @ ` ,-  -@ & @ ڐ& & ,-` & 㿠;` (b@ .` 0# (+`.'@.@ Ȑ& (@ & (& 0UU &=K 2  (=>`%@,%,&  0* "@)` ( & $ ,@ @ ,+  ,@ 㿠 0/ @   0 .` 0@@7  `' 8 D`@9 9@5`   % '%@''  UU (~#9`J 2 @ : 9` '  $a@@   @%. 9@ . 9  %` & 㿠`I@     $% &O`J@4& @ D@ @ @ '@ `@/`   "@`@^@r " &O "@~@#\ \: "   @. #@  %`] u %%  &O` @  & &&㿠@0   @&@!" < @ \t$$8O\  %@ @  &  _ u & 㿠``@̒ `  "  @b&@    K"+ 4@  K  J@ I (`@(@ $ I) &  $ $: ` :6  $@ @2@ ѐ" & " " &  K. "  & " "   @$ *O$ &  8`"@C   `& Ɣ?  &    " a@@  $  2@  &  "   " &  @" "  8 @ ? `@*   '@1 㿠  &@?  @ 8`"@   $ @ l 8@   % O @㿠 8`@ϒ $& 耤 & & @ @@`]?v@ &` @*O` @ ?`'```?4O'`&  㿠 4`/ 7`@6 4 4`@%(  4H ޔ@@$  4&6 4 @ D @@ {㿠  `@ &`”?"@ . ` `@ "@   &   `&   (UU'>K 2 >>`%@#؁㿠  `&  @@&&  &@  `&  㿠 `"@ 4  @! ( @"H 4!"<Ձ`@%(ρ 4.`'b`6 46 6 %@ .  2  &` 4  4' 6 4㿠 6 4@.`/d   && . ?㿠 4  ( 9 t&& t@ @@6 4 (@&  &   & . 9& t㿠@(` `@ `D @@r`a`ഔ`d@ @ H H@k" `H@   @~ $```HO  %%  %@  & 㿈'3c'a@''   t'@ i 㿠`@@&㿘/ 㿠'DD 㿐'D'HDH?ے 㿠7`6`K ΁㿘@`@`  `'' 㿠 ( @*   ``@@"H `@ "H` ``&O  4`@      @M&O 㿠` `@   0  ` @  8l @    @ ^ @` X&O ` @  $K`@     d&O 㿠 @@  `@  S <, @) H I J K   ,,Q㿐@ 㿈'''''’ 㿠/` `( @@ @ϔ / ' / 㿠/`  @. @ -`% @ -/`%`%`2O%`㿠  @ @ &' 㿠  h@" h` @@ @`:O  `  @ .  @ݖ  *   *  " `" '` x"  "  % '   #   "㿠``@  @㿠  h`@) h  @$  & h  @@@ h֐  ]t $ $ @0 h@ h :O 㿠  @ L@ '`'`('`'`4'` '`,'`0'`$/`H'`/`I/`J/`K'`'`8'`'`<'`@'` 㿠` `,/`@a `4`/`@[ `(`/ @U `0`. @N `8`-& L-@E `$`-`@? @= ``"@ ` `)` ( +  @( 8 @$`` @  `  6@"@(`8@ `  @ $O``"*`@   `` f "hDX(8㿠/f`h`/``&`@@.`ƀ```@/` ` "@` ` `@,` ```@ ``` H```ϐ`H` /` $'` & $ $'` & $ $'`l& $ $'`D& $㿠 0@` ``. 02O㿠  p`@ "@?```"@`2 @ ` `@   `@ @ `/```/``& 0@@'`' 0  0'` 0 `' 0`2O` "@8`"@`2`@ `` @  ``@m `@ ``/``` /``& 0 @@'`' 0  0'` 0"`' 0`2O`㿠` `@  ` `"@`` `@ ` `@ ` @* @'@#@}: k2  3p?@}3 v2 @2? H`./  .```.` ,&`& ,@ @  @ `@/``  `@ `  ` H` ?2O`  `,`@x@0 @, ` `@??2O`f, ` `@ @ ` @  m?2O`H@, ` `@ `@  @  cN?2O`)`@2@?&@  `"@C @  @7?2O`@ @  㿠` `"@`(` `)``(`@  ` &@ `@ `"@``( &O``$ @  `@``@` (``$@&O``4`@  `"@ `` ` "@``@`ؐ`4&O``8@  `@ @ `   -`8 &O`㿠` ``"@`` ` "@```@0 `` &@ `` ` "H````&O` "@````@ `` @ `&O㿠 7 (   0@-#@UU&@ 09 >J 2p 9`9  > .@@ ?  0 $@ -  04<`f-  ,@  ,Z@ ,7 >`<㿠`P`@  H "@  H7  ( @8@   `@*H` `@(O`  @&@ "@ *O@&(O&㿠 $` /``@@ "@`a @- "HA`DZ `& $Ӓ@ ``/```*@ )`*  & $`"@``, `(?,`l& $ ('`l& (` /` z`0`,./`&@. x@& $`$`,`4`$. -`0- `(@, `8+`L*  "@ )`㿠 $`@   $`O  @ ` 2@``( ` @` 2@  `2H  ` @   㿘@;   `@ @?,` ?ƒ `f@#2O  /@`@. `@@ H%2O   2O hPtD\ `j(!` @$+ @ @ '@g@`    ` `@מ`  @ў㿠  ``@-&@(? `@`h ``"@ ` `    ,`  & @@`$ `@$8O `㿠 ? `>:@ <`@$@ <4 ;@<@@<5`?@ 44<@v%@k4%&<㿠  0` 0@2@`' 0 p 0% p &` p! ` .``@ ` `@   `@ @ 9 @. 9 D-' @ ^u %  $ $  &  #  . 9' @㿠 `0`@   0O㿠  C?.@`@  @6 &O㿠   "@ ``"@$O㿠 &$&(&,p``"@pppP`&@  pH ` "@ pH `h @  `` @ `Ґ .㿠  x@ @`2@&H ` `"H`2O㿠 ې,&$&, `@( &$&( Ր-, .&& .D%&H㿘  `@ `@`"H $`"@ DU `@+`"H? 0N e @V  &  + g?  `   f )  D H @& H  D S (&  2@ D .  D H&@& H!"@ .  Hd(@  d H'`d& H d& L 㿠 5 T D @. L@/`%`' Ld@ @@O "@ H Ld:@ L D' @"$' L D' @z P6 K 2 4`R' @㿘 `   $(`,dd' d&`d%d$d$`-  @B O @6  OHzaP2J10 0P@$@  `@  `  @ *`  ` `*` ("`" (  "`#   *`*`  "`"  `@( `@$ @  + ` @` H ``H`    ` `+ 㿠7 =&@ @ F?/   d? w@ @ 67 K@ K @&@&㿠;$b 㿠 `` @@ `D&&`D  @ `2`O``+` e@ :  `  `?* d@ ! @?2 !:Oa`  `  @  ``@ `"@) `"@```@`"H`` @b` @1 0?`` 3 2p?`  1` 0?C0㿘@v>`@2@ J``x@JX2H@vڔ #\m" "\D>`L` 2@ M`'Q @@  'N  2O O f@㿠  @v@ ' '   &`@  & 㿀; bȒ@v %@~   &@ % %   # @l  `& Nf@ %@Oc"Hd"@ M %f@)p"H:s@E %`d@E //= 8   &@ @7   & +  :"  " `@$   &   @v/w r  / N//h@v  %2O ^   / &=`=`?@ $&   㿠'L'P'T'XZL㿠N``=@ `&@u.N`; @@b`&@uΐ@u@%@@uސ@u܁&@uېg@uϐN@@ @uє@uȐ@uĒ@u a"@  !"@ ` `@)㿠;@) 4`@)㿠 `<; @ `,    `$<   @)㿠 @@ @0  @ @Ȟ㿠@/㿠@ @@)^@)Z; 4`xK@)㿠В!`@/ː?" " " " 㿠@#r`0 㿠㿠 0 `8`8W 0@ `8`  4`#m '``8@ @ -`%`-#@ ` `8@ &O`W 0`,%,$@`"@ W 0``@ 4W 0 7 0㿠 0 2@/J Ȑ 2@.7` 0 2@ @(22" *`(`!(` " 2O2 02@ @2# (2 *`(`!(` " 2@ 4O2㿠 `$`H @  3 @2@ @J`H&O`H`H <@`А <`H`$ @ `$  ``ܘ#ϖ '``$ @ -`# `$ &O``H`,`#``"@ `H`@ b`H. 3-`H-`. 4`H/`H 2@+ ` ``)  `( @@!`?6O`?  `@ ` @ ```@` ` 4O````  f@ *h㿠@ ϔ  @  Ĕ2@ Β   @  C& &㿠 0˖  @@"&`㿠 0` @&@`@ @@#@ $@!@ d@"$@@!x 44`+ 3`@24 `@'ɞ?"`*` 2*`*`  "`" 㿠 &   `@ # @'   2& $@! 㿠 0`44`,@ 49 4!#Ö %4@ -!4&O`,`'`,`+`" ` `"@ `,  "@`, 4`Q`, $@&ٔ  ` H`@ `3`3  `  `d@@& ` H&O `㿠 4  &&`  0&`?&` &`& 0&`&`&` &`$&`(&`,6`0.`2&` @" * K@  &` `% %   $`@   `'  ""  !@ @ג   ' 㿠 4/ 0    @  @ ` `, .`.Z'` O'`  '`, @@ `0 `)`) F'`;'` #'`0 (`@ @ `( (`,`, 1'`&'` ('`( , @ `4 ,`.-'`'` ,UUU'`4W 0@@`8W 0+ #@ )`"@`*) '`'`W 0'`8`H`@ `$`H`- ,'`'``H '`$ & 0% @&' @r:@ Q@&||/ J@,ʐ@bǒ!P|㿈 0@""@,@#㿠@,@a 0@". ]p 0 0`$ a@%`@-lؐ`ܐ`&` =@"@4@" `  @%q$`$㿠` @@!'``$2@ `` `$@%o'`$㿠`$ @#` @``@`@@!`` `$@%S?@ "``` @%I` ?'` 㿠;@` c@- 0c` &` `$ &`$x 0    @% 'w 'Cشؒ >  0@![  { }@+ a@`[@@, `=@ C ?Β ,Gڐɒ ;2O  } {1?ܖq/`* ` .@ $@*  +  @ 㿠 0 / J`)@5 7  ,4a@a@ Ő` J@+@%J `/ J J/ J J@%8 J@h2O  2 J`&/ I 2@`ĺĐ' <f (@ -T@% ה  S )@ !Ĕ! ' @Oʐ2㿠@ " , ,@ 0@  @ڒ2O 0㿈 0  (@{@$"@' O9 @ @\@$Ő@+ `)@' Ɛ@ܔ? ) ( `Ԑ`'@*`耤 @耥 @ 耥@?@ 1 $&`?` @#ʘ  @#$ $!@$|㿠 `(@a@; @*@f ) ( 0@7a@$`p 0  [@ (@0 .H :H [@ {@$!"H#Œ @͐@! @*s@ zP @H 㿠 a@a @`{@Ra"H3a @Ma "H!a@a@a"H( 0a@a"H   p  >`@*3o@*. d @*) ^ @*# Y @* J`@/@#Ԑ  %  J.J@#  A @*@*  !"@   -@`#  f@  !@' /@ +@ %"@N  *@?I  +"@F -H5A  >@ /"@<  <H57  >"@4 ^H'/ !@!@ !"@( !H## !"@  !H !"@ !"H !H         㿈 U @@) 0@!E @#%". @@ @)g0@!eѐ0@!@. O44'`64 !@"!`@   !"@ !H  㿐 0 @Ð 㿘 0 $@ ` 2@``@`&` ` `d@d@%``2O``@  $  @! @;h``@` Ha@"ߒ ,@"'C耢@ 4 4# @   4# 4 0$aѐ 0ϒ ="H 0]$H 0 0&`$%`$ 0 $  0`@|@͒ 0`@t㿀O` `d@& 0@㿠 0`@ ` @ `` ``@` "O` `@5@"0 @` # @!h @q`@r㿐 0@(_@/ \!!@W@D!!U'@D㿈 0@   @(/@ǐ!!8`@  0@ 0@@ 0@㿈`0@X㿐 0 ! @  @ @ |@@ڒ @  @ ה  ! @ Ę@  @`@Đ`@?㿠 0b(  $@!i ) ` @!a ! `@!Y    = ,~v ,@v @5 $@ {@q㿈 0bL $ ,@!#  `@! ۔ `@! Ӕ ϔ : ,@pÔ`-O=!  Β @S & 㿐 0 @'D `=@ `,@ a @  ;X bx@ !! ې㿠@&T!㿘 0?' @@@@֒ݐ O @@ΐ@А@’@&@Ĕ@!! p 0֐) $ג @ْ 4  А/ @d2/``-&-$`㿈  , gOa =@2' 㿠 `.@ .O`:@ p@&=і 0@ 0@㿀 0耧` @/+/ ` @- $@' 㿈 0@&  @6  ;@1ʐ耤 @耤@ @@Z"@G2@̔?耥 @ 2@ 2` /`  %@2?  @`xxxxxxxxPxxx㿠 5y %@C.@@Ò B @%n!! v R K @%v! @Ԑ  h @%q A 㿠/"  @ ;L 02 0@%$`O 4 4'`7 4㿠   > & (   - (& & 0 0 (.&-@% & $,"& & , &  , , @# `&   "`  & !    &   a@' 㿠`0`(/ '@/` `,` . 㿠  H @] '` '` / @T  `&`&`@ @@H␐@]   * D- &@"  " " ," p" D* 8" <* 9 <" @" h" 02 62 4* " " (" " t" P㿠  `4```/  4< &!x&<  㿠   x+  N^ HvH P&P 8.8 <&< D&D<&@㿠`  x Ȑkx㿠  !x@`x '`  !/` x/` ` /` ```/`$ !x $   $ p$ $ $ @$ $ $ `$h$ 4$ <$ X, $ $ $ $ $$ ($ ,$ 0$ D$ P$ T$ L"$O"9z $ܔ @l 㿠 9z#`p f뒒 & t (&  `& & 6 66 4䵔 2O (E㿠 ` @@` c@ .`    `@  $ `&O"``@  ` "@ ` -"# 2O ` &O```.Ė $`$`㿠@  "  " @   *  * *  @i), , @ '`" ` @ 7@/ 㿠6` @ K6 .@ @ O    , @ @ @ @h@ 2O    `@@ / 㿠@8`  9  ``* `* " " "  p`"   p%`㿘'H7{'LH@@ H@h  `` '$O   - $@ @H.` t@W@$@.` ` @@"@$ 6 @"H  /  `*   (`   )@ ?( (@ " @ H(` r Q@ "(`  +@ !`@ @ `H* pS@ *   `@  DDP#\\`?`㿠`@?@`@@ @` 2@ ``&H``@ ``O`9"| ``'@= =`㿠”` @/ ` ` @ ` &O` ` #\ / \>&` _@v& `` ' )@ @ ) `  @  ` )@&O``) _v`&`_v`&  ` `@    `@ 1` @ : ff `@  )``1`@ ;  &O "`㿠D@/@@ * ``&  㿠     ` @`@@- `   ={$O` ```, &``O 㿠   /@@ ,`@ 2O&㿠;c@ .` `-`x&` m&` `@ -` %&O` &`㿠@#c@&` +.`  @ %m.+c@. B 7@&` ` % %%&O`.``.&`㿠```@@)@$.  @  @_ r  " O!# @/` .$ $  - @.`@ `@U]`r `" %` 6O`;c@@@, ҁ`c@ @  ` )@ 0'  ` $O%`'̐'%y㿠    % ' / ;' c@' / ' #㿠`c@@  ``--q ` ` . i g # "   @  ` @ "`  @ 8O   㿠Y @!#@@ 2@-^ڐ@y@`C@@@2O&_`w _`w _`w _`w '`'`^`' '`^w`'` @ @ `H폒㿈 @.` %`#pp#`#d;h`dh 2@`` B#h``2O`7P  ` +  @ ) ` 2@``@ 2H``2O`aP 㿠`@ @ "H `5P`ՁB#\`Dp\ @   O ;aP㿠ΒaP@.`@/ߝ/@ @H9"ߎ 㿀9h!P@#\ \?' 㿐9x!P@' '㿠`; `@#7,`@ 0 O,`$@&   `"@$  2O$$@ @@6 f@d@$@`O@ `@"` +`@`@ @ 2 ! )``; yTyD"@ O@   c@ H  㿠 c c@d0 `F ` &`  ` ,$O 㿠ߐ `@  /@  . ``@`"@`  `` ```*``@ *   aP㿠 ;  c  㿠@ i @;c㿘 O㿘 `@;`֐㿘ٔ 㿘є `2@   @ UÒ '`㿠ΐ; c@    / &&`  / &` &`,` 㿠; c@  -  &` &`@ &`(`  @  "``&O`@9  `   ` @ "@%%  @  @ Hp2 3p?% % `~= %  `% % `C`&O`\% @  /` 뵔 &` &``@ &`4  `%@ &O``@   ` @`%&O` 㿠-; c@    -`녖&`z -`&`&`0`UU aU@ -  (k &`` &`@ &`8  ` "@` &O`@  `#`@ # `@ ` "Oܐ' @@  ,  5 &`* &` @ &`$  ` %`&O` @   и `&O㿘  4`.7`@7 47    "`"` `   `@ U   $ '` `` ` d@ # '`<'`@u/`Hr/`Io/`Jl/`K<n@'0B &`%  4& 5 4㿈@9; @b8 @;`<&㿈N`@@N =@`Nf@d@%`7P$'''';'А`` p㿠 #\; Q`H @a .  . K\. . . . . . 㿘  @`2@ `ݒ@ >`&` p``"@` ';'`d @a@a&`&` 㿠 8 `@ &  @`@ < & @ݮ?`@+  `  &@ :`  :`?@ ) @@@  @  '>`H ݂㿠 &@ ^w`'` ^u`%` _ t  $(  $0@=  0&  " 07   !`&  X`p`#㿠 ^`w``'` ^u`%` ^t $( _ t`0 $`8  "@@    `@&  !`@㿠;` `t@&`ْ  @``@ ``  @  ` `Ȓ `2H`] v` &`ϔ  @ޒ`@ d&O`ۀf㿠;`  `l`@5 @`@ `` ` @  `  `~`2H#`_ t $  @  @` H諁v @څ`@ ``d&O':㿠Y `@Q`@  㿠@  ` ,@@   . @@ @@ ` -@@  ` .@ `@ f@㿠 `@?ڐ@?  `@ `2@   @  㿠  `` @_@@_@"@? &@_%O d@㿠`"@`@`a `@`2  ?H㿠`"@`ہ@`c``@ `: #3p?c ?@Y ?H d@٭HpT㿠`9 h@_-@ `@b``5` 2? `@6 3p? `@ `` Ӗ ` @ `– @   @  ` 2@  `@  `@4 3p? 㿠 ?  . 耣@ 耠`@ % @%2@% %[@SO? 2@ 耡`HF?% A?` `@ ` @@`$ @L %`&O`  `4@5 @- %  @  @@^`6O %' ' ?&@&`4O tP(@N@I%`' 0 @N.@ B>`&` >`&`  B>`&` ¬ >`&` ;x ;#p#tp@^Otx B>`&`#h #l#`#d`hl@^@d>`&` >`&`@H<h4 x,|P  p ( t  x PD`t`C0#\  #` ##d   )?`    ` 8 @ @@& @ 8`H5  `@ 5 $& 5  ` ?-`%@Gݓ*`@@5  !(X@v`&5  *`]v &5 a&d&5 f@5 a)`@#`#`@ G#`5  ' Xv& 5  '-'@& N 5 &  5  ( (@@+`@f@9  5  '* '& s s5 g`^u%&Gf"Ga ` "G].X5 & 5  a)`- @+@ `@ a-`f@f@ = =5 a5 弬 a幐&&&  @ D *G& 䂐 "5  !+ 5 ]@)`v@`-`&& f@  5  a ` a- -@ 5 f@- `*`@f@`2@ & `2@ & U>&C  5  -`* @ 5  ! f@ !- (`@@f@ 2@ & `2@ & >&  5  a ` a-`.`@5 @ ! f@ !- (@f@`2@ & `2@ & T>&  5 -`*`@5  a `f@ a-  -@ f@2@ & 2@ &  >&hŘ  a5  ! !-(`@5 @ f@ * `+ @ f@ 2@& 2@& I;;x#h#lh@\ lx [H>&3  ,5  - (@ 5  a `f@ a.``+`@f@ 2@&  2@& ''''@[>&^  5 a+`@ 2@& >& H  5 (`@`@ @ @  &d&&d&5  + @@"@ & #xx>&` bh"½\>&P 2G `e 5 &  !5  !%@l @ D@ @- ^@@u@ %}5  .` v5 &  .`*@ 5  ! !f@) @ -`f@`@@  ʐ@ @ @2@  5 ( G5 & 5  !+* @.`@ `  !-`f@ f@;2@   5 ) #5 & 5  ! !(` !(. @@ !+`f@@f@ >2@  5` *``"@  `2@  @ 5  5  "G0@-5  !*`@  @   2@   `@ 5  5  a@"GɦZ v &0` . 5 p a `+`f@  ! 5 &  ["H\ "H#\ &G  &  5 p (f@% & 9?"H  "H6 $ h`"@```#`<`  '`&  @ \q`!``  *O\-@& '` '` `'`  `& F N5 p a ,f@  "!  h@& ׽\@ #\"G)  `& $ 3 bp @V+W!5  +o5 > &>0)`&8&  @  @`y@ @k`@ ڒ@ ! ]`5  >&. ^ `0`0vP(&X^v@&H^v05  !&8& & }  @`& `"G[`s`#6 @- 5 5  a@   %8``& 8`?2@ G*# Ι+`  *@ @G-m^`r `" ``@ `@ @PGi&`c5 @-  H {@"    ?`2@ 1`   % `1 `(@ُ%@&O&`&&  @ `D*G,  ( 5  ! @;` I @; @"@& -   %@@@Ò @& `G @ - 6@ &# [@@v &`@G @㿘   @@@ '`& &  & N`?㿠 `2@ ?2@ ?&  &`&  O` "`"`"` "`"`㿠@?@ @@   @@X @&&  & O 㿠`@`  e@`@``ޖ&`Ӑ&`&``0;` @ aD@[@X 2@ @`@H```(d@`,%@9㿠;$2a㿠&8;@aΧ`@ِ ȡ 㿠'L'P'T'Xܒ Lȹ˒ ˫㿠@ @ @ @ @W@  2O77ᴐȖ[㿠;?`Ƭ?@ ? ' Ɛ?`ɖ 㿠@,@9? ֔?ޔ?@ђ?R 㿠H@;az㿠f@J㿠[?@;a㿠4@1 㿠B@ @@ @W&㿘;Ւa;` B@ P@ `㿠'L'P@LP߁㿠Œ@ /@ 㿠@㿠ȉ@ ǫH?ߒ?@,? E? 㿠@ 9? @@ `@Ҕ@ ū ɒ   @ `@    `2O 㿠?@3'@!? ?@m ܔŋ @ؒ?#?`@[@%h??nޒ?@?'  @R OIOO ğ㻐@V$@@VO@%@@@VBO%@@? 㿠??@U .@%@U%ƾv @ZM   .d@dž Ƨ? @ \M  `.Oʐ 5?㿠  @2@  Ƃ&  `&  㿠 `@!  ? Ԓ?В %` @(@  `@Oɗ '& 㿠ɐ@Ԑ 㿠@&$  *@  & N``'`.2O 㿠@U]㿠  _ & 㿘  U? 'd@ @Uc @& ð?{@ے? & "`` "`"`㿠@ 7?@Á @6?@Ã??Ơ ?v?`@ ƓW $ N㿠@@ 5?@E m 1 Ŏ+㿠``@ &`+&b` @ `` @T$& g㿠;@TaH;ĩ  bŚ) 㻘9`' ",@ V `' ŀ @Tq@' ρ`@l$` %  `#@ ' @c' ` `@` 2O` H ``@V!`" `@`@ @T{@'@F#$ @`2O' $@Tc?/ 7Ǒ` @ @T`@ ˆ ,gœ@TB`#@T=@T8`@T3``2@` ""``㿘';'aN㿠@SՐ㿠@@T  @T㿠?ɔ ;`(;@Sb` 㿠;b|ْ @;b @ `@`@     @1  `2@ 2 @'( `  )`@ ?`H `0@H 3  a` H   H `?+ * !`   @㿘 ?&  @ '@    @ݞ㿠@֐߁㿠 &` .`9#@Sr@# @"@1?,-@ @& "   *`? ?`   ?2)@@`d@  *``` @  b ?H#` 㿠@ `? 2@  ͒?O 㿠Ӓ  ?@ @`1 @ !?` ?.# @   '``3-`c6 @'` 㿠@  ̔?O㿠@}@NHO㿠 ?  ޖ &   @@  ͞㿠G @㿠@`?2H`&`5?@  /?2O 㿠 $ K@ @/` @`/`K㿠 $@& $a@  2@ @ $" $`` @`㿠    `( 2@ ( D#\\:  " `( ( @ `(`"Ԙ#F $``(@ @ /`` `# `(@ &O` (`^-@u$ @`"@  ( ` "H (Β (`& (㿐' '㿈'H 'LH?'㿐' '㿀' ' '`` @ ) ` @ `+  )@   `*` ``H) ?*` `+ @  (  ?`)`?  ` `+`c  $ * `*` "`` @  "` `* @3  "`` H ?@` `+   ) ` `+`" "`P\㿠`7h% @0/ @@ *&``  `@ $ &`` @ ` %`&`` `ΐː  @w %&`㿠 @eh P㿠9`"% @L.@@ `@'`` ``1 0?`@8 2'`` @<`*'````  @/'` '?? .`` -  @ " '``@`` @ '` &`㿠`` @;  $㿠`` @`````@6?`?X2@ ``RH` @?ِ Z  T Ē ``?&` &`$`&`㿠ݒ  $㿠`` @``2@ 2``H ``ג``` @۞ʞ㿠` @' `(H  (́ @- H3 (`@/`2@`+`$ @ ```   $``5 3p?` $ &``a`@`㿠``@`@ `"H-`@` "H&r`x` @  m`@   `` @ O㿠`V F $% t` @ܔ6'`&`㿠 3` 3? -`?7` d@. " 㿠`` @  `- `?@ 4` &  d@ ʁ ` 㿠``@ `"@"?`H`"@ ?`"@?` "@ ` ``` `?|`n&`㿠``@ `"@?`@ `"@?` "@ ` W `` `?P`B&`hxhxx㿠7`H% @"/ @@ &`` &``A`` g`  @ % &```&`&```㿠 &` &`DXP8@Q@L+& ``p @:/ @@D7 @4 @D1 @- J#@+ā / HP ;x;#`#d`@N=dx D @#p#t#h#lhpt@N1l @ @ 1 @`bP `P> 㿠@(`@ `@  @ Β˒ǒĒ  @`&&㿠@`f@ f@f@ c&&㿈?'' '@ w`@`"H@ } x`l㿠9`#@.`@@[G@wr,@Th|h㿠;``@.`  ϐ_ u _ u _ u    _ u _ u _ u - @$ `  .@`?@ %??   -  ,@,  @  *`!%  % ג    ށ ف ԁ ρ             ` +` "㿠 `,`@ `,` `b# $` `` -`$``0@ `0`-`#ږ $```.`%` '`* + @ *@ Ǟ *@ *` 㿠z? K 2 ?`? %d@@  "٘ ` "`ј   & $㿠 <``@%` @'Ȑ@X `- @ `4``Ԭ$`ԡ`4$`$``$``/㿠; cc@K ` * * $Oa@  Q #䀉` @ 4 4` *ć 㿠&a`@  <`ށP @`;ٔ P 4c Ș@ / 4ռ 4Ԓ  ߞ㿘 4ⴐ 0 `ߔ ` d@d@&%㿠  8&@ & 8``"`I` &  8&  "@  2H  @"@  8 #@ $  8 % L &  8&  3 c@& ;`㿠 ..`D &`4! &` &`8&`0&`&`&`@`<`<`4Ֆ `<%``<$`8`$  @ $``8` #`K &`|`8&`㿠@K 2@   8%@ & 8 ' N`& ^ 8&   <` <``@*`!`*@; J: `8` { ""`)`2OJh㿠@K/N D@ . O . DN Dې <`@ N D;!ϔ .`, 㿠; aQ 8%@ % 8` H` &   8&  @ 2G  `."O @@` 2@  `_@  k 8 #@ $  8 % L &  8&  G _"O N N Ds . < ӎ@㿠   9 8&@ & 8"J `&  8&  `=@ ! 8`#@ $` 8` %`M &  8&   ="O  ?'@@d@㿠  8 '``@ '  8 ! H& r 8&  ` @ H``H@2@e  [@ @ @@ "@?C [@ ]H0< /! 2G   8$  @"' 8x`$`K `&  [ ) 8'& x  [ `2O   6  8 @  8`"J` `&   8&  [@ ?@2 @L "@K2 [@ ]H + *2G  a 8`$  @ #` 8$L `&   8&  2O  ! > 8%``@% 8&   8`  `O `&  ' Ȑ @d [@ @X @: "@9? 8[@]H*8 8ϐ2G   8`%  @%`' 8x `' O` & \ [ r 8'& xR [ 2O Y ޒ  <$` @ S 8&   8`"J` `&  )!  [@ @o @Q "@PV 8[@]H O 8m2G   8 "@#  8&   8``"`I` &  Q2O   8`%  @ %` 8 `' O` ` 8`@ &  <,  < & &`e  <% `%  @ %` 8`$L` &   8&  ! 㿠 B 8 '``@ '  8 `' O` &  8&  @7Q ` @@ "@ @ \"@ 8 }! w! `&@ ` 8` !`I &  8&  `f@`a@ @` @9` "@8< `a"@ `b"H 4 `t@ `f"@ `n"H `r"H  ' `t"@ `v"H  А 8$``@ $ 8``%`O` & i A 8& d  Z] @   8`#  @ #` 8`$L` & G  8& B  -` @ 8)  @'``@ '  8"J `  8  @&  `O-``@! ۔!p l 8`'  @ ` 8` !`I &  8&  2O0  T 8`#  @ #` 8`$L` &  8&  <` <`% Ɛ&㿠 <7Q'  .@ "@ ?"@! @# @! "@E '@C -"@ 8w >@ .@A <@ =@l >@ۀ [@o ~@c  ``@  8``!`O` & v 8&  -@P 8#  @ " 8` $`L & a 8&  [2@  <@ % Β  <%`  "G  "O  "O  8`'  @ ` 8` !`I & 2 8&  ` "O{  "Ow  ?"Os  8 -_@!@ [`! 8 #@ $  8 % L &  8&  =@ = 8&@ % 8` H``&  8& ! 8`!  @ !` 8`&O` &  8&  =@ < 8#``@ # 8$L `&  8& ! 8%``@ % 8` &`O &  8&  =@ > 8 @ !  8`'`J `&  8& ! 8 &@ #  8` $`L & { 8&  =@ ~ 8`%  @ %` 8 ' N & d 8& ! ! Ԑ 8 ``@  8``"`I` & F 8& ɐ@ Đ!!f@ @ .!  `@ 8`$  @ $` 8` %`M & c  8& ^  @! @ 2@  `_"@   8 $@ %  8`&`M 3&  8&  d 8 @  8`"J` `&  8&  @ G _"O  < <`ϐ  $@&` !!㿠 &  a@ !^ v ^ (v &  & 㿠 (& 㿠 㿠$Lua: Lua 5.1.4 Copyright (C) 1994-2008 Lua.org, PUC-Rio $ $Authors: R. Ierusalimschy, L. H. de Figueiredo & W. Celes $ $URL: www.lua.org $ (4@LXdpx| `qT`Pql1 (%d instruction%s, %d bytes at %p) mainfunctions%d%s param%s, %d slot%s, %d upvalue%s, +%d local%s, %d constant%s, %d function%s constants (%d) for %p: locals (%d) for %p: %d %s %d %d upvalues (%d) for %p: %d %s no calling environmentno value?(*temporary)=[C]CmainLuatail=(tail call)?localglobalfieldupvaluemethodattempt to %s %s '%s' (a %s value)attempt to %s a %s valueconcatenateperform arithmetic onattempt to compare two %s valuesattempt to compare %s with %s%s:%d: %snot enough memoryerror in error handlingstack overflowncallC stack overflowcannot resume non-suspended coroutineattempt to yield across metamethod/C-call boundaryLuamemory allocation error: block too big(null)%p%... [string ""]MOVELOADKLOADBOOLLOADNILGETUPVALGETGLOBALGETTABLESETGLOBALSETUPVALSETTABLENEWTABLESELFADDSUBMULDIVMODPOWUNMNOTLENCONCATJMPEQLTLETESTTESTSETCALLTAILCALLRETURNFORLOOPFORPREPTFORLOOPSETLISTCLOSECLOSUREVARARG'%s' expectedmain function has more than %d %sfunction at line %d has more than %d %s'%s' expected (to close '%s' at line %d)too many local variableslocal variablesupvalueschunk has too many syntax levelsconstant table overflowitems in a constructorarg or '...' expectedselfambiguous syntax (function call x new statement)function arguments expectedunexpected symbolcannot use '...' outside a vararg functionsyntax errorvariables in assignmentno loop to break(for index)(for limit)(for step)(for generator)(for state)(for control)'=' or 'in' expectednot enough memoryinvalid key to 'next'table overflowtable index is niltable index is NaNnilbooleanuserdatanumberstringtablefunctionthreadprotoupval__index__newindex__gc__mode__eq__add__sub__mul__div__mod__pow__unm__len__lt__le__concat__call%s: %s in precompiled chunkunexpected endbad integerbad constantcode too deepbad codebad headerLuabinary string=?%.14gindexloop in gettableloop in settablestring length overflowget length of'for' initial value must be a number'for' limit must be a number'for' step must be a numberbad argument #%d (%s)nmethodcalling '%s' on bad self (%s)?bad argument #%d to '%s' (%s)%s expected, got %sSl%s:%d: invalid option '%s'stack overflow (%s)value expected_LOADEDname conflict for module '%s' cannot %s %s: %s=stdin@%sropenLuarbreopenreadPANIC: unprotected error in call to Lua API (%s) control structure too longfunction or expression too complexconstant table overflowcode size overflowandbreakdoelseelseifendfalseforfunctionifinlocalnilnotorrepeatreturnthentrueuntilwhile.....==>=<=~=lexical element too longchar(%d)%c%s:%d: %s%s near '%s'chunk has too many linesmalformed numberEe+-unfinished long stringunfinished long commentnesting of [[...]] is deprecatedunfinished stringescape sequence too largeinvalid long string delimiter.00<0H0T0`0l0x00000000000000 0,080D0P0\0h0t00000000000j} | |   oo.o/4/ ooluac.outP .///41 | | | P  d  1DR^| mt 6(0 6XH 6| 7P 9| ;0< ;l = ? @x A Dd F`h -F 9GLp G^| NHH XIH, cP z^  ^t `(  cP e| e|` gLD g h iP i  j x !m *oH 7o Npx4 _vD ew( py< z{t }t ~\ 0, t <  $ `  l @  4     %0 04, ;pd F T a k( v~ @( h 0 X (    | x $8< 1 ;( F( ]D e o x  @X  \   ^}P   ` ^~` ^" " (< d0 !h ,( $4  5T ?l| W( K T(( [P _h pDX }` h dp \ P`  tH ¼ T@ Ô( üT T  d `T   )4@ 3t0 = &ɤ BtX Q Ul\ _ k̀ vΜ {Xp t <p Ѭ  Ҹ L< Ԙ\ : (H p0 נ Hx H  ڨ < 0 s@$ h ,p 3ބ4 ;߸ C`8 S Z d0 d n4P wt   P X<  < $ X     , ^@ @  " 9 A`L /@ N X$ eP n z|   ` $ d 4 0 ^` , @4 t  <   h Xd )  7d D N <P Y _ X i L s  z$h   `  Fh  0 L    1 F5 74 :@ ; >| $?T ,A( 1B|, ?B4 E MC @ WD$ `Dp hElD pEH FT F\ GD Ghp G, IX0 I$ I@ KX( K0 Mh$ Nl, N0 N\ %P$4 6PX8 >TX U0 IV XWH0 oWx wXp0 X\ Y Z [H [< \< _d ^ a bt4 c e4x +eh 7fx Cf Ph Yi jo8 vt0 { M hh  , fd ! T  | 8 L ( y -\4x 8P BS Ph ^Q nt$ xb  ȴ h  44 `  |@ 0 9  $ `$, dP Pb$ -Tt 9N( F UYL8 9J f| p {`t  \l | ( ND 6\, H T    || &;\ 6UP F$, U^4 _4 j4 t5| _xD 0` V  4   bd KX a \K  <  'z4 72xL BQ8 S2 ]Rx hD@ s |[P P  ( /pX 2x Tdt / x|,P = | P    { Rl $+HH ;_H H< VW< a l oQ }1@ |` ;( U K$4 0 d`3H `  SxL c$ /7| =D KH< \h` pY@ }= _@8 f4 J( Kt 50L ~d b\  z< X %v( 4\:Wx` G6H YBP iI$$ z[ XL$ 0td \  aX N@4 Z0d Hht PL l 4, , &PT 3XD ?| eT\ uYD D  (X T|    <U0 8 h4T ]X B4 S,L  DPH D &4\ ;< E7T R`P$ _/ iKX  t0 Gx T, LX\ 4p0 2  T4 L 5T }P nX RH$  C` )dP 86p JY`O44 m5 J\p  ,H( Oh@ | H| ~dh b| LT d )=4 2It$ BQ4P PV a  o{UX, ?h "<0  l  e8 fL %~& 2z< C|>|?TB?hA(B$,BPB|,B4B45T5 5 D113l4445t6 679 <@>?ABdBanotate\ X (55A$>B,ABB|BB (55A0>B<ABB|BBanotate@CLC @C`BDPHD BD$BDpE\ElDEHFTF\GDGhpG,BH(BH<HhtHHI$$IX0I$I@J(K$4KX(K0KLNl,BP$4PX8BQ8QRH$RlSBTdtBTXU0BUVXL$YBZB_H_d`$,`P$`tBpMMhBN\NBWxWHBX\Xp[P[H\4x[\\\BTMh$N0WH0Xp0[H[<\< DHDDH$H4HPHILN\NPHQR\RdRSxST\UUXD[\\\h\t\\^H^\^p^^^^^^^__$_8`H`l,MMh@h8NN$$\|$$$$$8WWH||||(<<,XXp ,HD\P[,,,,,, PPPPPPD]\@Th|Danotate HMMhNNWWHXXpYXY4XYX\8[\\ HMMhNNWWHXXpYXY8XYX\@[]\anotateaaaXb\bt4b|Bc$c4`cde4xehfxfhio8t0|,P|| bHbXbc,dxf|hanotate luac.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o luac.o luac.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7print.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o print.o print.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7;,lapi.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lapi.o lapi.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7wBldebug.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o ldebug.o ldebug.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7Xldo.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o ldo.o ldo.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7nldump.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o ldump.o ldump.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7)lfunc.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lfunc.o lfunc.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7elgc.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lgc.o lgc.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7lmem.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lmem.o lmem.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7lobject.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lobject.o lobject.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7lopcodes.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lopcodes.o lopcodes.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7Tlparser.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lparser.o lparser.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7lstate.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lstate.o lstate.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7lstring.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lstring.o lstring.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.74ltable.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o ltable.o ltable.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7LJltm.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o ltm.o ltm.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7`lundump.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lundump.o lundump.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7vlvm.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lvm.o lvm.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7lzio.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lzio.o lzio.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7;lauxlib.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lauxlib.o lauxlib.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7vlcode.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o lcode.o lcode.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.7llex.c /var/tmp/lua-5.1.4/src /opt/sunstudio12.1/prod/bin/cc -O2 -c -o llex.o llex.cXa;O;R=Sun C 5.10 SunOS_sparc 2009/06/03;backend;raw;cd;DBG_GEN 5.2.771 /var/tmp/lua-5.1.4/srcluac.c82 /var/tmp/lua-5.1.4/srcprint.c71 /var/tmp/lua-5.1.4/srclapi.c93 /var/tmp/lua-5.1.4/srcldebug.c60 /var/tmp/lua-5.1.4/srcldo.c82 /var/tmp/lua-5.1.4/srcldump.c82 /var/tmp/lua-5.1.4/srclfunc.c60 /var/tmp/lua-5.1.4/srclgc.c71 /var/tmp/lua-5.1.4/srclmem.c:4 /var/tmp/lua-5.1.4/srclobject.c;5 /var/tmp/lua-5.1.4/srclopcodes.c:4 /var/tmp/lua-5.1.4/srclparser.c93 /var/tmp/lua-5.1.4/srclstate.c:4 /var/tmp/lua-5.1.4/srclstring.c93 /var/tmp/lua-5.1.4/srcltable.c60 /var/tmp/lua-5.1.4/srcltm.c:4 /var/tmp/lua-5.1.4/srclundump.c60 /var/tmp/lua-5.1.4/srclvm.c71 /var/tmp/lua-5.1.4/srclzio.c:4 /var/tmp/lua-5.1.4/srclauxlib.c82 /var/tmp/lua-5.1.4/srclcode.c71 /var/tmp/lua-5.1.4/srcllex.c DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD% DD%cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)assert.h 1.10 04/05/18 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)setjmp.h 1.38 04/09/28 SMI@(#)setjmp_iso.h 1.2 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03cg: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)libintl.h 1.16 04/09/28 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_sparc 2009/06/03ld: Software Generation Utilities - Solaris Link Editors: 5.10-1.497.interp.hash.dynsym.dynstr.SUNW_version.rela.data.rela.bss.rela.plt.text.init.fini.rodata.rodata1.got.dynamic.symtab.strtab.annotate.debug_info.debug_line.debug_abbrev.comment.shstrtab  0   "o..P-B//  8B//$ BB/4/4 L11KR||X|| ^||fPPoG t2P=\}(J o0&k_+nQ gK0707010005d1f9000041ed0000000000000000000000024c5cc658000000000000010000010036ffffffffffffffff0000001700000000root/usr/local/include0707010005d1fb000081a40000000000000000000000014c5cc64300002da80000010000010036ffffffffffffffff0000001d00000000root/usr/local/include/lua.h/* ** $Id: lua.h,v 1.218.1.5 2008/08/06 13:30:12 roberto Exp $ ** Lua - An Extensible Extension Language ** Lua.org, PUC-Rio, Brazil (http://www.lua.org) ** See Copyright Notice at the end of this file */ #ifndef lua_h #define lua_h #include #include #include "luaconf.h" #define LUA_VERSION "Lua 5.1" #define LUA_RELEASE "Lua 5.1.4" #define LUA_VERSION_NUM 501 #define LUA_COPYRIGHT "Copyright (C) 1994-2008 Lua.org, PUC-Rio" #define LUA_AUTHORS "R. Ierusalimschy, L. H. de Figueiredo & W. Celes" /* mark for precompiled code (`Lua') */ #define LUA_SIGNATURE "\033Lua" /* option for multiple returns in `lua_pcall' and `lua_call' */ #define LUA_MULTRET (-1) /* ** pseudo-indices */ #define LUA_REGISTRYINDEX (-10000) #define LUA_ENVIRONINDEX (-10001) #define LUA_GLOBALSINDEX (-10002) #define lua_upvalueindex(i) (LUA_GLOBALSINDEX-(i)) /* thread status; 0 is OK */ #define LUA_YIELD 1 #define LUA_ERRRUN 2 #define LUA_ERRSYNTAX 3 #define LUA_ERRMEM 4 #define LUA_ERRERR 5 typedef struct lua_State lua_State; typedef int (*lua_CFunction) (lua_State *L); /* ** functions that read/write blocks when loading/dumping Lua chunks */ typedef const char * (*lua_Reader) (lua_State *L, void *ud, size_t *sz); typedef int (*lua_Writer) (lua_State *L, const void* p, size_t sz, void* ud); /* ** prototype for memory-allocation functions */ typedef void * (*lua_Alloc) (void *ud, void *ptr, size_t osize, size_t nsize); /* ** basic types */ #define LUA_TNONE (-1) #define LUA_TNIL 0 #define LUA_TBOOLEAN 1 #define LUA_TLIGHTUSERDATA 2 #define LUA_TNUMBER 3 #define LUA_TSTRING 4 #define LUA_TTABLE 5 #define LUA_TFUNCTION 6 #define LUA_TUSERDATA 7 #define LUA_TTHREAD 8 /* minimum Lua stack available to a C function */ #define LUA_MINSTACK 20 /* ** generic extra include file */ #if defined(LUA_USER_H) #include LUA_USER_H #endif /* type of numbers in Lua */ typedef LUA_NUMBER lua_Number; /* type for integer functions */ typedef LUA_INTEGER lua_Integer; /* ** state manipulation */ LUA_API lua_State *(lua_newstate) (lua_Alloc f, void *ud); LUA_API void (lua_close) (lua_State *L); LUA_API lua_State *(lua_newthread) (lua_State *L); LUA_API lua_CFunction (lua_atpanic) (lua_State *L, lua_CFunction panicf); /* ** basic stack manipulation */ LUA_API int (lua_gettop) (lua_State *L); LUA_API void (lua_settop) (lua_State *L, int idx); LUA_API void (lua_pushvalue) (lua_State *L, int idx); LUA_API void (lua_remove) (lua_State *L, int idx); LUA_API void (lua_insert) (lua_State *L, int idx); LUA_API void (lua_replace) (lua_State *L, int idx); LUA_API int (lua_checkstack) (lua_State *L, int sz); LUA_API void (lua_xmove) (lua_State *from, lua_State *to, int n); /* ** access functions (stack -> C) */ LUA_API int (lua_isnumber) (lua_State *L, int idx); LUA_API int (lua_isstring) (lua_State *L, int idx); LUA_API int (lua_iscfunction) (lua_State *L, int idx); LUA_API int (lua_isuserdata) (lua_State *L, int idx); LUA_API int (lua_type) (lua_State *L, int idx); LUA_API const char *(lua_typename) (lua_State *L, int tp); LUA_API int (lua_equal) (lua_State *L, int idx1, int idx2); LUA_API int (lua_rawequal) (lua_State *L, int idx1, int idx2); LUA_API int (lua_lessthan) (lua_State *L, int idx1, int idx2); LUA_API lua_Number (lua_tonumber) (lua_State *L, int idx); LUA_API lua_Integer (lua_tointeger) (lua_State *L, int idx); LUA_API int (lua_toboolean) (lua_State *L, int idx); LUA_API const char *(lua_tolstring) (lua_State *L, int idx, size_t *len); LUA_API size_t (lua_objlen) (lua_State *L, int idx); LUA_API lua_CFunction (lua_tocfunction) (lua_State *L, int idx); LUA_API void *(lua_touserdata) (lua_State *L, int idx); LUA_API lua_State *(lua_tothread) (lua_State *L, int idx); LUA_API const void *(lua_topointer) (lua_State *L, int idx); /* ** push functions (C -> stack) */ LUA_API void (lua_pushnil) (lua_State *L); LUA_API void (lua_pushnumber) (lua_State *L, lua_Number n); LUA_API void (lua_pushinteger) (lua_State *L, lua_Integer n); LUA_API void (lua_pushlstring) (lua_State *L, const char *s, size_t l); LUA_API void (lua_pushstring) (lua_State *L, const char *s); LUA_API const char *(lua_pushvfstring) (lua_State *L, const char *fmt, va_list argp); LUA_API const char *(lua_pushfstring) (lua_State *L, const char *fmt, ...); LUA_API void (lua_pushcclosure) (lua_State *L, lua_CFunction fn, int n); LUA_API void (lua_pushboolean) (lua_State *L, int b); LUA_API void (lua_pushlightuserdata) (lua_State *L, void *p); LUA_API int (lua_pushthread) (lua_State *L); /* ** get functions (Lua -> stack) */ LUA_API void (lua_gettable) (lua_State *L, int idx); LUA_API void (lua_getfield) (lua_State *L, int idx, const char *k); LUA_API void (lua_rawget) (lua_State *L, int idx); LUA_API void (lua_rawgeti) (lua_State *L, int idx, int n); LUA_API void (lua_createtable) (lua_State *L, int narr, int nrec); LUA_API void *(lua_newuserdata) (lua_State *L, size_t sz); LUA_API int (lua_getmetatable) (lua_State *L, int objindex); LUA_API void (lua_getfenv) (lua_State *L, int idx); /* ** set functions (stack -> Lua) */ LUA_API void (lua_settable) (lua_State *L, int idx); LUA_API void (lua_setfield) (lua_State *L, int idx, const char *k); LUA_API void (lua_rawset) (lua_State *L, int idx); LUA_API void (lua_rawseti) (lua_State *L, int idx, int n); LUA_API int (lua_setmetatable) (lua_State *L, int objindex); LUA_API int (lua_setfenv) (lua_State *L, int idx); /* ** `load' and `call' functions (load and run Lua code) */ LUA_API void (lua_call) (lua_State *L, int nargs, int nresults); LUA_API int (lua_pcall) (lua_State *L, int nargs, int nresults, int errfunc); LUA_API int (lua_cpcall) (lua_State *L, lua_CFunction func, void *ud); LUA_API int (lua_load) (lua_State *L, lua_Reader reader, void *dt, const char *chunkname); LUA_API int (lua_dump) (lua_State *L, lua_Writer writer, void *data); /* ** coroutine functions */ LUA_API int (lua_yield) (lua_State *L, int nresults); LUA_API int (lua_resume) (lua_State *L, int narg); LUA_API int (lua_status) (lua_State *L); /* ** garbage-collection function and options */ #define LUA_GCSTOP 0 #define LUA_GCRESTART 1 #define LUA_GCCOLLECT 2 #define LUA_GCCOUNT 3 #define LUA_GCCOUNTB 4 #define LUA_GCSTEP 5 #define LUA_GCSETPAUSE 6 #define LUA_GCSETSTEPMUL 7 LUA_API int (lua_gc) (lua_State *L, int what, int data); /* ** miscellaneous functions */ LUA_API int (lua_error) (lua_State *L); LUA_API int (lua_next) (lua_State *L, int idx); LUA_API void (lua_concat) (lua_State *L, int n); LUA_API lua_Alloc (lua_getallocf) (lua_State *L, void **ud); LUA_API void lua_setallocf (lua_State *L, lua_Alloc f, void *ud); /* ** =============================================================== ** some useful macros ** =============================================================== */ #define lua_pop(L,n) lua_settop(L, -(n)-1) #define lua_newtable(L) lua_createtable(L, 0, 0) #define lua_register(L,n,f) (lua_pushcfunction(L, (f)), lua_setglobal(L, (n))) #define lua_pushcfunction(L,f) lua_pushcclosure(L, (f), 0) #define lua_strlen(L,i) lua_objlen(L, (i)) #define lua_isfunction(L,n) (lua_type(L, (n)) == LUA_TFUNCTION) #define lua_istable(L,n) (lua_type(L, (n)) == LUA_TTABLE) #define lua_islightuserdata(L,n) (lua_type(L, (n)) == LUA_TLIGHTUSERDATA) #define lua_isnil(L,n) (lua_type(L, (n)) == LUA_TNIL) #define lua_isboolean(L,n) (lua_type(L, (n)) == LUA_TBOOLEAN) #define lua_isthread(L,n) (lua_type(L, (n)) == LUA_TTHREAD) #define lua_isnone(L,n) (lua_type(L, (n)) == LUA_TNONE) #define lua_isnoneornil(L, n) (lua_type(L, (n)) <= 0) #define lua_pushliteral(L, s) \ lua_pushlstring(L, "" s, (sizeof(s)/sizeof(char))-1) #define lua_setglobal(L,s) lua_setfield(L, LUA_GLOBALSINDEX, (s)) #define lua_getglobal(L,s) lua_getfield(L, LUA_GLOBALSINDEX, (s)) #define lua_tostring(L,i) lua_tolstring(L, (i), NULL) /* ** compatibility macros and functions */ #define lua_open() luaL_newstate() #define lua_getregistry(L) lua_pushvalue(L, LUA_REGISTRYINDEX) #define lua_getgccount(L) lua_gc(L, LUA_GCCOUNT, 0) #define lua_Chunkreader lua_Reader #define lua_Chunkwriter lua_Writer /* hack */ LUA_API void lua_setlevel (lua_State *from, lua_State *to); /* ** {====================================================================== ** Debug API ** ======================================================================= */ /* ** Event codes */ #define LUA_HOOKCALL 0 #define LUA_HOOKRET 1 #define LUA_HOOKLINE 2 #define LUA_HOOKCOUNT 3 #define LUA_HOOKTAILRET 4 /* ** Event masks */ #define LUA_MASKCALL (1 << LUA_HOOKCALL) #define LUA_MASKRET (1 << LUA_HOOKRET) #define LUA_MASKLINE (1 << LUA_HOOKLINE) #define LUA_MASKCOUNT (1 << LUA_HOOKCOUNT) typedef struct lua_Debug lua_Debug; /* activation record */ /* Functions to be called by the debuger in specific events */ typedef void (*lua_Hook) (lua_State *L, lua_Debug *ar); LUA_API int lua_getstack (lua_State *L, int level, lua_Debug *ar); LUA_API int lua_getinfo (lua_State *L, const char *what, lua_Debug *ar); LUA_API const char *lua_getlocal (lua_State *L, const lua_Debug *ar, int n); LUA_API const char *lua_setlocal (lua_State *L, const lua_Debug *ar, int n); LUA_API const char *lua_getupvalue (lua_State *L, int funcindex, int n); LUA_API const char *lua_setupvalue (lua_State *L, int funcindex, int n); LUA_API int lua_sethook (lua_State *L, lua_Hook func, int mask, int count); LUA_API lua_Hook lua_gethook (lua_State *L); LUA_API int lua_gethookmask (lua_State *L); LUA_API int lua_gethookcount (lua_State *L); struct lua_Debug { int event; const char *name; /* (n) */ const char *namewhat; /* (n) `global', `local', `field', `method' */ const char *what; /* (S) `Lua', `C', `main', `tail' */ const char *source; /* (S) */ int currentline; /* (l) */ int nups; /* (u) number of upvalues */ int linedefined; /* (S) */ int lastlinedefined; /* (S) */ char short_src[LUA_IDSIZE]; /* (S) */ /* private part */ int i_ci; /* active function */ }; /* }====================================================================== */ /****************************************************************************** * Copyright (C) 1994-2008 Lua.org, PUC-Rio. All rights reserved. * * Permission is hereby granted, free of charge, to any person obtaining * a copy of this software and associated documentation files (the * "Software"), to deal in the Software without restriction, including * without limitation the rights to use, copy, modify, merge, publish, * distribute, sublicense, and/or sell copies of the Software, and to * permit persons to whom the Software is furnished to do so, subject to * the following conditions: * * The above copyright notice and this permission notice shall be * included in all copies or substantial portions of the Software. * * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. * IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY * CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. ******************************************************************************/ #endif 0707010005d1fa000081a40000000000000000000000014c5cc643000016910000010000010036ffffffffffffffff0000002100000000root/usr/local/include/lauxlib.h/* ** $Id: lauxlib.h,v 1.88.1.1 2007/12/27 13:02:25 roberto Exp $ ** Auxiliary functions for building Lua libraries ** See Copyright Notice in lua.h */ #ifndef lauxlib_h #define lauxlib_h #include #include #include "lua.h" #if defined(LUA_COMPAT_GETN) LUALIB_API int (luaL_getn) (lua_State *L, int t); LUALIB_API void (luaL_setn) (lua_State *L, int t, int n); #else #define luaL_getn(L,i) ((int)lua_objlen(L, i)) #define luaL_setn(L,i,j) ((void)0) /* no op! */ #endif #if defined(LUA_COMPAT_OPENLIB) #define luaI_openlib luaL_openlib #endif /* extra error code for `luaL_load' */ #define LUA_ERRFILE (LUA_ERRERR+1) typedef struct luaL_Reg { const char *name; lua_CFunction func; } luaL_Reg; LUALIB_API void (luaI_openlib) (lua_State *L, const char *libname, const luaL_Reg *l, int nup); LUALIB_API void (luaL_register) (lua_State *L, const char *libname, const luaL_Reg *l); LUALIB_API int (luaL_getmetafield) (lua_State *L, int obj, const char *e); LUALIB_API int (luaL_callmeta) (lua_State *L, int obj, const char *e); LUALIB_API int (luaL_typerror) (lua_State *L, int narg, const char *tname); LUALIB_API int (luaL_argerror) (lua_State *L, int numarg, const char *extramsg); LUALIB_API const char *(luaL_checklstring) (lua_State *L, int numArg, size_t *l); LUALIB_API const char *(luaL_optlstring) (lua_State *L, int numArg, const char *def, size_t *l); LUALIB_API lua_Number (luaL_checknumber) (lua_State *L, int numArg); LUALIB_API lua_Number (luaL_optnumber) (lua_State *L, int nArg, lua_Number def); LUALIB_API lua_Integer (luaL_checkinteger) (lua_State *L, int numArg); LUALIB_API lua_Integer (luaL_optinteger) (lua_State *L, int nArg, lua_Integer def); LUALIB_API void (luaL_checkstack) (lua_State *L, int sz, const char *msg); LUALIB_API void (luaL_checktype) (lua_State *L, int narg, int t); LUALIB_API void (luaL_checkany) (lua_State *L, int narg); LUALIB_API int (luaL_newmetatable) (lua_State *L, const char *tname); LUALIB_API void *(luaL_checkudata) (lua_State *L, int ud, const char *tname); LUALIB_API void (luaL_where) (lua_State *L, int lvl); LUALIB_API int (luaL_error) (lua_State *L, const char *fmt, ...); LUALIB_API int (luaL_checkoption) (lua_State *L, int narg, const char *def, const char *const lst[]); LUALIB_API int (luaL_ref) (lua_State *L, int t); LUALIB_API void (luaL_unref) (lua_State *L, int t, int ref); LUALIB_API int (luaL_loadfile) (lua_State *L, const char *filename); LUALIB_API int (luaL_loadbuffer) (lua_State *L, const char *buff, size_t sz, const char *name); LUALIB_API int (luaL_loadstring) (lua_State *L, const char *s); LUALIB_API lua_State *(luaL_newstate) (void); LUALIB_API const char *(luaL_gsub) (lua_State *L, const char *s, const char *p, const char *r); LUALIB_API const char *(luaL_findtable) (lua_State *L, int idx, const char *fname, int szhint); /* ** =============================================================== ** some useful macros ** =============================================================== */ #define luaL_argcheck(L, cond,numarg,extramsg) \ ((void)((cond) || luaL_argerror(L, (numarg), (extramsg)))) #define luaL_checkstring(L,n) (luaL_checklstring(L, (n), NULL)) #define luaL_optstring(L,n,d) (luaL_optlstring(L, (n), (d), NULL)) #define luaL_checkint(L,n) ((int)luaL_checkinteger(L, (n))) #define luaL_optint(L,n,d) ((int)luaL_optinteger(L, (n), (d))) #define luaL_checklong(L,n) ((long)luaL_checkinteger(L, (n))) #define luaL_optlong(L,n,d) ((long)luaL_optinteger(L, (n), (d))) #define luaL_typename(L,i) lua_typename(L, lua_type(L,(i))) #define luaL_dofile(L, fn) \ (luaL_loadfile(L, fn) || lua_pcall(L, 0, LUA_MULTRET, 0)) #define luaL_dostring(L, s) \ (luaL_loadstring(L, s) || lua_pcall(L, 0, LUA_MULTRET, 0)) #define luaL_getmetatable(L,n) (lua_getfield(L, LUA_REGISTRYINDEX, (n))) #define luaL_opt(L,f,n,d) (lua_isnoneornil(L,(n)) ? (d) : f(L,(n))) /* ** {====================================================== ** Generic Buffer manipulation ** ======================================================= */ typedef struct luaL_Buffer { char *p; /* current position in buffer */ int lvl; /* number of strings in the stack (level) */ lua_State *L; char buffer[LUAL_BUFFERSIZE]; } luaL_Buffer; #define luaL_addchar(B,c) \ ((void)((B)->p < ((B)->buffer+LUAL_BUFFERSIZE) || luaL_prepbuffer(B)), \ (*(B)->p++ = (char)(c))) /* compatibility only */ #define luaL_putchar(B,c) luaL_addchar(B,c) #define luaL_addsize(B,n) ((B)->p += (n)) LUALIB_API void (luaL_buffinit) (lua_State *L, luaL_Buffer *B); LUALIB_API char *(luaL_prepbuffer) (luaL_Buffer *B); LUALIB_API void (luaL_addlstring) (luaL_Buffer *B, const char *s, size_t l); LUALIB_API void (luaL_addstring) (luaL_Buffer *B, const char *s); LUALIB_API void (luaL_addvalue) (luaL_Buffer *B); LUALIB_API void (luaL_pushresult) (luaL_Buffer *B); /* }====================================================== */ /* compatibility with ref system */ /* pre-defined references */ #define LUA_NOREF (-2) #define LUA_REFNIL (-1) #define lua_ref(L,lock) ((lock) ? luaL_ref(L, LUA_REGISTRYINDEX) : \ (lua_pushstring(L, "unlocked references are obsolete"), lua_error(L), 0)) #define lua_unref(L,ref) luaL_unref(L, LUA_REGISTRYINDEX, (ref)) #define lua_getref(L,ref) lua_rawgeti(L, LUA_REGISTRYINDEX, (ref)) #define luaL_reg luaL_Reg #endif 0707010005d1fe000081a40000000000000000000000014c5cc643000004020000010000010036ffffffffffffffff0000002000000000root/usr/local/include/lualib.h/* ** $Id: lualib.h,v 1.36.1.1 2007/12/27 13:02:25 roberto Exp $ ** Lua standard libraries ** See Copyright Notice in lua.h */ #ifndef lualib_h #define lualib_h #include "lua.h" /* Key to file-handle type */ #define LUA_FILEHANDLE "FILE*" #define LUA_COLIBNAME "coroutine" LUALIB_API int (luaopen_base) (lua_State *L); #define LUA_TABLIBNAME "table" LUALIB_API int (luaopen_table) (lua_State *L); #define LUA_IOLIBNAME "io" LUALIB_API int (luaopen_io) (lua_State *L); #define LUA_OSLIBNAME "os" LUALIB_API int (luaopen_os) (lua_State *L); #define LUA_STRLIBNAME "string" LUALIB_API int (luaopen_string) (lua_State *L); #define LUA_MATHLIBNAME "math" LUALIB_API int (luaopen_math) (lua_State *L); #define LUA_DBLIBNAME "debug" LUALIB_API int (luaopen_debug) (lua_State *L); #define LUA_LOADLIBNAME "package" LUALIB_API int (luaopen_package) (lua_State *L); /* open all previous libraries */ LUALIB_API void (luaL_openlibs) (lua_State *L); #ifndef lua_assert #define lua_assert(x) ((void)0) #endif #endif 0707010005d1fd000081a40000000000000000000000014c5cc6430000571b0000010000010036ffffffffffffffff0000002100000000root/usr/local/include/luaconf.h/* ** $Id: luaconf.h,v 1.82.1.7 2008/02/11 16:25:08 roberto Exp $ ** Configuration file for Lua ** See Copyright Notice in lua.h */ #ifndef lconfig_h #define lconfig_h #include #include /* ** ================================================================== ** Search for "@@" to find all configurable definitions. ** =================================================================== */ /* @@ LUA_ANSI controls the use of non-ansi features. ** CHANGE it (define it) if you want Lua to avoid the use of any ** non-ansi feature or library. */ #if defined(__STRICT_ANSI__) #define LUA_ANSI #endif #if !defined(LUA_ANSI) && defined(_WIN32) #define LUA_WIN #endif #if defined(LUA_USE_LINUX) #define LUA_USE_POSIX #define LUA_USE_DLOPEN /* needs an extra library: -ldl */ #define LUA_USE_READLINE /* needs some extra libraries */ #endif #if defined(LUA_USE_MACOSX) #define LUA_USE_POSIX #define LUA_DL_DYLD /* does not need extra library */ #endif /* @@ LUA_USE_POSIX includes all functionallity listed as X/Open System @* Interfaces Extension (XSI). ** CHANGE it (define it) if your system is XSI compatible. */ #if defined(LUA_USE_POSIX) #define LUA_USE_MKSTEMP #define LUA_USE_ISATTY #define LUA_USE_POPEN #define LUA_USE_ULONGJMP #endif /* @@ LUA_PATH and LUA_CPATH are the names of the environment variables that @* Lua check to set its paths. @@ LUA_INIT is the name of the environment variable that Lua @* checks for initialization code. ** CHANGE them if you want different names. */ #define LUA_PATH "LUA_PATH" #define LUA_CPATH "LUA_CPATH" #define LUA_INIT "LUA_INIT" /* @@ LUA_PATH_DEFAULT is the default path that Lua uses to look for @* Lua libraries. @@ LUA_CPATH_DEFAULT is the default path that Lua uses to look for @* C libraries. ** CHANGE them if your machine has a non-conventional directory ** hierarchy or if you want to install your libraries in ** non-conventional directories. */ #if defined(_WIN32) /* ** In Windows, any exclamation mark ('!') in the path is replaced by the ** path of the directory of the executable file of the current process. */ #define LUA_LDIR "!\\lua\\" #define LUA_CDIR "!\\" #define LUA_PATH_DEFAULT \ ".\\?.lua;" LUA_LDIR"?.lua;" LUA_LDIR"?\\init.lua;" \ LUA_CDIR"?.lua;" LUA_CDIR"?\\init.lua" #define LUA_CPATH_DEFAULT \ ".\\?.dll;" LUA_CDIR"?.dll;" LUA_CDIR"loadall.dll" #else #define LUA_ROOT "/usr/local/" #define LUA_LDIR LUA_ROOT "share/lua/5.1/" #define LUA_CDIR LUA_ROOT "lib/lua/5.1/" #define LUA_PATH_DEFAULT \ "./?.lua;" LUA_LDIR"?.lua;" LUA_LDIR"?/init.lua;" \ LUA_CDIR"?.lua;" LUA_CDIR"?/init.lua" #define LUA_CPATH_DEFAULT \ "./?.so;" LUA_CDIR"?.so;" LUA_CDIR"loadall.so" #endif /* @@ LUA_DIRSEP is the directory separator (for submodules). ** CHANGE it if your machine does not use "/" as the directory separator ** and is not Windows. (On Windows Lua automatically uses "\".) */ #if defined(_WIN32) #define LUA_DIRSEP "\\" #else #define LUA_DIRSEP "/" #endif /* @@ LUA_PATHSEP is the character that separates templates in a path. @@ LUA_PATH_MARK is the string that marks the substitution points in a @* template. @@ LUA_EXECDIR in a Windows path is replaced by the executable's @* directory. @@ LUA_IGMARK is a mark to ignore all before it when bulding the @* luaopen_ function name. ** CHANGE them if for some reason your system cannot use those ** characters. (E.g., if one of those characters is a common character ** in file/directory names.) Probably you do not need to change them. */ #define LUA_PATHSEP ";" #define LUA_PATH_MARK "?" #define LUA_EXECDIR "!" #define LUA_IGMARK "-" /* @@ LUA_INTEGER is the integral type used by lua_pushinteger/lua_tointeger. ** CHANGE that if ptrdiff_t is not adequate on your machine. (On most ** machines, ptrdiff_t gives a good choice between int or long.) */ #define LUA_INTEGER ptrdiff_t /* @@ LUA_API is a mark for all core API functions. @@ LUALIB_API is a mark for all standard library functions. ** CHANGE them if you need to define those functions in some special way. ** For instance, if you want to create one Windows DLL with the core and ** the libraries, you may want to use the following definition (define ** LUA_BUILD_AS_DLL to get it). */ #if defined(LUA_BUILD_AS_DLL) #if defined(LUA_CORE) || defined(LUA_LIB) #define LUA_API __declspec(dllexport) #else #define LUA_API __declspec(dllimport) #endif #else #define LUA_API extern #endif /* more often than not the libs go together with the core */ #define LUALIB_API LUA_API /* @@ LUAI_FUNC is a mark for all extern functions that are not to be @* exported to outside modules. @@ LUAI_DATA is a mark for all extern (const) variables that are not to @* be exported to outside modules. ** CHANGE them if you need to mark them in some special way. Elf/gcc ** (versions 3.2 and later) mark them as "hidden" to optimize access ** when Lua is compiled as a shared library. */ #if defined(luaall_c) #define LUAI_FUNC static #define LUAI_DATA /* empty */ #elif defined(__GNUC__) && ((__GNUC__*100 + __GNUC_MINOR__) >= 302) && \ defined(__ELF__) #define LUAI_FUNC __attribute__((visibility("hidden"))) extern #define LUAI_DATA LUAI_FUNC #else #define LUAI_FUNC extern #define LUAI_DATA extern #endif /* @@ LUA_QL describes how error messages quote program elements. ** CHANGE it if you want a different appearance. */ #define LUA_QL(x) "'" x "'" #define LUA_QS LUA_QL("%s") /* @@ LUA_IDSIZE gives the maximum size for the description of the source @* of a function in debug information. ** CHANGE it if you want a different size. */ #define LUA_IDSIZE 60 /* ** {================================================================== ** Stand-alone configuration ** =================================================================== */ #if defined(lua_c) || defined(luaall_c) /* @@ lua_stdin_is_tty detects whether the standard input is a 'tty' (that @* is, whether we're running lua interactively). ** CHANGE it if you have a better definition for non-POSIX/non-Windows ** systems. */ #if defined(LUA_USE_ISATTY) #include #define lua_stdin_is_tty() isatty(0) #elif defined(LUA_WIN) #include #include #define lua_stdin_is_tty() _isatty(_fileno(stdin)) #else #define lua_stdin_is_tty() 1 /* assume stdin is a tty */ #endif /* @@ LUA_PROMPT is the default prompt used by stand-alone Lua. @@ LUA_PROMPT2 is the default continuation prompt used by stand-alone Lua. ** CHANGE them if you want different prompts. (You can also change the ** prompts dynamically, assigning to globals _PROMPT/_PROMPT2.) */ #define LUA_PROMPT "> " #define LUA_PROMPT2 ">> " /* @@ LUA_PROGNAME is the default name for the stand-alone Lua program. ** CHANGE it if your stand-alone interpreter has a different name and ** your system is not able to detect that name automatically. */ #define LUA_PROGNAME "lua" /* @@ LUA_MAXINPUT is the maximum length for an input line in the @* stand-alone interpreter. ** CHANGE it if you need longer lines. */ #define LUA_MAXINPUT 512 /* @@ lua_readline defines how to show a prompt and then read a line from @* the standard input. @@ lua_saveline defines how to "save" a read line in a "history". @@ lua_freeline defines how to free a line read by lua_readline. ** CHANGE them if you want to improve this functionality (e.g., by using ** GNU readline and history facilities). */ #if defined(LUA_USE_READLINE) #include #include #include #define lua_readline(L,b,p) ((void)L, ((b)=readline(p)) != NULL) #define lua_saveline(L,idx) \ if (lua_strlen(L,idx) > 0) /* non-empty line? */ \ add_history(lua_tostring(L, idx)); /* add it to history */ #define lua_freeline(L,b) ((void)L, free(b)) #else #define lua_readline(L,b,p) \ ((void)L, fputs(p, stdout), fflush(stdout), /* show prompt */ \ fgets(b, LUA_MAXINPUT, stdin) != NULL) /* get line */ #define lua_saveline(L,idx) { (void)L; (void)idx; } #define lua_freeline(L,b) { (void)L; (void)b; } #endif #endif /* }================================================================== */ /* @@ LUAI_GCPAUSE defines the default pause between garbage-collector cycles @* as a percentage. ** CHANGE it if you want the GC to run faster or slower (higher values ** mean larger pauses which mean slower collection.) You can also change ** this value dynamically. */ #define LUAI_GCPAUSE 200 /* 200% (wait memory to double before next GC) */ /* @@ LUAI_GCMUL defines the default speed of garbage collection relative to @* memory allocation as a percentage. ** CHANGE it if you want to change the granularity of the garbage ** collection. (Higher values mean coarser collections. 0 represents ** infinity, where each step performs a full collection.) You can also ** change this value dynamically. */ #define LUAI_GCMUL 200 /* GC runs 'twice the speed' of memory allocation */ /* @@ LUA_COMPAT_GETN controls compatibility with old getn behavior. ** CHANGE it (define it) if you want exact compatibility with the ** behavior of setn/getn in Lua 5.0. */ #undef LUA_COMPAT_GETN /* @@ LUA_COMPAT_LOADLIB controls compatibility about global loadlib. ** CHANGE it to undefined as soon as you do not need a global 'loadlib' ** function (the function is still available as 'package.loadlib'). */ #undef LUA_COMPAT_LOADLIB /* @@ LUA_COMPAT_VARARG controls compatibility with old vararg feature. ** CHANGE it to undefined as soon as your programs use only '...' to ** access vararg parameters (instead of the old 'arg' table). */ #define LUA_COMPAT_VARARG /* @@ LUA_COMPAT_MOD controls compatibility with old math.mod function. ** CHANGE it to undefined as soon as your programs use 'math.fmod' or ** the new '%' operator instead of 'math.mod'. */ #define LUA_COMPAT_MOD /* @@ LUA_COMPAT_LSTR controls compatibility with old long string nesting @* facility. ** CHANGE it to 2 if you want the old behaviour, or undefine it to turn ** off the advisory error when nesting [[...]]. */ #define LUA_COMPAT_LSTR 1 /* @@ LUA_COMPAT_GFIND controls compatibility with old 'string.gfind' name. ** CHANGE it to undefined as soon as you rename 'string.gfind' to ** 'string.gmatch'. */ #define LUA_COMPAT_GFIND /* @@ LUA_COMPAT_OPENLIB controls compatibility with old 'luaL_openlib' @* behavior. ** CHANGE it to undefined as soon as you replace to 'luaL_register' ** your uses of 'luaL_openlib' */ #define LUA_COMPAT_OPENLIB /* @@ luai_apicheck is the assert macro used by the Lua-C API. ** CHANGE luai_apicheck if you want Lua to perform some checks in the ** parameters it gets from API calls. This may slow down the interpreter ** a bit, but may be quite useful when debugging C code that interfaces ** with Lua. A useful redefinition is to use assert.h. */ #if defined(LUA_USE_APICHECK) #include #define luai_apicheck(L,o) { (void)L; assert(o); } #else #define luai_apicheck(L,o) { (void)L; } #endif /* @@ LUAI_BITSINT defines the number of bits in an int. ** CHANGE here if Lua cannot automatically detect the number of bits of ** your machine. Probably you do not need to change this. */ /* avoid overflows in comparison */ #if INT_MAX-20 < 32760 #define LUAI_BITSINT 16 #elif INT_MAX > 2147483640L /* int has at least 32 bits */ #define LUAI_BITSINT 32 #else #error "you must define LUA_BITSINT with number of bits in an integer" #endif /* @@ LUAI_UINT32 is an unsigned integer with at least 32 bits. @@ LUAI_INT32 is an signed integer with at least 32 bits. @@ LUAI_UMEM is an unsigned integer big enough to count the total @* memory used by Lua. @@ LUAI_MEM is a signed integer big enough to count the total memory @* used by Lua. ** CHANGE here if for some weird reason the default definitions are not ** good enough for your machine. (The definitions in the 'else' ** part always works, but may waste space on machines with 64-bit ** longs.) Probably you do not need to change this. */ #if LUAI_BITSINT >= 32 #define LUAI_UINT32 unsigned int #define LUAI_INT32 int #define LUAI_MAXINT32 INT_MAX #define LUAI_UMEM size_t #define LUAI_MEM ptrdiff_t #else /* 16-bit ints */ #define LUAI_UINT32 unsigned long #define LUAI_INT32 long #define LUAI_MAXINT32 LONG_MAX #define LUAI_UMEM unsigned long #define LUAI_MEM long #endif /* @@ LUAI_MAXCALLS limits the number of nested calls. ** CHANGE it if you need really deep recursive calls. This limit is ** arbitrary; its only purpose is to stop infinite recursion before ** exhausting memory. */ #define LUAI_MAXCALLS 20000 /* @@ LUAI_MAXCSTACK limits the number of Lua stack slots that a C function @* can use. ** CHANGE it if you need lots of (Lua) stack space for your C ** functions. This limit is arbitrary; its only purpose is to stop C ** functions to consume unlimited stack space. (must be smaller than ** -LUA_REGISTRYINDEX) */ #define LUAI_MAXCSTACK 8000 /* ** {================================================================== ** CHANGE (to smaller values) the following definitions if your system ** has a small C stack. (Or you may want to change them to larger ** values if your system has a large C stack and these limits are ** too rigid for you.) Some of these constants control the size of ** stack-allocated arrays used by the compiler or the interpreter, while ** others limit the maximum number of recursive calls that the compiler ** or the interpreter can perform. Values too large may cause a C stack ** overflow for some forms of deep constructs. ** =================================================================== */ /* @@ LUAI_MAXCCALLS is the maximum depth for nested C calls (short) and @* syntactical nested non-terminals in a program. */ #define LUAI_MAXCCALLS 200 /* @@ LUAI_MAXVARS is the maximum number of local variables per function @* (must be smaller than 250). */ #define LUAI_MAXVARS 200 /* @@ LUAI_MAXUPVALUES is the maximum number of upvalues per function @* (must be smaller than 250). */ #define LUAI_MAXUPVALUES 60 /* @@ LUAL_BUFFERSIZE is the buffer size used by the lauxlib buffer system. */ #define LUAL_BUFFERSIZE BUFSIZ /* }================================================================== */ /* ** {================================================================== @@ LUA_NUMBER is the type of numbers in Lua. ** CHANGE the following definitions only if you want to build Lua ** with a number type different from double. You may also need to ** change lua_number2int & lua_number2integer. ** =================================================================== */ #define LUA_NUMBER_DOUBLE #define LUA_NUMBER double /* @@ LUAI_UACNUMBER is the result of an 'usual argument conversion' @* over a number. */ #define LUAI_UACNUMBER double /* @@ LUA_NUMBER_SCAN is the format for reading numbers. @@ LUA_NUMBER_FMT is the format for writing numbers. @@ lua_number2str converts a number to a string. @@ LUAI_MAXNUMBER2STR is maximum size of previous conversion. @@ lua_str2number converts a string to a number. */ #define LUA_NUMBER_SCAN "%lf" #define LUA_NUMBER_FMT "%.14g" #define lua_number2str(s,n) sprintf((s), LUA_NUMBER_FMT, (n)) #define LUAI_MAXNUMBER2STR 32 /* 16 digits, sign, point, and \0 */ #define lua_str2number(s,p) strtod((s), (p)) /* @@ The luai_num* macros define the primitive operations over numbers. */ #if defined(LUA_CORE) #include #define luai_numadd(a,b) ((a)+(b)) #define luai_numsub(a,b) ((a)-(b)) #define luai_nummul(a,b) ((a)*(b)) #define luai_numdiv(a,b) ((a)/(b)) #define luai_nummod(a,b) ((a) - floor((a)/(b))*(b)) #define luai_numpow(a,b) (pow(a,b)) #define luai_numunm(a) (-(a)) #define luai_numeq(a,b) ((a)==(b)) #define luai_numlt(a,b) ((a)<(b)) #define luai_numle(a,b) ((a)<=(b)) #define luai_numisnan(a) (!luai_numeq((a), (a))) #endif /* @@ lua_number2int is a macro to convert lua_Number to int. @@ lua_number2integer is a macro to convert lua_Number to lua_Integer. ** CHANGE them if you know a faster way to convert a lua_Number to ** int (with any rounding method and without throwing errors) in your ** system. In Pentium machines, a naive typecast from double to int ** in C is extremely slow, so any alternative is worth trying. */ /* On a Pentium, resort to a trick */ #if defined(LUA_NUMBER_DOUBLE) && !defined(LUA_ANSI) && !defined(__SSE2__) && \ (defined(__i386) || defined (_M_IX86) || defined(__i386__)) /* On a Microsoft compiler, use assembler */ #if defined(_MSC_VER) #define lua_number2int(i,d) __asm fld d __asm fistp i #define lua_number2integer(i,n) lua_number2int(i, n) /* the next trick should work on any Pentium, but sometimes clashes with a DirectX idiosyncrasy */ #else union luai_Cast { double l_d; long l_l; }; #define lua_number2int(i,d) \ { volatile union luai_Cast u; u.l_d = (d) + 6755399441055744.0; (i) = u.l_l; } #define lua_number2integer(i,n) lua_number2int(i, n) #endif /* this option always works, but may be slow */ #else #define lua_number2int(i,d) ((i)=(int)(d)) #define lua_number2integer(i,d) ((i)=(lua_Integer)(d)) #endif /* }================================================================== */ /* @@ LUAI_USER_ALIGNMENT_T is a type that requires maximum alignment. ** CHANGE it if your system requires alignments larger than double. (For ** instance, if your system supports long doubles and they must be ** aligned in 16-byte boundaries, then you should add long double in the ** union.) Probably you do not need to change this. */ #define LUAI_USER_ALIGNMENT_T union { double u; void *s; long l; } /* @@ LUAI_THROW/LUAI_TRY define how Lua does exception handling. ** CHANGE them if you prefer to use longjmp/setjmp even with C++ ** or if want/don't to use _longjmp/_setjmp instead of regular ** longjmp/setjmp. By default, Lua handles errors with exceptions when ** compiling as C++ code, with _longjmp/_setjmp when asked to use them, ** and with longjmp/setjmp otherwise. */ #if defined(__cplusplus) /* C++ exceptions */ #define LUAI_THROW(L,c) throw(c) #define LUAI_TRY(L,c,a) try { a } catch(...) \ { if ((c)->status == 0) (c)->status = -1; } #define luai_jmpbuf int /* dummy variable */ #elif defined(LUA_USE_ULONGJMP) /* in Unix, try _longjmp/_setjmp (more efficient) */ #define LUAI_THROW(L,c) _longjmp((c)->b, 1) #define LUAI_TRY(L,c,a) if (_setjmp((c)->b) == 0) { a } #define luai_jmpbuf jmp_buf #else /* default handling with long jumps */ #define LUAI_THROW(L,c) longjmp((c)->b, 1) #define LUAI_TRY(L,c,a) if (setjmp((c)->b) == 0) { a } #define luai_jmpbuf jmp_buf #endif /* @@ LUA_MAXCAPTURES is the maximum number of captures that a pattern @* can do during pattern-matching. ** CHANGE it if you need more captures. This limit is arbitrary. */ #define LUA_MAXCAPTURES 32 /* @@ lua_tmpnam is the function that the OS library uses to create a @* temporary name. @@ LUA_TMPNAMBUFSIZE is the maximum size of a name created by lua_tmpnam. ** CHANGE them if you have an alternative to tmpnam (which is considered ** insecure) or if you want the original tmpnam anyway. By default, Lua ** uses tmpnam except when POSIX is available, where it uses mkstemp. */ #if defined(loslib_c) || defined(luaall_c) #if defined(LUA_USE_MKSTEMP) #include #define LUA_TMPNAMBUFSIZE 32 #define lua_tmpnam(b,e) { \ strcpy(b, "/tmp/lua_XXXXXX"); \ e = mkstemp(b); \ if (e != -1) close(e); \ e = (e == -1); } #else #define LUA_TMPNAMBUFSIZE L_tmpnam #define lua_tmpnam(b,e) { e = (tmpnam(b) == NULL); } #endif #endif /* @@ lua_popen spawns a new process connected to the current one through @* the file streams. ** CHANGE it if you have a way to implement it in your system. */ #if defined(LUA_USE_POPEN) #define lua_popen(L,c,m) ((void)L, fflush(NULL), popen(c,m)) #define lua_pclose(L,file) ((void)L, (pclose(file) != -1)) #elif defined(LUA_WIN) #define lua_popen(L,c,m) ((void)L, _popen(c,m)) #define lua_pclose(L,file) ((void)L, (_pclose(file) != -1)) #else #define lua_popen(L,c,m) ((void)((void)c, m), \ luaL_error(L, LUA_QL("popen") " not supported"), (FILE*)0) #define lua_pclose(L,file) ((void)((void)L, file), 0) #endif /* @@ LUA_DL_* define which dynamic-library system Lua should use. ** CHANGE here if Lua has problems choosing the appropriate ** dynamic-library system for your platform (either Windows' DLL, Mac's ** dyld, or Unix's dlopen). If your system is some kind of Unix, there ** is a good chance that it has dlopen, so LUA_DL_DLOPEN will work for ** it. To use dlopen you also need to adapt the src/Makefile (probably ** adding -ldl to the linker options), so Lua does not select it ** automatically. (When you change the makefile to add -ldl, you must ** also add -DLUA_USE_DLOPEN.) ** If you do not want any kind of dynamic library, undefine all these ** options. ** By default, _WIN32 gets LUA_DL_DLL and MAC OS X gets LUA_DL_DYLD. */ #if defined(LUA_USE_DLOPEN) #define LUA_DL_DLOPEN #endif #if defined(LUA_WIN) #define LUA_DL_DLL #endif /* @@ LUAI_EXTRASPACE allows you to add user-specific data in a lua_State @* (the data goes just *before* the lua_State pointer). ** CHANGE (define) this if you really need that. This value must be ** a multiple of the maximum alignment required for your machine. */ #define LUAI_EXTRASPACE 0 /* @@ luai_userstate* allow user-specific actions on threads. ** CHANGE them if you defined LUAI_EXTRASPACE and need to do something ** extra when a thread is created/deleted/resumed/yielded. */ #define luai_userstateopen(L) ((void)L) #define luai_userstateclose(L) ((void)L) #define luai_userstatethread(L,L1) ((void)L) #define luai_userstatefree(L) ((void)L) #define luai_userstateresume(L,n) ((void)L) #define luai_userstateyield(L,n) ((void)L) /* @@ LUA_INTFRMLEN is the length modifier for integer conversions @* in 'string.format'. @@ LUA_INTFRM_T is the integer type correspoding to the previous length @* modifier. ** CHANGE them if your system supports long long or does not support long. */ #if defined(LUA_USELONGLONG) #define LUA_INTFRMLEN "ll" #define LUA_INTFRM_T long long #else #define LUA_INTFRMLEN "l" #define LUA_INTFRM_T long #endif /* =================================================================== */ /* ** Local configuration. You can use this space to add your redefinitions ** without modifying the main part of the file. */ #endif 0707010005d1fc000081a40000000000000000000000014c5cc643000000bf0000010000010036ffffffffffffffff0000001f00000000root/usr/local/include/lua.hpp// lua.hpp // Lua header files for C++ // <> not supplied automatically because Lua also compiles as C++ extern "C" { #include "lua.h" #include "lualib.h" #include "lauxlib.h" } 07070100000000000000000000000000000000000000010000000000000000000000000000000000000000000000000000000b00000000TRAILER!!!