# PaCkAgE DaTaStReAm m4 1 3479 # end of header 0707010002c85b000081a40000000000000000000000014c513104000001040000010000010036ffffffffffffffff0000000b00000000m4/pkginfoPKG=m4 NAME=m4 1.4.14 SPARC 64bit Solaris 10 VERSION=1.4.14 PSTAMP=29th July 2010 VENDOR=GNU EMAIL=http://www.gnu.org/software/m4/manual/m4.html DESC=GNU m4 macro processor ARCH=sparc CATEGORY=utility CLASSES=none BASEDIR=/ ISTATES=S s 1 2 3 RSTATES=S s 1 2 3 0707010002c85a000081a40000000000000000000000014c513104000011df0000010000010036ffffffffffffffff0000000a00000000m4/pkgmap: 1 3479 1 d none /usr ? ? ? 1 d none /usr/local ? ? ? 1 d none /usr/local/bin 0755 root root 1 f none /usr/local/bin/m4 0755 root root 1243120 33291 1280389377 1 d none /usr/local/lib 0755 root root 1 f none /usr/local/lib/charset.alias 0644 root root 654 46086 1280389376 1 d none /usr/local/lib/m4 0755 root root 1 d none /usr/local/lib/m4/examples 0755 root root 1 f none /usr/local/lib/m4/examples/capitalize.m4 0644 root root 385 29851 1280389379 1 f none /usr/local/lib/m4/examples/capitalize2.m4 0644 root root 752 59958 1280389379 1 f none /usr/local/lib/m4/examples/comments.m4 0644 root root 167 13918 1280389379 1 f none /usr/local/lib/m4/examples/curry.m4 0644 root root 192 15861 1280389379 1 f none /usr/local/lib/m4/examples/ddivert.m4 0644 root root 123 10976 1280389379 1 f none /usr/local/lib/m4/examples/debug.m4 0644 root root 136 11235 1280389379 1 f none /usr/local/lib/m4/examples/esyscmd.m4 0644 root root 205 17713 1280389379 1 f none /usr/local/lib/m4/examples/exp.m4 0644 root root 81 6234 1280389379 1 f none /usr/local/lib/m4/examples/file.m4 0644 root root 162 14160 1280389379 1 f none /usr/local/lib/m4/examples/foreach.m4 0644 root root 296 22663 1280389379 1 f none /usr/local/lib/m4/examples/foreach2.m4 0644 root root 360 27682 1280389379 1 f none /usr/local/lib/m4/examples/foreachq.m4 0644 root root 325 25252 1280389379 1 f none /usr/local/lib/m4/examples/foreachq2.m4 0644 root root 378 28961 1280389379 1 f none /usr/local/lib/m4/examples/foreachq3.m4 0644 root root 333 24683 1280389379 1 f none /usr/local/lib/m4/examples/foreachq4.m4 0644 root root 391 29071 1280389379 1 f none /usr/local/lib/m4/examples/forloop.m4 0644 root root 224 17135 1280389379 1 f none /usr/local/lib/m4/examples/forloop2.m4 0644 root root 473 35902 1280389379 1 f none /usr/local/lib/m4/examples/forloop3.m4 0644 root root 545 40577 1280389379 1 f none /usr/local/lib/m4/examples/fstab.m4 0644 root root 306 24005 1280389379 1 f none /usr/local/lib/m4/examples/hanoi.m4 0644 root root 363 26720 1280389379 1 f none /usr/local/lib/m4/examples/incl-test.m4 0644 root root 30 2569 1280389379 1 f none /usr/local/lib/m4/examples/incl.m4 0644 root root 40 3599 1280389379 1 f none /usr/local/lib/m4/examples/include.m4 0644 root root 105 9057 1280389379 1 f none /usr/local/lib/m4/examples/indir.m4 0644 root root 285 20807 1280389379 1 f none /usr/local/lib/m4/examples/join.m4 0644 root root 583 44181 1280389379 1 f none /usr/local/lib/m4/examples/loop.m4 0644 root root 930 14677 1280389379 1 f none /usr/local/lib/m4/examples/misc.m4 0644 root root 192 15415 1280389379 1 f none /usr/local/lib/m4/examples/multiquotes.m4 0644 root root 377 27952 1280389379 1 f none /usr/local/lib/m4/examples/patsubst.m4 0644 root root 305 23810 1280389379 1 f none /usr/local/lib/m4/examples/pushpop.m4 0644 root root 379 30996 1280389379 1 f none /usr/local/lib/m4/examples/quote.m4 0644 root root 402 31235 1280389379 1 f none /usr/local/lib/m4/examples/regexp.m4 0644 root root 375 28665 1280389379 1 f none /usr/local/lib/m4/examples/reverse.m4 0644 root root 165 12554 1280389379 1 f none /usr/local/lib/m4/examples/stack.m4 0644 root root 656 54863 1280389379 1 f none /usr/local/lib/m4/examples/stack_sep.m4 0644 root root 745 62089 1280389379 1 f none /usr/local/lib/m4/examples/sync-lines.m4 0644 root root 286 25049 1280389379 1 f none /usr/local/lib/m4/examples/sysv-args.m4 0644 root root 332 26342 1280389379 1 f none /usr/local/lib/m4/examples/trace.m4 0644 root root 513 38947 1280389379 1 f none /usr/local/lib/m4/examples/translit.m4 0644 root root 265 21112 1280389379 1 f none /usr/local/lib/m4/examples/undivert.m4 0644 root root 122 10735 1280389379 1 f none /usr/local/lib/m4/examples/wrap.m4 0644 root root 134 10438 1280389379 1 f none /usr/local/lib/m4/examples/wrapfifo.m4 0644 root root 388 30733 1280389379 1 f none /usr/local/lib/m4/examples/wraplifo.m4 0644 root root 381 31967 1280389379 1 f none /usr/local/lib/m4/examples/wraplifo2.m4 0644 root root 351 28229 1280389379 1 d none /usr/local/share 0755 root root 1 d none /usr/local/share/info 0755 root root 1 f none /usr/local/share/info/m4.info 0644 root root 3563 26975 1280389377 1 f none /usr/local/share/info/m4.info-1 0644 root root 300552 44536 1280389377 1 f none /usr/local/share/info/m4.info-2 0644 root root 53508 48826 1280389377 1 d none /usr/local/share/man 0755 root root 1 d none /usr/local/share/man/man1 0755 root root 1 f none /usr/local/share/man/man1/m4.1 0644 root root 3700 52222 1280389377 1 i checkinstall 785 2565 1280389380 1 i pkginfo 260 19505 1280389380 07070100000000000000000000000000000000000000010000000000000000000000000000000000000000000000000000000b00000000TRAILER!!!0707010002c85b000081a40000000000000000000000014c513104000001040000010000010036ffffffffffffffff0000000800000000pkginfoPKG=m4 NAME=m4 1.4.14 SPARC 64bit Solaris 10 VERSION=1.4.14 PSTAMP=29th July 2010 VENDOR=GNU EMAIL=http://www.gnu.org/software/m4/manual/m4.html DESC=GNU m4 macro processor ARCH=sparc CATEGORY=utility CLASSES=none BASEDIR=/ ISTATES=S s 1 2 3 RSTATES=S s 1 2 3 0707010002c85a000081a40000000000000000000000014c513104000011df0000010000010036ffffffffffffffff0000000700000000pkgmap: 1 3479 1 d none /usr ? ? ? 1 d none /usr/local ? ? ? 1 d none /usr/local/bin 0755 root root 1 f none /usr/local/bin/m4 0755 root root 1243120 33291 1280389377 1 d none /usr/local/lib 0755 root root 1 f none /usr/local/lib/charset.alias 0644 root root 654 46086 1280389376 1 d none /usr/local/lib/m4 0755 root root 1 d none /usr/local/lib/m4/examples 0755 root root 1 f none /usr/local/lib/m4/examples/capitalize.m4 0644 root root 385 29851 1280389379 1 f none /usr/local/lib/m4/examples/capitalize2.m4 0644 root root 752 59958 1280389379 1 f none /usr/local/lib/m4/examples/comments.m4 0644 root root 167 13918 1280389379 1 f none /usr/local/lib/m4/examples/curry.m4 0644 root root 192 15861 1280389379 1 f none /usr/local/lib/m4/examples/ddivert.m4 0644 root root 123 10976 1280389379 1 f none /usr/local/lib/m4/examples/debug.m4 0644 root root 136 11235 1280389379 1 f none /usr/local/lib/m4/examples/esyscmd.m4 0644 root root 205 17713 1280389379 1 f none /usr/local/lib/m4/examples/exp.m4 0644 root root 81 6234 1280389379 1 f none /usr/local/lib/m4/examples/file.m4 0644 root root 162 14160 1280389379 1 f none /usr/local/lib/m4/examples/foreach.m4 0644 root root 296 22663 1280389379 1 f none /usr/local/lib/m4/examples/foreach2.m4 0644 root root 360 27682 1280389379 1 f none /usr/local/lib/m4/examples/foreachq.m4 0644 root root 325 25252 1280389379 1 f none /usr/local/lib/m4/examples/foreachq2.m4 0644 root root 378 28961 1280389379 1 f none /usr/local/lib/m4/examples/foreachq3.m4 0644 root root 333 24683 1280389379 1 f none /usr/local/lib/m4/examples/foreachq4.m4 0644 root root 391 29071 1280389379 1 f none /usr/local/lib/m4/examples/forloop.m4 0644 root root 224 17135 1280389379 1 f none /usr/local/lib/m4/examples/forloop2.m4 0644 root root 473 35902 1280389379 1 f none /usr/local/lib/m4/examples/forloop3.m4 0644 root root 545 40577 1280389379 1 f none /usr/local/lib/m4/examples/fstab.m4 0644 root root 306 24005 1280389379 1 f none /usr/local/lib/m4/examples/hanoi.m4 0644 root root 363 26720 1280389379 1 f none /usr/local/lib/m4/examples/incl-test.m4 0644 root root 30 2569 1280389379 1 f none /usr/local/lib/m4/examples/incl.m4 0644 root root 40 3599 1280389379 1 f none /usr/local/lib/m4/examples/include.m4 0644 root root 105 9057 1280389379 1 f none /usr/local/lib/m4/examples/indir.m4 0644 root root 285 20807 1280389379 1 f none /usr/local/lib/m4/examples/join.m4 0644 root root 583 44181 1280389379 1 f none /usr/local/lib/m4/examples/loop.m4 0644 root root 930 14677 1280389379 1 f none /usr/local/lib/m4/examples/misc.m4 0644 root root 192 15415 1280389379 1 f none /usr/local/lib/m4/examples/multiquotes.m4 0644 root root 377 27952 1280389379 1 f none /usr/local/lib/m4/examples/patsubst.m4 0644 root root 305 23810 1280389379 1 f none /usr/local/lib/m4/examples/pushpop.m4 0644 root root 379 30996 1280389379 1 f none /usr/local/lib/m4/examples/quote.m4 0644 root root 402 31235 1280389379 1 f none /usr/local/lib/m4/examples/regexp.m4 0644 root root 375 28665 1280389379 1 f none /usr/local/lib/m4/examples/reverse.m4 0644 root root 165 12554 1280389379 1 f none /usr/local/lib/m4/examples/stack.m4 0644 root root 656 54863 1280389379 1 f none /usr/local/lib/m4/examples/stack_sep.m4 0644 root root 745 62089 1280389379 1 f none /usr/local/lib/m4/examples/sync-lines.m4 0644 root root 286 25049 1280389379 1 f none /usr/local/lib/m4/examples/sysv-args.m4 0644 root root 332 26342 1280389379 1 f none /usr/local/lib/m4/examples/trace.m4 0644 root root 513 38947 1280389379 1 f none /usr/local/lib/m4/examples/translit.m4 0644 root root 265 21112 1280389379 1 f none /usr/local/lib/m4/examples/undivert.m4 0644 root root 122 10735 1280389379 1 f none /usr/local/lib/m4/examples/wrap.m4 0644 root root 134 10438 1280389379 1 f none /usr/local/lib/m4/examples/wrapfifo.m4 0644 root root 388 30733 1280389379 1 f none /usr/local/lib/m4/examples/wraplifo.m4 0644 root root 381 31967 1280389379 1 f none /usr/local/lib/m4/examples/wraplifo2.m4 0644 root root 351 28229 1280389379 1 d none /usr/local/share 0755 root root 1 d none /usr/local/share/info 0755 root root 1 f none /usr/local/share/info/m4.info 0644 root root 3563 26975 1280389377 1 f none /usr/local/share/info/m4.info-1 0644 root root 300552 44536 1280389377 1 f none /usr/local/share/info/m4.info-2 0644 root root 53508 48826 1280389377 1 d none /usr/local/share/man 0755 root root 1 d none /usr/local/share/man/man1 0755 root root 1 f none /usr/local/share/man/man1/m4.1 0644 root root 3700 52222 1280389377 1 i checkinstall 785 2565 1280389380 1 i pkginfo 260 19505 1280389380 0707010002c899000041ed0000000000000000000000024c513104000000000000010000010036ffffffffffffffff0000000800000000install0707010002c89a000081ed0000000000000000000000014c513104000003110000010000010036ffffffffffffffff0000001500000000install/checkinstall#!/bin/sh # expected_bits="64" expected_release="5.10" expected_platform="sparc" # release=`uname -r` platform=`uname -p` bits=`isainfo -b` # if [ ${platform} != ${expected_platform} ]; then echo "\n\n\n\tThis package must be installed on a ${expected_platform} architecture\n" echo "\tAborting installation.\n\n\n" exit 1 fi if [ ${release} != ${expected_release} ]; then echo "\n\n\n\tThis package must be installed on a ${expected_release} machine\n" echo "\tAborting installation.\n\n\n" exit 1 fi if [ ${bits} != ${expected_bits} ]; then echo "\n\n\n\tThis package must be installed on a ${expected_bits} bit machine\n" echo "\tYour machine is running a ${bits} bit O.S. currently\n" echo "\tAborting installation.\n\n\n" exit 1 fi exit 0 0707010002c85c000041ed0000000000000000000000034c513104000000000000010000010036ffffffffffffffff0000000500000000root0707010002c85d000041ed0000000000000000000000034c513104000000000000010000010036ffffffffffffffff0000000900000000root/usr0707010002c85e000041ed0000000000000000000000054c513104000000000000010000010036ffffffffffffffff0000000f00000000root/usr/local0707010002c891000041ed0000000000000000000000044c513104000000000000010000010036ffffffffffffffff0000001500000000root/usr/local/share0707010002c896000041ed0000000000000000000000034c513104000000000000010000010036ffffffffffffffff0000001900000000root/usr/local/share/man0707010002c897000041ed0000000000000000000000024c513104000000000000010000010036ffffffffffffffff0000001e00000000root/usr/local/share/man/man10707010002c898000081a40000000000000000000000014c51310100000e740000010000010036ffffffffffffffff0000002300000000root/usr/local/share/man/man1/m4.1.\" DO NOT MODIFY THIS FILE! It was generated by help2man 1.36. .TH M4 "1" "February 2010" "GNU M4 1.4.14" "User Commands" .SH NAME m4 \- macro processor .SH SYNOPSIS .B m4 [\fIOPTION\fR]... [\fIFILE\fR]... .SH DESCRIPTION Process macros in FILEs. If no FILE or if FILE is `\-', standard input is read. .PP Mandatory or optional arguments to long options are mandatory or optional for short options too. .SS "Operation modes:" .TP \fB\-\-help\fR display this help and exit .TP \fB\-\-version\fR output version information and exit .TP \fB\-E\fR, \fB\-\-fatal\-warnings\fR once: warnings become errors, twice: stop execution at first error .TP \fB\-i\fR, \fB\-\-interactive\fR unbuffer output, ignore interrupts .TP \fB\-P\fR, \fB\-\-prefix\-builtins\fR force a `m4_' prefix to all builtins .TP \fB\-Q\fR, \fB\-\-quiet\fR, \fB\-\-silent\fR suppress some warnings for builtins .TP \fB\-\-warn\-macro\-sequence\fR[=\fIREGEXP\fR] warn if macro definition matches REGEXP, .IP default \e$\e({[^}]*}\e|[0\-9][0\-9]+\e) .SS "Preprocessor features:" .TP \fB\-D\fR, \fB\-\-define=NAME\fR[=\fIVALUE\fR] define NAME as having VALUE, or empty .TP \fB\-I\fR, \fB\-\-include\fR=\fIDIRECTORY\fR append DIRECTORY to include path .TP \fB\-s\fR, \fB\-\-synclines\fR generate `#line NUM "FILE"' lines .TP \fB\-U\fR, \fB\-\-undefine\fR=\fINAME\fR undefine NAME .SS "Limits control:" .TP \fB\-g\fR, \fB\-\-gnu\fR override \fB\-G\fR to re\-enable GNU extensions .TP \fB\-G\fR, \fB\-\-traditional\fR suppress all GNU extensions .TP \fB\-H\fR, \fB\-\-hashsize\fR=\fIPRIME\fR set symbol lookup hash table size [509] .TP \fB\-L\fR, \fB\-\-nesting\-limit\fR=\fINUMBER\fR change nesting limit, 0 for unlimited [0] .SS "Frozen state files:" .TP \fB\-F\fR, \fB\-\-freeze\-state\fR=\fIFILE\fR produce a frozen state on FILE at end .TP \fB\-R\fR, \fB\-\-reload\-state\fR=\fIFILE\fR reload a frozen state from FILE at start .SS "Debugging:" .TP \fB\-d\fR, \fB\-\-debug\fR[=\fIFLAGS\fR] set debug level (no FLAGS implies `aeq') .TP \fB\-\-debugfile\fR[=\fIFILE\fR] redirect debug and trace output to FILE (default stderr, discard if empty string) .TP \fB\-l\fR, \fB\-\-arglength\fR=\fINUM\fR restrict macro tracing size .TP \fB\-t\fR, \fB\-\-trace\fR=\fINAME\fR trace NAME when it is defined .SS "FLAGS is any of:" .TP a show actual arguments .TP c show before collect, after collect and after call .TP e show expansion .TP f say current input file name .TP i show changes in input files .TP l say current input line number .TP p show results of path searches .TP q quote values as necessary, with a or e flag .TP t trace for all macro calls, not only traceon'ed .TP x add a unique macro call id, useful with c flag .TP V shorthand for all of the above flags .PP If defined, the environment variable `M4PATH' is a colon\-separated list of directories included after any specified by `\-I'. .PP Exit status is 0 for success, 1 for failure, 63 for frozen file version mismatch, or whatever value was passed to the m4exit macro. .SH AUTHOR Written by Rene' Seindal. .SH "REPORTING BUGS" Report bugs to: bug\-m4@gnu.org GNU M4 home page: General help using GNU software: .SH COPYRIGHT Copyright \(co 2010 Free Software Foundation, Inc. License GPLv3+: GNU GPL version 3 or later . .br This is free software: you are free to change and redistribute it. There is NO WARRANTY, to the extent permitted by law. .SH "SEE ALSO" The full documentation for .B m4 is maintained as a Texinfo manual. If the .B info and .B m4 programs are properly installed at your site, the command .IP .B info m4 .PP should give you access to the complete manual. 0707010002c892000041ed0000000000000000000000024c513104000000000000010000010036ffffffffffffffff0000001a00000000root/usr/local/share/info0707010002c893000081a40000000000000000000000014c51310100000deb0000010000010036ffffffffffffffff0000002200000000root/usr/local/share/info/m4.infoThis is m4.info, produced by makeinfo version 4.13 from m4.texinfo. This manual (24 February 2010) is for GNU M4 (version 1.4.14), a package containing an implementation of the m4 macro language. Copyright (C) 1989, 1990, 1991, 1992, 1993, 1994, 2004, 2005, 2006, 2007, 2008, 2009, 2010 Free Software Foundation, Inc. Permission is granted to copy, distribute and/or modify this document under the terms of the GNU Free Documentation License, Version 1.3 or any later version published by the Free Software Foundation; with no Invariant Sections, no Front-Cover Texts, and no Back-Cover Texts. A copy of the license is included in the section entitled "GNU Free Documentation License." INFO-DIR-SECTION Text creation and manipulation START-INFO-DIR-ENTRY * M4: (m4). A powerful macro processor. END-INFO-DIR-ENTRY  Indirect: m4.info-1: 873 m4.info-2: 300552  Tag Table: (Indirect) Node: Top873 Node: Preliminaries9737 Node: Intro10423 Node: History12055 Node: Bugs14874 Node: Manual16125 Node: Invoking m419523 Node: Operation modes21669 Node: Preprocessor features24641 Node: Limits control27738 Node: Frozen state31640 Node: Debugging options32439 Node: Command line files34423 Node: Syntax35996 Node: Names37115 Node: Quoted strings37577 Node: Comments38226 Node: Other tokens39103 Node: Input processing39681 Ref: Input processing-Footnote-147602 Node: Macros47797 Node: Invocation48291 Node: Inhibiting Invocation49092 Node: Macro Arguments53223 Node: Quoting Arguments56285 Node: Macro expansion58408 Node: Definitions59109 Node: Define59894 Node: Arguments62332 Node: Pseudo Arguments66004 Node: Undefine69546 Node: Defn70676 Node: Pushdef75126 Node: Indir77752 Node: Builtin79880 Node: Conditionals82106 Node: Ifdef83048 Node: Ifelse83911 Node: Shift87229 Node: Forloop97778 Node: Foreach100414 Node: Stacks105902 Node: Composition108941 Node: Debugging114881 Node: Dumpdef115466 Node: Trace116876 Node: Debug Levels120449 Node: Debug Output125153 Node: Input Control126437 Node: Dnl126974 Node: Changequote128875 Node: Changecom134972 Node: Changeword138668 Node: M4wrap144109 Node: File Inclusion148105 Node: Include148422 Node: Search Path151133 Node: Diversions152050 Node: Divert153733 Node: Undivert156259 Node: Divnum159582 Node: Cleardivert160046 Node: Text handling161251 Node: Len161974 Node: Index macro162359 Node: Regexp163232 Node: Substr165773 Node: Translit166824 Node: Patsubst169546 Node: Format174072 Node: Arithmetic177265 Node: Incr177714 Node: Eval178489 Node: Shell commands186452 Node: Platform macros187374 Node: Syscmd189489 Node: Esyscmd191769 Node: Sysval193278 Node: Mkstemp194960 Node: Miscellaneous198915 Node: Errprint199348 Node: Location200567 Node: M4exit203341 Node: Frozen files205428 Node: Using frozen files206209 Node: Frozen file format209473 Node: Compatibility212537 Node: Extensions213603 Node: Incompatibilities217470 Node: Other Incompatibilities226396 Node: Answers229042 Node: Improved exch229824 Node: Improved forloop230362 Node: Improved foreach235694 Node: Improved copy248711 Node: Improved m4wrap252665 Node: Improved cleardivert255089 Node: Improved capitalize256070 Node: Improved fatal_error260933 Node: Copying This Package261994 Node: GNU General Public License262473 Node: Copying This Manual300032 Node: GNU Free Documentation License300552 Node: Indices325683 Node: Macro index325963 Node: Concept index332200  End Tag Table 0707010002c894000081a40000000000000000000000014c513101000496080000010000010036ffffffffffffffff0000002400000000root/usr/local/share/info/m4.info-1This is m4.info, produced by makeinfo version 4.13 from m4.texinfo. This manual (24 February 2010) is for GNU M4 (version 1.4.14), a package containing an implementation of the m4 macro language. Copyright (C) 1989, 1990, 1991, 1992, 1993, 1994, 2004, 2005, 2006, 2007, 2008, 2009, 2010 Free Software Foundation, Inc. Permission is granted to copy, distribute and/or modify this document under the terms of the GNU Free Documentation License, Version 1.3 or any later version published by the Free Software Foundation; with no Invariant Sections, no Front-Cover Texts, and no Back-Cover Texts. A copy of the license is included in the section entitled "GNU Free Documentation License." INFO-DIR-SECTION Text creation and manipulation START-INFO-DIR-ENTRY * M4: (m4). A powerful macro processor. END-INFO-DIR-ENTRY  File: m4.info, Node: Top, Next: Preliminaries, Up: (dir) GNU M4 ****** This manual (24 February 2010) is for GNU M4 (version 1.4.14), a package containing an implementation of the m4 macro language. Copyright (C) 1989, 1990, 1991, 1992, 1993, 1994, 2004, 2005, 2006, 2007, 2008, 2009, 2010 Free Software Foundation, Inc. Permission is granted to copy, distribute and/or modify this document under the terms of the GNU Free Documentation License, Version 1.3 or any later version published by the Free Software Foundation; with no Invariant Sections, no Front-Cover Texts, and no Back-Cover Texts. A copy of the license is included in the section entitled "GNU Free Documentation License." GNU `m4' is an implementation of the traditional UNIX macro processor. It is mostly SVR4 compatible, although it has some extensions (for example, handling more than 9 positional parameters to macros). `m4' also has builtin functions for including files, running shell commands, doing arithmetic, etc. Autoconf needs GNU `m4' for generating `configure' scripts, but not for running them. GNU `m4' was originally written by Rene' Seindal, with subsequent changes by Franc,ois Pinard and other volunteers on the Internet. All names and email addresses can be found in the files `m4-1.4.14/AUTHORS' and `m4-1.4.14/THANKS' from the GNU M4 distribution. This is release 1.4.14. It is now considered stable: future releases in the 1.4.x series are only meant to fix bugs, increase speed, or improve documentation. However... An experimental feature, which would improve `m4' usefulness, allows for changing the syntax for what is a "word" in `m4'. You should use: ./configure --enable-changeword if you want this feature compiled in. The current implementation slows down `m4' considerably and is hardly acceptable. In the future, `m4' 2.0 will come with a different set of new features that provide similar capabilities, but without the inefficiencies, so changeword will go away and _you should not count on it_. * Menu: * Preliminaries:: Introduction and preliminaries * Invoking m4:: Invoking `m4' * Syntax:: Lexical and syntactic conventions * Macros:: How to invoke macros * Definitions:: How to define new macros * Conditionals:: Conditionals, loops, and recursion * Debugging:: How to debug macros and input * Input Control:: Input control * File Inclusion:: File inclusion * Diversions:: Diverting and undiverting output * Text handling:: Macros for text handling * Arithmetic:: Macros for doing arithmetic * Shell commands:: Macros for running shell commands * Miscellaneous:: Miscellaneous builtin macros * Frozen files:: Fast loading of frozen state * Compatibility:: Compatibility with other versions of `m4' * Answers:: Correct version of some examples * Copying This Package:: How to make copies of the overall M4 package * Copying This Manual:: How to make copies of this manual * Indices:: Indices of concepts and macros --- The Detailed Node Listing --- Introduction and preliminaries * Intro:: Introduction to `m4' * History:: Historical references * Bugs:: Problems and bugs * Manual:: Using this manual Invoking `m4' * Operation modes:: Command line options for operation modes * Preprocessor features:: Command line options for preprocessor features * Limits control:: Command line options for limits control * Frozen state:: Command line options for frozen state * Debugging options:: Command line options for debugging * Command line files:: Specifying input files on the command line Lexical and syntactic conventions * Names:: Macro names * Quoted strings:: Quoting input to `m4' * Comments:: Comments in `m4' input * Other tokens:: Other kinds of input tokens * Input processing:: How `m4' copies input to output How to invoke macros * Invocation:: Macro invocation * Inhibiting Invocation:: Preventing macro invocation * Macro Arguments:: Macro arguments * Quoting Arguments:: On Quoting Arguments to macros * Macro expansion:: Expanding macros How to define new macros * Define:: Defining a new macro * Arguments:: Arguments to macros * Pseudo Arguments:: Special arguments to macros * Undefine:: Deleting a macro * Defn:: Renaming macros * Pushdef:: Temporarily redefining macros * Indir:: Indirect call of macros * Builtin:: Indirect call of builtins Conditionals, loops, and recursion * Ifdef:: Testing if a macro is defined * Ifelse:: If-else construct, or multibranch * Shift:: Recursion in `m4' * Forloop:: Iteration by counting * Foreach:: Iteration by list contents * Stacks:: Working with definition stacks * Composition:: Building macros with macros How to debug macros and input * Dumpdef:: Displaying macro definitions * Trace:: Tracing macro calls * Debug Levels:: Controlling debugging output * Debug Output:: Saving debugging output Input control * Dnl:: Deleting whitespace in input * Changequote:: Changing the quote characters * Changecom:: Changing the comment delimiters * Changeword:: Changing the lexical structure of words * M4wrap:: Saving text until end of input File inclusion * Include:: Including named files * Search Path:: Searching for include files Diverting and undiverting output * Divert:: Diverting output * Undivert:: Undiverting output * Divnum:: Diversion numbers * Cleardivert:: Discarding diverted text Macros for text handling * Len:: Calculating length of strings * Index macro:: Searching for substrings * Regexp:: Searching for regular expressions * Substr:: Extracting substrings * Translit:: Translating characters * Patsubst:: Substituting text by regular expression * Format:: Formatting strings (printf-like) Macros for doing arithmetic * Incr:: Decrement and increment operators * Eval:: Evaluating integer expressions Macros for running shell commands * Platform macros:: Determining the platform * Syscmd:: Executing simple commands * Esyscmd:: Reading the output of commands * Sysval:: Exit status * Mkstemp:: Making temporary files Miscellaneous builtin macros * Errprint:: Printing error messages * Location:: Printing current location * M4exit:: Exiting from `m4' Fast loading of frozen state * Using frozen files:: Using frozen files * Frozen file format:: Frozen file format Compatibility with other versions of `m4' * Extensions:: Extensions in GNU M4 * Incompatibilities:: Facilities in System V m4 not in GNU M4 * Other Incompatibilities:: Other incompatibilities Correct version of some examples * Improved exch:: Solution for `exch' * Improved forloop:: Solution for `forloop' * Improved foreach:: Solution for `foreach' * Improved copy:: Solution for `copy' * Improved m4wrap:: Solution for `m4wrap' * Improved cleardivert:: Solution for `cleardivert' * Improved capitalize:: Solution for `capitalize' * Improved fatal_error:: Solution for `fatal_error' How to make copies of the overall M4 package * GNU General Public License:: License for copying the M4 package How to make copies of this manual * GNU Free Documentation License:: License for copying this manual Indices of concepts and macros * Macro index:: Index for all `m4' macros * Concept index:: Index for many concepts  File: m4.info, Node: Preliminaries, Next: Invoking m4, Prev: Top, Up: Top 1 Introduction and preliminaries ******************************** This first chapter explains what GNU `m4' is, where `m4' comes from, how to read and use this documentation, how to call the `m4' program, and how to report bugs about it. It concludes by giving tips for reading the remainder of the manual. The following chapters then detail all the features of the `m4' language. * Menu: * Intro:: Introduction to `m4' * History:: Historical references * Bugs:: Problems and bugs * Manual:: Using this manual  File: m4.info, Node: Intro, Next: History, Up: Preliminaries 1.1 Introduction to `m4' ======================== `m4' is a macro processor, in the sense that it copies its input to the output, expanding macros as it goes. Macros are either builtin or user-defined, and can take any number of arguments. Besides just doing macro expansion, `m4' has builtin functions for including named files, running shell commands, doing integer arithmetic, manipulating text in various ways, performing recursion, etc.... `m4' can be used either as a front-end to a compiler, or as a macro processor in its own right. The `m4' macro processor is widely available on all UNIXes, and has been standardized by POSIX. Usually, only a small percentage of users are aware of its existence. However, those who find it often become committed users. The popularity of GNU Autoconf, which requires GNU `m4' for _generating_ `configure' scripts, is an incentive for many to install it, while these people will not themselves program in `m4'. GNU `m4' is mostly compatible with the System V, Release 3 version, except for some minor differences. *Note Compatibility::, for more details. Some people find `m4' to be fairly addictive. They first use `m4' for simple problems, then take bigger and bigger challenges, learning how to write complex sets of `m4' macros along the way. Once really addicted, users pursue writing of sophisticated `m4' applications even to solve simple problems, devoting more time debugging their `m4' scripts than doing real work. Beware that `m4' may be dangerous for the health of compulsive programmers.  File: m4.info, Node: History, Next: Bugs, Prev: Intro, Up: Preliminaries 1.2 Historical references ========================= `GPM' was an important ancestor of `m4'. See C. Strachey: "A General Purpose Macro generator", Computer Journal 8,3 (1965), pp. 225 ff. `GPM' is also succinctly described into David Gries classic "Compiler Construction for Digital Computers". The classic B. Kernighan and P.J. Plauger: "Software Tools", Addison-Wesley, Inc. (1976) describes and implements a Unix macro-processor language, which inspired Dennis Ritchie to write `m3', a macro processor for the AP-3 minicomputer. Kernighan and Ritchie then joined forces to develop the original `m4', as described in "The M4 Macro Processor", Bell Laboratories (1977). It had only 21 builtin macros. While `GPM' was more _pure_, `m4' is meant to deal with the true intricacies of real life: macros can be recognized without being pre-announced, skipping whitespace or end-of-lines is easier, more constructs are builtin instead of derived, etc. Originally, the Kernighan and Plauger macro-processor, and then `m3', formed the engine for the Rational FORTRAN preprocessor, that is, the `Ratfor' equivalent of `cpp'. Later, `m4' was used as a front-end for `Ratfor', `C' and `Cobol'. Rene' Seindal released his implementation of `m4', GNU `m4', in 1990, with the aim of removing the artificial limitations in many of the traditional `m4' implementations, such as maximum line length, macro size, or number of macros. The late Professor A. Dain Samples described and implemented a further evolution in the form of `M5': "User's Guide to the M5 Macro Language: 2nd edition", Electronic Announcement on comp.compilers newsgroup (1992). Franc,ois Pinard took over maintenance of GNU `m4' in 1992, until 1994 when he released GNU `m4' 1.4, which was the stable release for 10 years. It was at this time that GNU Autoconf decided to require GNU `m4' as its underlying engine, since all other implementations of `m4' had too many limitations. More recently, in 2004, Paul Eggert released 1.4.1 and 1.4.2 which addressed some long standing bugs in the venerable 1.4 release. Then in 2005, Gary V. Vaughan collected together the many patches to GNU `m4' 1.4 that were floating around the net and released 1.4.3 and 1.4.4. And in 2006, Eric Blake joined the team and prepared patches for the release of 1.4.5, 1.4.6, 1.4.7, and 1.4.8. More bug fixes were incorporated in 2007, with releases 1.4.9 and 1.4.10. Eric continued with some portability fixes for 1.4.11 and 1.4.12 in 2008, 1.4.13 in 2009, and 1.4.14 in 2010. Meanwhile, development has continued on new features for `m4', such as dynamic module loading and additional builtins. When complete, GNU `m4' 2.0 will start a new series of releases.  File: m4.info, Node: Bugs, Next: Manual, Prev: History, Up: Preliminaries 1.3 Problems and bugs ===================== If you have problems with GNU M4 or think you've found a bug, please report it. Before reporting a bug, make sure you've actually found a real bug. Carefully reread the documentation and see if it really says you can do what you're trying to do. If it's not clear whether you should be able to do something or not, report that too; it's a bug in the documentation! Before reporting a bug or trying to fix it yourself, try to isolate it to the smallest possible input file that reproduces the problem. Then send us the input file and the exact results `m4' gave you. Also say what you expected to occur; this will help us decide whether the problem was really in the documentation. Once you've got a precise problem, send e-mail to . Please include the version number of `m4' you are using. You can get this information with the command `m4 --version'. Also provide details about the platform you are executing on. Non-bug suggestions are always welcome as well. If you have questions about things that are unclear in the documentation or are just obscure features, please report them too.  File: m4.info, Node: Manual, Prev: Bugs, Up: Preliminaries 1.4 Using this manual ===================== This manual contains a number of examples of `m4' input and output, and a simple notation is used to distinguish input, output and error messages from `m4'. Examples are set out from the normal text, and shown in a fixed width font, like this This is an example of an example! To distinguish input from output, all output from `m4' is prefixed by the string `=>', and all error messages by the string `error-->'. When showing how command line options affect matters, the command line is shown with a prompt `$ like this', otherwise, you can assume that a simple `m4' invocation will work. Thus: $ command line to invoke m4 Example of input line =>Output line from m4 error-->and an error message The sequence `^D' in an example indicates the end of the input file. The sequence `' refers to the newline character. The majority of these examples are self-contained, and you can run them with similar results by invoking `m4 -d'. In fact, the testsuite that is bundled in the GNU M4 package consists of the examples in this document! Some of the examples assume that your current directory is located where you unpacked the installation, so if you plan on following along, you may find it helpful to do this now: $ cd m4-1.4.14 As each of the predefined macros in `m4' is described, a prototype call of the macro will be shown, giving descriptive names to the arguments, e.g., -- Composite: example (STRING, [COUNT = `1'], [ARGUMENT]...) This is a sample prototype. There is not really a macro named `example', but this documents that if there were, it would be a Composite macro, rather than a Builtin. It requires at least one argument, STRING. Remember that in `m4', there must not be a space between the macro name and the opening parenthesis, unless it was intended to call the macro without any arguments. The brackets around COUNT and ARGUMENT show that these arguments are optional. If COUNT is omitted, the macro behaves as if count were `1', whereas if ARGUMENT is omitted, the macro behaves as if it were the empty string. A blank argument is not the same as an omitted argument. For example, `example(`a')', `example(`a',`1')', and `example(`a',`1',)' would behave identically with COUNT set to `1'; while `example(`a',)' and `example(`a',`')' would explicitly pass the empty string for COUNT. The ellipses (`...') show that the macro processes additional arguments after ARGUMENT, rather than ignoring them. All macro arguments in `m4' are strings, but some are given special interpretation, e.g., as numbers, file names, regular expressions, etc. The documentation for each macro will state how the parameters are interpreted, and what happens if the argument cannot be parsed according to the desired interpretation. Unless specified otherwise, a parameter specified to be a number is parsed as a decimal, even if the argument has leading zeros; and parsing the empty string as a number results in 0 rather than an error, although a warning will be issued. This document consistently writes and uses "builtin", without a hyphen, as if it were an English word. This is how the `builtin' primitive is spelled within `m4'.  File: m4.info, Node: Invoking m4, Next: Syntax, Prev: Preliminaries, Up: Top 2 Invoking `m4' *************** The format of the `m4' command is: `m4' [OPTION...] [FILE...] All options begin with `-', or if long option names are used, with `--'. A long option name need not be written completely, any unambiguous prefix is sufficient. POSIX requires `m4' to recognize arguments intermixed with files, even when `POSIXLY_CORRECT' is set in the environment. Most options take effect at startup regardless of their position, but some are documented below as taking effect after any files that occurred earlier in the command line. The argument `--' is a marker to denote the end of options. With short options, options that do not take arguments may be combined into a single command line argument with subsequent options, options with mandatory arguments may be provided either as a single command line argument or as two arguments, and options with optional arguments must be provided as a single argument. In other words, `m4 -QPDfoo -d a -df' is equivalent to `m4 -Q -P -D foo -d -df -- ./a', although the latter form is considered canonical. With long options, options with mandatory arguments may be provided with an equal sign (`=') in a single argument, or as two arguments, and options with optional arguments must be provided as a single argument. In other words, `m4 --def foo --debug a' is equivalent to `m4 --define=foo --debug= -- ./a', although the latter form is considered canonical (not to mention more robust, in case a future version of `m4' introduces an option named `--default'). `m4' understands the following options, grouped by functionality. * Menu: * Operation modes:: Command line options for operation modes * Preprocessor features:: Command line options for preprocessor features * Limits control:: Command line options for limits control * Frozen state:: Command line options for frozen state * Debugging options:: Command line options for debugging * Command line files:: Specifying input files on the command line  File: m4.info, Node: Operation modes, Next: Preprocessor features, Up: Invoking m4 2.1 Command line options for operation modes ============================================ Several options control the overall operation of `m4': `--help' Print a help summary on standard output, then immediately exit `m4' without reading any input files or performing any other actions. `--version' Print the version number of the program on standard output, then immediately exit `m4' without reading any input files or performing any other actions. `-E' `--fatal-warnings' Controls the effect of warnings. If unspecified, then execution continues and exit status is unaffected when a warning is printed. If specified exactly once, warnings become fatal; when one is issued, execution continues, but the exit status will be non-zero. If specified multiple times, then execution halts with non-zero status the first time a warning is issued. The introduction of behavior levels is new to M4 1.4.9; for behavior consistent with earlier versions, you should specify `-E' twice. `-i' `--interactive' `-e' Makes this invocation of `m4' interactive. This means that all output will be unbuffered, and interrupts will be ignored. The spelling `-e' exists for compatibility with other `m4' implementations, and issues a warning because it may be withdrawn in a future version of GNU M4. `-P' `--prefix-builtins' Internally modify _all_ builtin macro names so they all start with the prefix `m4_'. For example, using this option, one should write `m4_define' instead of `define', and `m4___file__' instead of `__file__'. This option has no effect if `-R' is also specified. `-Q' `--quiet' `--silent' Suppress warnings, such as missing or superfluous arguments in macro calls, or treating the empty string as zero. `--warn-macro-sequence[=REGEXP]' Issue a warning if the regular expression REGEXP has a non-empty match in any macro definition (either by `define' or `pushdef'). Empty matches are ignored; therefore, supplying the empty string as REGEXP disables any warning. If the optional REGEXP is not supplied, then the default regular expression is `\$\({[^}]*}\|[0-9][0-9]+\)' (a literal `$' followed by multiple digits or by an open brace), since these sequences will change semantics in the default operation of GNU M4 2.0 (due to a change in how more than 9 arguments in a macro definition will be handled, *note Arguments::). Providing an alternate regular expression can provide a useful reverse lookup feature of finding where a macro is defined to have a given definition. `-W REGEXP' `--word-regexp=REGEXP' Use REGEXP as an alternative syntax for macro names. This experimental option will not be present in all GNU `m4' implementations (*note Changeword::).  File: m4.info, Node: Preprocessor features, Next: Limits control, Prev: Operation modes, Up: Invoking m4 2.2 Command line options for preprocessor features ================================================== Several options allow `m4' to behave more like a preprocessor. Macro definitions and deletions can be made on the command line, the search path can be altered, and the output file can track where the input came from. These features occur with the following options: `-D NAME[=VALUE]' `--define=NAME[=VALUE]' This enters NAME into the symbol table. If `=VALUE' is missing, the value is taken to be the empty string. The VALUE can be any string, and the macro can be defined to take arguments, just as if it was defined from within the input. This option may be given more than once; order with respect to file names is significant, and redefining the same NAME loses the previous value. `-I DIRECTORY' `--include=DIRECTORY' Make `m4' search DIRECTORY for included files that are not found in the current working directory. *Note Search Path::, for more details. This option may be given more than once. `-s' `--synclines' Generate synchronization lines, for use by the C preprocessor or other similar tools. Order is significant with respect to file names. This option is useful, for example, when `m4' is used as a front end to a compiler. Source file name and line number information is conveyed by directives of the form `#line LINENUM "FILE"', which are inserted as needed into the middle of the output. Such directives mean that the following line originated or was expanded from the contents of input file FILE at line LINENUM. The `"FILE"' part is often omitted when the file name did not change from the previous directive. Synchronization directives are always given on complete lines by themselves. When a synchronization discrepancy occurs in the middle of an output line, the associated synchronization directive is delayed until the next newline that does not occur in the middle of a quoted string or comment. define(`twoline', `1 2') =>#line 2 "stdin" => changecom(`/*', `*/') => define(`comment', `/*1 2*/') =>#line 5 => dnl no line hello =>#line 7 =>hello twoline =>1 =>#line 8 =>2 comment =>/*1 =>2*/ one comment `two three' =>#line 10 =>one /*1 =>2*/ two =>three goodbye =>#line 12 =>goodbye `-U NAME' `--undefine=NAME' This deletes any predefined meaning NAME might have. Obviously, only predefined macros can be deleted in this way. This option may be given more than once; undefining a NAME that does not have a definition is silently ignored. Order is significant with respect to file names.  File: m4.info, Node: Limits control, Next: Frozen state, Prev: Preprocessor features, Up: Invoking m4 2.3 Command line options for limits control =========================================== There are some limits within `m4' that can be tuned. For compatibility, `m4' also accepts some options that control limits in other implementations, but which are automatically unbounded (limited only by your hardware and operating system constraints) in GNU `m4'. `-g' `--gnu' Enable all the extensions in this implementation. In this release of M4, this option is always on by default; it is currently only useful when overriding a prior use of `--traditional'. However, having GNU behavior as default makes it impossible to write a strictly POSIX-compliant client that avoids all incompatible GNU M4 extensions, since such a client would have to use the non-POSIX command-line option to force full POSIX behavior. Thus, a future version of M4 will be changed to implicitly use the option `--traditional' if the environment variable `POSIXLY_CORRECT' is set. Projects that intentionally use GNU extensions should consider using `--gnu' to state their intentions, so that the project will not mysteriously break if the user upgrades to a newer M4 and has `POSIXLY_CORRECT' set in their environment. `-G' `--traditional' Suppress all the extensions made in this implementation, compared to the System V version. *Note Compatibility::, for a list of these. `-H NUM' `--hashsize=NUM' Make the internal hash table for symbol lookup be NUM entries big. For better performance, the number should be prime, but this is not checked. The default is 509 entries. It should not be necessary to increase this value, unless you define an excessive number of macros. `-L NUM' `--nesting-limit=NUM' Artificially limit the nesting of macro calls to NUM levels, stopping program execution if this limit is ever exceeded. When not specified, nesting defaults to unlimited on platforms that can detect stack overflow, and to 1024 levels otherwise. A value of zero means unlimited; but then heavily nested code could potentially cause a stack overflow. The precise effect of this option is more correctly associated with textual nesting than dynamic recursion. It has been useful when some complex `m4' input was generated by mechanical means, and also in diagnosing recursive algorithms that do not scale well. Most users never need to change this option from its default. This option does _not_ have the ability to break endless rescanning loops, since these do not necessarily consume much memory or stack space. Through clever usage of rescanning loops, one can request complex, time-consuming computations from `m4' with useful results. Putting limitations in this area would break `m4' power. There are many pathological cases: `define(`a', `a')a' is only the simplest example (but *note Compatibility::). Expecting GNU `m4' to detect these would be a little like expecting a compiler system to detect and diagnose endless loops: it is a quite _hard_ problem in general, if not undecidable! `-B NUM' `-S NUM' `-T NUM' These options are present for compatibility with System V `m4', but do nothing in this implementation. They may disappear in future releases, and issue a warning to that effect. `-N NUM' `--diversions=NUM' These options are present only for compatibility with previous versions of GNU `m4', and were controlling the number of possible diversions which could be used at the same time. They do nothing, because there is no fixed limit anymore. They may disappear in future releases, and issue a warning to that effect.  File: m4.info, Node: Frozen state, Next: Debugging options, Prev: Limits control, Up: Invoking m4 2.4 Command line options for frozen state ========================================= GNU `m4' comes with a feature of freezing internal state (*note Frozen files::). This can be used to speed up `m4' execution when reusing a common initialization script. `-F FILE' `--freeze-state=FILE' Once execution is finished, write out the frozen state on the specified FILE. It is conventional, but not required, for FILE to end in `.m4f'. `-R FILE' `--reload-state=FILE' Before execution starts, recover the internal state from the specified frozen FILE. The options `-D', `-U', and `-t' take effect after state is reloaded, but before the input files are read.  File: m4.info, Node: Debugging options, Next: Command line files, Prev: Frozen state, Up: Invoking m4 2.5 Command line options for debugging ====================================== Finally, there are several options for aiding in debugging `m4' scripts. `-d[FLAGS]' `--debug[=FLAGS]' Set the debug-level according to the flags FLAGS. The debug-level controls the format and amount of information presented by the debugging functions. *Note Debug Levels::, for more details on the format and meaning of FLAGS. If omitted, FLAGS defaults to `aeq'. `--debugfile[=FILE]' `-o FILE' `--error-output=FILE' Redirect `dumpdef' output, debug messages, and trace output to the named FILE. Warnings, error messages, and `errprint' output are still printed to standard error. If these options are not used, or if FILE is unspecified (only possible for `--debugfile'), debug output goes to standard error; if FILE is the empty string, debug output is discarded. *Note Debug Output::, for more details. The option `--debugfile' may be given more than once, and order is significant with respect to file names. The spellings `-o' and `--error-output' are misleading and inconsistent with other GNU tools; for now they are silently accepted as synonyms of `--debugfile' and only recognized once, but in a future version of M4, using them will cause a warning to be issued. `-l NUM' `--arglength=NUM' Restrict the size of the output generated by macro tracing to NUM characters per trace line. If unspecified or zero, output is unlimited. *Note Debug Levels::, for more details. `-t NAME' `--trace=NAME' This enables tracing for the macro NAME, at any point where it is defined. NAME need not be defined when this option is given. This option may be given more than once, and order is significant with respect to file names. *Note Trace::, for more details.  File: m4.info, Node: Command line files, Prev: Debugging options, Up: Invoking m4 2.6 Specifying input files on the command line ============================================== The remaining arguments on the command line are taken to be input file names. If no names are present, standard input is read. A file name of `-' is taken to mean standard input. It is conventional, but not required, for input files to end in `.m4'. The input files are read in the sequence given. Standard input can be read more than once, so the file name `-' may appear multiple times on the command line; this makes a difference when input is from a terminal or other special file type. It is an error if an input file ends in the middle of argument collection, a comment, or a quoted string. The options `--define' (`-D'), `--undefine' (`-U'), `--synclines' (`-s'), and `--trace' (`-t') only take effect after processing input from any file names that occur earlier on the command line. For example, assume the file `foo' contains: $ cat foo bar The text `bar' can then be redefined over multiple uses of `foo': $ m4 -Dbar=hello foo -Dbar=world foo =>hello =>world If none of the input files invoked `m4exit' (*note M4exit::), the exit status of `m4' will be 0 for success, 1 for general failure (such as problems with reading an input file), and 63 for version mismatch (*note Using frozen files::). If you need to read a file whose name starts with a `-', you can specify it as `./-file', or use `--' to mark the end of options.  File: m4.info, Node: Syntax, Next: Macros, Prev: Invoking m4, Up: Top 3 Lexical and syntactic conventions *********************************** As `m4' reads its input, it separates it into "tokens". A token is either a name, a quoted string, or any single character, that is not a part of either a name or a string. Input to `m4' can also contain comments. GNU `m4' does not yet understand multibyte locales; all operations are byte-oriented rather than character-oriented (although if your locale uses a single byte encoding, such as ISO-8859-1, you will not notice a difference). However, `m4' is eight-bit clean, so you can use non-ASCII characters in quoted strings (*note Changequote::), comments (*note Changecom::), and macro names (*note Indir::), with the exception of the NUL character (the zero byte `'\0''). * Menu: * Names:: Macro names * Quoted strings:: Quoting input to `m4' * Comments:: Comments in `m4' input * Other tokens:: Other kinds of input tokens * Input processing:: How `m4' copies input to output  File: m4.info, Node: Names, Next: Quoted strings, Up: Syntax 3.1 Macro names =============== A name is any sequence of letters, digits, and the character `_' (underscore), where the first character is not a digit. `m4' will use the longest such sequence found in the input. If a name has a macro definition, it will be subject to macro expansion (*note Macros::). Names are case-sensitive. Examples of legal names are: `foo', `_tmp', and `name01'.  File: m4.info, Node: Quoted strings, Next: Comments, Prev: Names, Up: Syntax 3.2 Quoting input to `m4' ========================= A quoted string is a sequence of characters surrounded by quote strings, defaulting to ``' and `'', where the nested begin and end quotes within the string are balanced. The value of a string token is the text, with one level of quotes stripped off. Thus `' => is the empty string, and double-quoting turns into single-quoting. ``quoted'' =>`quoted' The quote characters can be changed at any time, using the builtin macro `changequote'. *Note Changequote::, for more information.  File: m4.info, Node: Comments, Next: Other tokens, Prev: Quoted strings, Up: Syntax 3.3 Comments in `m4' input ========================== Comments in `m4' are normally delimited by the characters `#' and newline. All characters between the comment delimiters are ignored, but the entire comment (including the delimiters) is passed through to the output--comments are _not_ discarded by `m4'. Comments cannot be nested, so the first newline after a `#' ends the comment. The commenting effect of the begin-comment string can be inhibited by quoting it. $ m4 `quoted text' # `commented text' =>quoted text # `commented text' `quoting inhibits' `#' `comments' =>quoting inhibits # comments The comment delimiters can be changed to any string at any time, using the builtin macro `changecom'. *Note Changecom::, for more information.  File: m4.info, Node: Other tokens, Next: Input processing, Prev: Comments, Up: Syntax 3.4 Other kinds of input tokens =============================== Any character, that is neither a part of a name, nor of a quoted string, nor a comment, is a token by itself. When not in the context of macro expansion, all of these tokens are just copied to output. However, during macro expansion, whitespace characters (space, tab, newline, formfeed, carriage return, vertical tab), parentheses (`(' and `)'), comma (`,'), and dollar (`$') have additional roles, explained later.  File: m4.info, Node: Input processing, Prev: Other tokens, Up: Syntax 3.5 How `m4' copies input to output =================================== As `m4' reads the input token by token, it will copy each token directly to the output immediately. The exception is when it finds a word with a macro definition. In that case `m4' will calculate the macro's expansion, possibly reading more input to get the arguments. It then inserts the expansion in front of the remaining input. In other words, the resulting text from a macro call will be read and parsed into tokens again. `m4' expands a macro as soon as possible. If it finds a macro call when collecting the arguments to another, it will expand the second call first. This process continues until there are no more macro calls to expand and all the input has been consumed. For a running example, examine how `m4' handles this input: format(`Result is %d', eval(`2**15')) First, `m4' sees that the token `format' is a macro name, so it collects the tokens `(', ``Result is %d'', `,', and ` ', before encountering another potential macro. Sure enough, `eval' is a macro name, so the nested argument collection picks up `(', ``2**15'', and `)', invoking the eval macro with the lone argument of `2**15'. The expansion of `eval(2**15)' is `32768', which is then rescanned as the five tokens `3', `2', `7', `6', and `8'; and combined with the next `)', the format macro now has all its arguments, as if the user had typed: format(`Result is %d', 32768) The format macro expands to `Result is 32768', and we have another round of scanning for the tokens `Result', ` ', `is', ` ', `3', `2', `7', `6', and `8'. None of these are macros, so the final output is =>Result is 32768 As a more complicated example, we will contrast an actual code example from the Gnulib project(1), showing both a buggy approach and the desired results. The user desires to output a shell assignment statement that takes its argument and turns it into a shell variable by converting it to uppercase and prepending a prefix. The original attempt looks like this: changequote([,])dnl define([gl_STRING_MODULE_INDICATOR], [ dnl comment GNULIB_]translit([$1],[a-z],[A-Z])[=1 ])dnl gl_STRING_MODULE_INDICATOR([strcase]) => => GNULIB_strcase=1 => Oops - the argument did not get capitalized. And although the manual is not able to easily show it, both lines that appear empty actually contain two trailing spaces. By stepping through the parse, it is easy to see what happened. First, `m4' sees the token `changequote', which it recognizes as a macro, followed by `(', `[', `,', `]', and `)' to form the argument list. The macro expands to the empty string, but changes the quoting characters to something more useful for generating shell code (unbalanced ``' and `'' appear all the time in shell scripts, but unbalanced `[]' tend to be rare). Also in the first line, `m4' sees the token `dnl', which it recognizes as a builtin macro that consumes the rest of the line, resulting in no output for that line. The second line starts a macro definition. `m4' sees the token `define', which it recognizes as a macro, followed by a `(', `[gl_STRING_MODULE_INDICATOR]', and `,'. Because an unquoted comma was encountered, the first argument is known to be the expansion of the single-quoted string token, or `gl_STRING_MODULE_INDICATOR'. Next, `m4' sees `', ` ', and ` ', but this whitespace is discarded as part of argument collection. Then comes a rather lengthy single-quoted string token, `[ dnl comment GNULIB_]'. This is followed by the token `translit', which `m4' recognizes as a macro name, so a nested macro expansion has started. The arguments to the `translit' are found by the tokens `(', `[$1]', `,', `[a-z]', `,', `[A-Z]', and finally `)'. All three string arguments are expanded (or in other words, the quotes are stripped), and since neither `$' nor `1' need capitalization, the result of the macro is `$1'. This expansion is rescanned, resulting in the two literal characters `$' and `1'. Scanning of the outer macro resumes, and picks up with `[=1 ]', and finally `)'. The collected pieces of expanded text are concatenated, with the end result that the macro `gl_STRING_MODULE_INDICATOR' is now defined to be the sequence ` dnl comment GNULIB_$1=1 '. Once again, `dnl' is recognized and avoids a newline in the output. The final line is then parsed, beginning with ` ' and ` ' that are output literally. Then `gl_STRING_MODULE_INDICATOR' is recognized as a macro name, with an argument list of `(', `[strcase]', and `)'. Since the definition of the macro contains the sequence `$1', that sequence is replaced with the argument `strcase' prior to starting the rescan. The rescan sees `' and four spaces, which are output literally, then `dnl', which discards the text ` comment'. Next comes four more spaces, also output literally, and the token `GNULIB_strcase', which resulted from the earlier parameter substitution. Since that is not a macro name, it is output literally, followed by the literal tokens `=', `1', `', and two more spaces. Finally, the original `' seen after the macro invocation is scanned and output literally. Now for a corrected approach. This rearranges the use of newlines and whitespace so that less whitespace is output (which, although harmless to shell scripts, can be visually unappealing), and fixes the quoting issues so that the capitalization occurs when the macro `gl_STRING_MODULE_INDICATOR' is invoked, rather then when it is defined. It also adds another layer of quoting to the first argument of `translit', to ensure that the output will be rescanned as a string rather than a potential uppercase macro name needing further expansion. changequote([,])dnl define([gl_STRING_MODULE_INDICATOR], [dnl comment GNULIB_[]translit([[$1]], [a-z], [A-Z])=1dnl ])dnl gl_STRING_MODULE_INDICATOR([strcase]) => GNULIB_STRCASE=1 The parsing of the first line is unchanged. The second line sees the name of the macro to define, then sees the discarded `' and two spaces, as before. But this time, the next token is `[dnl comment GNULIB_[]translit([[$1]], [a-z], [A-Z])=1dnl]', which includes nested quotes, followed by `)' to end the macro definition and `dnl' to skip the newline. No early expansion of `translit' occurs, so the entire string becomes the definition of the macro. The final line is then parsed, beginning with two spaces that are output literally, and an invocation of `gl_STRING_MODULE_INDICATOR' with the argument `strcase'. Again, the `$1' in the macro definition is substituted prior to rescanning. Rescanning first encounters `dnl', and discards ` comment'. Then two spaces are output literally. Next comes the token `GNULIB_', but that is not a macro, so it is output literally. The token `[]' is an empty string, so it does not affect output. Then the token `translit' is encountered. This time, the arguments to `translit' are parsed as `(', `[[strcase]]', `,', ` ', `[a-z]', `,', ` ', `[A-Z]', and `)'. The two spaces are discarded, and the translit results in the desired result `[STRCASE]'. This is rescanned, but since it is a string, the quotes are stripped and the only output is a literal `STRCASE'. Then the scanner sees `=' and `1', which are output literally, followed by `dnl' which discards the rest of the definition of `gl_STRING_MODULE_INDICATOR'. The newline at the end of output is the literal `' that appeared after the invocation of the macro. The order in which `m4' expands the macros can be further explored using the trace facilities of GNU `m4' (*note Trace::). ---------- Footnotes ---------- (1) Derived from a patch in `http://lists.gnu.org/archive/html/bug-gnulib/2007-01/msg00389.html', and a followup patch in `http://lists.gnu.org/archive/html/bug-gnulib/2007-02/msg00000.html'  File: m4.info, Node: Macros, Next: Definitions, Prev: Syntax, Up: Top 4 How to invoke macros ********************** This chapter covers macro invocation, macro arguments and how macro expansion is treated. * Menu: * Invocation:: Macro invocation * Inhibiting Invocation:: Preventing macro invocation * Macro Arguments:: Macro arguments * Quoting Arguments:: On Quoting Arguments to macros * Macro expansion:: Expanding macros  File: m4.info, Node: Invocation, Next: Inhibiting Invocation, Up: Macros 4.1 Macro invocation ==================== Macro invocations has one of the forms name which is a macro invocation without any arguments, or name(arg1, arg2, ..., argN) which is a macro invocation with N arguments. Macros can have any number of arguments. All arguments are strings, but different macros might interpret the arguments in different ways. The opening parenthesis _must_ follow the NAME directly, with no spaces in between. If it does not, the macro is called with no arguments at all. For a macro call to have no arguments, the parentheses _must_ be left out. The macro call name() is a macro call with one argument, which is the empty string, not a call with no arguments.  File: m4.info, Node: Inhibiting Invocation, Next: Macro Arguments, Prev: Invocation, Up: Macros 4.2 Preventing macro invocation =============================== An innovation of the `m4' language, compared to some of its predecessors (like Strachey's `GPM', for example), is the ability to recognize macro calls without resorting to any special, prefixed invocation character. While generally useful, this feature might sometimes be the source of spurious, unwanted macro calls. So, GNU `m4' offers several mechanisms or techniques for inhibiting the recognition of names as macro calls. First of all, many builtin macros cannot meaningfully be called without arguments. As a GNU extension, for any of these macros, whenever an opening parenthesis does not immediately follow their name, the builtin macro call is not triggered. This solves the most usual cases, like for `include' or `eval'. Later in this document, the sentence "This macro is recognized only with parameters" refers to this specific provision of GNU M4, also known as a blind builtin macro. For the builtins defined by POSIX that bear this disclaimer, POSIX specifically states that invoking those builtins without arguments is unspecified, because many other implementations simply invoke the builtin as though it were given one empty argument instead. $ m4 eval =>eval eval(`1') =>1 There is also a command line option (`--prefix-builtins', or `-P', *note Invoking m4: Operation modes.) that renames all builtin macros with a prefix of `m4_' at startup. The option has no effect whatsoever on user defined macros. For example, with this option, one has to write `m4_dnl' and even `m4_m4exit'. It also has no effect on whether a macro requires parameters. $ m4 -P eval =>eval eval(`1') =>eval(1) m4_eval =>m4_eval m4_eval(`1') =>1 Another alternative is to redefine problematic macros to a name less likely to cause conflicts, *Note Definitions::. If your version of GNU `m4' has the `changeword' feature compiled in, it offers far more flexibility in specifying the syntax of macro names, both builtin or user-defined. *Note Changeword::, for more information on this experimental feature. Of course, the simplest way to prevent a name from being interpreted as a call to an existing macro is to quote it. The remainder of this section studies a little more deeply how quoting affects macro invocation, and how quoting can be used to inhibit macro invocation. Even if quoting is usually done over the whole macro name, it can also be done over only a few characters of this name (provided, of course, that the unquoted portions are not also a macro). It is also possible to quote the empty string, but this works only _inside_ the name. For example: `divert' =>divert `d'ivert =>divert di`ver't =>divert div`'ert =>divert all yield the string `divert'. While in both: `'divert => divert`' => the `divert' builtin macro will be called, which expands to the empty string. The output of macro evaluations is always rescanned. In the following example, the input `x`'y' yields the string `bCD', exactly as if `m4' has been given `substr(ab`'cde, `1', `3')' as input: define(`cde', `CDE') => define(`x', `substr(ab') => define(`y', `cde, `1', `3')') => x`'y =>bCD Unquoted strings on either side of a quoted string are subject to being recognized as macro names. In the following example, quoting the empty string allows for the second `macro' to be recognized as such: define(`macro', `m') => macro(`m')macro =>mmacro macro(`m')`'macro =>mm Quoting may prevent recognizing as a macro name the concatenation of a macro expansion with the surrounding characters. In this example: define(`macro', `di$1') => macro(`v')`ert' =>divert macro(`v')ert => the input will produce the string `divert'. When the quotes were removed, the `divert' builtin was called instead.  File: m4.info, Node: Macro Arguments, Next: Quoting Arguments, Prev: Inhibiting Invocation, Up: Macros 4.3 Macro arguments =================== When a name is seen, and it has a macro definition, it will be expanded as a macro. If the name is followed by an opening parenthesis, the arguments will be collected before the macro is called. If too few arguments are supplied, the missing arguments are taken to be the empty string. However, some builtins are documented to behave differently for a missing optional argument than for an explicit empty string. If there are too many arguments, the excess arguments are ignored. Unquoted leading whitespace is stripped off all arguments, but whitespace generated by a macro expansion or occurring after a macro that expanded to an empty string remains intact. Whitespace includes space, tab, newline, carriage return, vertical tab, and formfeed. define(`macro', `$1') => macro( unquoted leading space lost) =>unquoted leading space lost macro(` quoted leading space kept') => quoted leading space kept macro( divert `unquoted space kept after expansion') => unquoted space kept after expansion macro(macro(` ')`whitespace from expansion kept') => =>whitespace from expansion kept macro(`unquoted trailing whitespace kept' ) =>unquoted trailing whitespace kept => Normally `m4' will issue warnings if a builtin macro is called with an inappropriate number of arguments, but it can be suppressed with the `--quiet' command line option (or `--silent', or `-Q', *note Invoking m4: Operation modes.). For user defined macros, there is no check of the number of arguments given. $ m4 index(`abc') error-->m4:stdin:1: Warning: too few arguments to builtin `index' =>0 index(`abc',) =>0 index(`abc', `b', `ignored') error-->m4:stdin:3: Warning: excess arguments to builtin `index' ignored =>1 $ m4 -Q index(`abc') =>0 index(`abc',) =>0 index(`abc', `b', `ignored') =>1 Macros are expanded normally during argument collection, and whatever commas, quotes and parentheses that might show up in the resulting expanded text will serve to define the arguments as well. Thus, if FOO expands to `, b, c', the macro call bar(a foo, d) is a macro call with four arguments, which are `a ', `b', `c' and `d'. To understand why the first argument contains whitespace, remember that unquoted leading whitespace is never part of an argument, but trailing whitespace always is. It is possible for a macro's definition to change during argument collection, in which case the expansion uses the definition that was in effect at the time the opening `(' was seen. define(`f', `1') => f(define(`f', `2')) =>1 f =>2 It is an error if the end of file occurs while collecting arguments. hello world =>hello world define( ^D error-->m4:stdin:2: ERROR: end of file in argument list  File: m4.info, Node: Quoting Arguments, Next: Macro expansion, Prev: Macro Arguments, Up: Macros 4.4 On Quoting Arguments to macros ================================== Each argument has unquoted leading whitespace removed. Within each argument, all unquoted parentheses must match. For example, if FOO is a macro, foo(() (`(') `(') is a macro call, with one argument, whose value is `() (() ('. Commas separate arguments, except when they occur inside quotes, comments, or unquoted parentheses. *Note Pseudo Arguments::, for examples. It is common practice to quote all arguments to macros, unless you are sure you want the arguments expanded. Thus, in the above example with the parentheses, the `right' way to do it is like this: foo(`() (() (') It is, however, in certain cases necessary (because nested expansion must occur to create the arguments for the outer macro) or convenient (because it uses fewer characters) to leave out quotes for some arguments, and there is nothing wrong in doing it. It just makes life a bit harder, if you are not careful to follow a consistent quoting style. For consistency, this manual follows the rule of thumb that each layer of parentheses introduces another layer of single quoting, except when showing the consequences of quoting rules. This is done even when the quoted string cannot be a macro, such as with integers when you have not changed the syntax via `changeword' (*note Changeword::). The quoting rule of thumb of one level of quoting per parentheses has a nice property: when a macro name appears inside parentheses, you can determine when it will be expanded. If it is not quoted, it will be expanded prior to the outer macro, so that its expansion becomes the argument. If it is single-quoted, it will be expanded after the outer macro. And if it is double-quoted, it will be used as literal text instead of a macro name. define(`active', `ACT, IVE') => define(`show', `$1 $1') => show(active) =>ACT ACT show(`active') =>ACT, IVE ACT, IVE show(``active'') =>active active  File: m4.info, Node: Macro expansion, Prev: Quoting Arguments, Up: Macros 4.5 Macro expansion =================== When the arguments, if any, to a macro call have been collected, the macro is expanded, and the expansion text is pushed back onto the input (unquoted), and reread. The expansion text from one macro call might therefore result in more macros being called, if the calls are included, completely or partially, in the first macro calls' expansion. Taking a very simple example, if FOO expands to `bar', and BAR expands to `Hello', the input $ m4 -Dbar=Hello -Dfoo=bar foo =>Hello will expand first to `bar', and when this is reread and expanded, into `Hello'.  File: m4.info, Node: Definitions, Next: Conditionals, Prev: Macros, Up: Top 5 How to define new macros ************************** Macros can be defined, redefined and deleted in several different ways. Also, it is possible to redefine a macro without losing a previous value, and bring back the original value at a later time. * Menu: * Define:: Defining a new macro * Arguments:: Arguments to macros * Pseudo Arguments:: Special arguments to macros * Undefine:: Deleting a macro * Defn:: Renaming macros * Pushdef:: Temporarily redefining macros * Indir:: Indirect call of macros * Builtin:: Indirect call of builtins  File: m4.info, Node: Define, Next: Arguments, Up: Definitions 5.1 Defining a macro ==================== The normal way to define or redefine macros is to use the builtin `define': -- Builtin: define (NAME, [EXPANSION]) Defines NAME to expand to EXPANSION. If EXPANSION is not given, it is taken to be empty. The expansion of `define' is void. The macro `define' is recognized only with parameters. The following example defines the macro FOO to expand to the text `Hello World.'. define(`foo', `Hello world.') => foo =>Hello world. The empty line in the output is there because the newline is not a part of the macro definition, and it is consequently copied to the output. This can be avoided by use of the macro `dnl'. *Note Dnl::, for details. The first argument to `define' should be quoted; otherwise, if the macro is already defined, you will be defining a different macro. This example shows the problems with underquoting, since we did not want to redefine `one': define(foo, one) => define(foo, two) => one =>two GNU `m4' normally replaces only the _topmost_ definition of a macro if it has several definitions from `pushdef' (*note Pushdef::). Some other implementations of `m4' replace all definitions of a macro with `define'. *Note Incompatibilities::, for more details. As a GNU extension, the first argument to `define' does not have to be a simple word. It can be any text string, even the empty string. A macro with a non-standard name cannot be invoked in the normal way, as the name is not recognized. It can only be referenced by the builtins `indir' (*note Indir::) and `defn' (*note Defn::). Arrays and associative arrays can be simulated by using non-standard macro names. -- Composite: array (INDEX) -- Composite: array_set (INDEX, [VALUE]) Provide access to entries within an array. `array' reads the entry at location INDEX, and `array_set' assigns VALUE to location INDEX. define(`array', `defn(format(``array[%d]'', `$1'))') => define(`array_set', `define(format(``array[%d]'', `$1'), `$2')') => array_set(`4', `array element no. 4') => array_set(`17', `array element no. 17') => array(`4') =>array element no. 4 array(eval(`10 + 7')) =>array element no. 17 Change the `%d' to `%s' and it is an associative array.  File: m4.info, Node: Arguments, Next: Pseudo Arguments, Prev: Define, Up: Definitions 5.2 Arguments to macros ======================= Macros can have arguments. The Nth argument is denoted by `$n' in the expansion text, and is replaced by the Nth actual argument, when the macro is expanded. Replacement of arguments happens before rescanning, regardless of how many nesting levels of quoting appear in the expansion. Here is an example of a macro with two arguments. -- Composite: exch (ARG1, ARG2) Expands to ARG2 followed by ARG1, effectively exchanging their order. define(`exch', `$2, $1') => exch(`arg1', `arg2') =>arg2, arg1 This can be used, for example, if you like the arguments to `define' to be reversed. define(`exch', `$2, $1') => define(exch(``expansion text'', ``macro'')) => macro =>expansion text *Note Quoting Arguments::, for an explanation of the double quotes. (You should try and improve this example so that clients of `exch' do not have to double quote; or *note Answers: Improved exch.). As a special case, the zeroth argument, `$0', is always the name of the macro being expanded. define(`test', ``Macro name: $0'') => test =>Macro name: test If you want quoted text to appear as part of the expansion text, remember that quotes can be nested in quoted strings. Thus, in define(`foo', `This is macro `foo'.') => foo =>This is macro foo. The `foo' in the expansion text is _not_ expanded, since it is a quoted string, and not a name. GNU `m4' allows the number following the `$' to consist of one or more digits, allowing macros to have any number of arguments. The extension of accepting multiple digits is incompatible with POSIX, and is different than traditional implementations of `m4', which only recognize one digit. Therefore, future versions of GNU M4 will phase out this feature. To portably access beyond the ninth argument, you can use the `argn' macro documented later (*note Shift::). POSIX also states that `$' followed immediately by `{' in a macro definition is implementation-defined. This version of M4 passes the literal characters `${' through unchanged, but M4 2.0 will implement an optional feature similar to `sh', where `${11}' expands to the eleventh argument, to replace the current recognition of `$11'. Meanwhile, if you want to guarantee that you will get a literal `${' in output when expanding a macro, even when you upgrade to M4 2.0, you can use nested quoting to your advantage: define(`foo', `single quoted $`'{1} output') => define(`bar', ``double quoted $'`{2} output'') => foo(`a', `b') =>single quoted ${1} output bar(`a', `b') =>double quoted ${2} output To help you detect places in your M4 input files that might change in behavior due to the changed behavior of M4 2.0, you can use the `--warn-macro-sequence' command-line option (*note Invoking m4: Operation modes.) with the default regular expression. This will add a warning any time a macro definition includes `$' followed by multiple digits, or by `{'. The warning is not enabled by default, because it triggers a number of warnings in Autoconf 2.61 (and Autoconf uses `-E' to treat warnings as errors), and because it will still be possible to restore older behavior in M4 2.0. $ m4 --warn-macro-sequence define(`foo', `$001 ${1} $1') error-->m4:stdin:1: Warning: definition of `foo' contains sequence `$001' error-->m4:stdin:1: Warning: definition of `foo' contains sequence `${1}' => foo(`bar') =>bar ${1} bar  File: m4.info, Node: Pseudo Arguments, Next: Undefine, Prev: Arguments, Up: Definitions 5.3 Special arguments to macros =============================== There is a special notation for the number of actual arguments supplied, and for all the actual arguments. The number of actual arguments in a macro call is denoted by `$#' in the expansion text. -- Composite: nargs (...) Expands to a count of the number of arguments supplied. define(`nargs', `$#') => nargs =>0 nargs() =>1 nargs(`arg1', `arg2', `arg3') =>3 nargs(`commas can be quoted, like this') =>1 nargs(arg1#inside comments, commas do not separate arguments still arg1) =>1 nargs((unquoted parentheses, like this, group arguments)) =>1 Remember that `#' defaults to the comment character; if you forget quotes to inhibit the comment behavior, your macro definition may not end where you expected. dnl Attempt to define a macro to just `$#' define(underquoted, $#) oops) => underquoted =>0) =>oops The notation `$*' can be used in the expansion text to denote all the actual arguments, unquoted, with commas in between. For example define(`echo', `$*') => echo(arg1, arg2, arg3 , arg4) =>arg1,arg2,arg3 ,arg4 Often each argument should be quoted, and the notation `$@' handles that. It is just like `$*', except that it quotes each argument. A simple example of that is: define(`echo', `$@') => echo(arg1, arg2, arg3 , arg4) =>arg1,arg2,arg3 ,arg4 Where did the quotes go? Of course, they were eaten, when the expanded text were reread by `m4'. To show the difference, try define(`echo1', `$*') => define(`echo2', `$@') => define(`foo', `This is macro `foo'.') => echo1(foo) =>This is macro This is macro foo.. echo1(`foo') =>This is macro foo. echo2(foo) =>This is macro foo. echo2(`foo') =>foo *Note Trace::, if you do not understand this. As another example of the difference, remember that comments encountered in arguments are passed untouched to the macro, and that quoting disables comments. define(`echo1', `$*') => define(`echo2', `$@') => define(`foo', `bar') => echo1(#foo'foo foo) =>#foo'foo =>bar echo2(#foo'foo foo) =>#foobar =>bar' A `$' sign in the expansion text, that is not followed by anything `m4' understands, is simply copied to the macro expansion, as any other text is. define(`foo', `$$$ hello $$$') => foo =>$$$ hello $$$ If you want a macro to expand to something like `$12', the judicious use of nested quoting can put a safe character between the `$' and the next character, relying on the rescanning to remove the nested quote. This will prevent `m4' from interpreting the `$' sign as a reference to an argument. define(`foo', `no nested quote: $1') => foo(`arg') =>no nested quote: arg define(`foo', `nested quote around $: `$'1') => foo(`arg') =>nested quote around $: $1 define(`foo', `nested empty quote after $: $`'1') => foo(`arg') =>nested empty quote after $: $1 define(`foo', `nested quote around next character: $`1'') => foo(`arg') =>nested quote around next character: $1 define(`foo', `nested quote around both: `$1'') => foo(`arg') =>nested quote around both: arg  File: m4.info, Node: Undefine, Next: Defn, Prev: Pseudo Arguments, Up: Definitions 5.4 Deleting a macro ==================== A macro definition can be removed with `undefine': -- Builtin: undefine (NAME...) For each argument, remove the macro NAME. The macro names must necessarily be quoted, since they will be expanded otherwise. The expansion of `undefine' is void. The macro `undefine' is recognized only with parameters. foo bar blah =>foo bar blah define(`foo', `some')define(`bar', `other')define(`blah', `text') => foo bar blah =>some other text undefine(`foo') => foo bar blah =>foo other text undefine(`bar', `blah') => foo bar blah =>foo bar blah Undefining a macro inside that macro's expansion is safe; the macro still expands to the definition that was in effect at the `('. define(`f', ``$0':$1') => f(f(f(undefine(`f')`hello world'))) =>f:f:f:hello world f(`bye') =>f(bye) It is not an error for NAME to have no macro definition. In that case, `undefine' does nothing.  File: m4.info, Node: Defn, Next: Pushdef, Prev: Undefine, Up: Definitions 5.5 Renaming macros =================== It is possible to rename an already defined macro. To do this, you need the builtin `defn': -- Builtin: defn (NAME...) Expands to the _quoted definition_ of each NAME. If an argument is not a defined macro, the expansion for that argument is empty. If NAME is a user-defined macro, the quoted definition is simply the quoted expansion text. If, instead, there is only one NAME and it is a builtin, the expansion is a special token, which points to the builtin's internal definition. This token is only meaningful as the second argument to `define' (and `pushdef'), and is silently converted to an empty string in most other contexts. Combining a builtin with anything else is not supported; a warning is issued and the builtin is omitted from the final expansion. The macro `defn' is recognized only with parameters. Its normal use is best understood through an example, which shows how to rename `undefine' to `zap': define(`zap', defn(`undefine')) => zap(`undefine') => undefine(`zap') =>undefine(zap) In this way, `defn' can be used to copy macro definitions, and also definitions of builtin macros. Even if the original macro is removed, the other name can still be used to access the definition. The fact that macro definitions can be transferred also explains why you should use `$0', rather than retyping a macro's name in its definition: define(`foo', `This is `$0'') => define(`bar', defn(`foo')) => bar =>This is bar Macros used as string variables should be referred through `defn', to avoid unwanted expansion of the text: define(`string', `The macro dnl is very useful ') => string =>The macro defn(`string') =>The macro dnl is very useful => However, it is important to remember that `m4' rescanning is purely textual. If an unbalanced end-quote string occurs in a macro definition, the rescan will see that embedded quote as the termination of the quoted string, and the remainder of the macro's definition will be rescanned unquoted. Thus it is a good idea to avoid unbalanced end-quotes in macro definitions or arguments to macros. define(`foo', a'a) => define(`a', `A') => define(`echo', `$@') => foo =>A'A defn(`foo') =>aA' echo(foo) =>AA' On the other hand, it is possible to exploit the fact that `defn' can concatenate multiple macros prior to the rescanning phase, in order to join the definitions of macros that, in isolation, have unbalanced quotes. This is particularly useful when one has used several macros to accumulate text that M4 should rescan as a whole. In the example below, note how the use of `defn' on `l' in isolation opens a string, which is not closed until the next line; but used on `l' and `r' together results in nested quoting. define(`l', `<[>')define(`r', `<]>') => changequote(`[', `]') => defn([l])defn([r]) ]) =><[>]defn([r]) =>) defn([l], [r]) =><[>][<]> Using `defn' to generate special tokens for builtin macros outside of expected contexts can sometimes trigger warnings. But most of the time, such tokens are silently converted to the empty string. $ m4 -d defn(`defn') => define(defn(`divnum'), `cannot redefine a builtin token') error-->m4:stdin:2: Warning: define: invalid macro name ignored => divnum =>0 len(defn(`divnum')) =>0 Also note that `defn' with multiple arguments can only join text macros, not builtins, although a future version of GNU M4 may lift this restriction. $ m4 -d define(`a', `A')define(`AA', `b') => traceon(`defn', `define') => defn(`a', `divnum', `a') error-->m4:stdin:3: Warning: cannot concatenate builtin `divnum' error-->m4trace: -1- defn(`a', `divnum', `a') -> ``A'`A'' =>AA define(`mydivnum', defn(`divnum', `divnum'))mydivnum error-->m4:stdin:4: Warning: cannot concatenate builtin `divnum' error-->m4:stdin:4: Warning: cannot concatenate builtin `divnum' error-->m4trace: -2- defn(`divnum', `divnum') error-->m4trace: -1- define(`mydivnum', `') => traceoff(`defn', `define') =>  File: m4.info, Node: Pushdef, Next: Indir, Prev: Defn, Up: Definitions 5.6 Temporarily redefining macros ================================= It is possible to redefine a macro temporarily, reverting to the previous definition at a later time. This is done with the builtins `pushdef' and `popdef': -- Builtin: pushdef (NAME, [EXPANSION]) -- Builtin: popdef (NAME...) Analogous to `define' and `undefine'. These macros work in a stack-like fashion. A macro is temporarily redefined with `pushdef', which replaces an existing definition of NAME, while saving the previous definition, before the new one is installed. If there is no previous definition, `pushdef' behaves exactly like `define'. If a macro has several definitions (of which only one is accessible), the topmost definition can be removed with `popdef'. If there is no previous definition, `popdef' behaves like `undefine'. The expansion of both `pushdef' and `popdef' is void. The macros `pushdef' and `popdef' are recognized only with parameters. define(`foo', `Expansion one.') => foo =>Expansion one. pushdef(`foo', `Expansion two.') => foo =>Expansion two. pushdef(`foo', `Expansion three.') => pushdef(`foo', `Expansion four.') => popdef(`foo') => foo =>Expansion three. popdef(`foo', `foo') => foo =>Expansion one. popdef(`foo') => foo =>foo If a macro with several definitions is redefined with `define', the topmost definition is _replaced_ with the new definition. If it is removed with `undefine', _all_ the definitions are removed, and not only the topmost one. However, POSIX allows other implementations that treat `define' as replacing an entire stack of definitions with a single new definition, so to be portable to other implementations, it may be worth explicitly using `popdef' and `pushdef' rather than relying on the GNU behavior of `define'. define(`foo', `Expansion one.') => foo =>Expansion one. pushdef(`foo', `Expansion two.') => foo =>Expansion two. define(`foo', `Second expansion two.') => foo =>Second expansion two. undefine(`foo') => foo =>foo Local variables within macros are made with `pushdef' and `popdef'. At the start of the macro a new definition is pushed, within the macro it is manipulated and at the end it is popped, revealing the former definition. It is possible to temporarily redefine a builtin with `pushdef' and `defn'.  File: m4.info, Node: Indir, Next: Builtin, Prev: Pushdef, Up: Definitions 5.7 Indirect call of macros =========================== Any macro can be called indirectly with `indir': -- Builtin: indir (NAME, [ARGS...]) Results in a call to the macro NAME, which is passed the rest of the arguments ARGS. If NAME is not defined, an error message is printed, and the expansion is void. The macro `indir' is recognized only with parameters. This can be used to call macros with computed or "invalid" names (`define' allows such names to be defined): define(`$$internal$macro', `Internal macro (name `$0')') => $$internal$macro =>$$internal$macro indir(`$$internal$macro') =>Internal macro (name $$internal$macro) The point is, here, that larger macro packages can have private macros defined, that will not be called by accident. They can _only_ be called through the builtin `indir'. One other point to observe is that argument collection occurs before `indir' invokes NAME, so if argument collection changes the value of NAME, that will be reflected in the final expansion. This is different than the behavior when invoking macros directly, where the definition that was in effect before argument collection is used. $ m4 -d define(`f', `1') => f(define(`f', `2')) =>1 indir(`f', define(`f', `3')) =>3 indir(`f', undefine(`f')) error-->m4:stdin:4: undefined macro `f' => When handed the result of `defn' (*note Defn::) as one of its arguments, `indir' defers to the invoked NAME for whether a token representing a builtin is recognized or flattened to the empty string. $ m4 -d indir(defn(`defn'), `divnum') error-->m4:stdin:1: Warning: indir: invalid macro name ignored => indir(`define', defn(`defn'), `divnum') error-->m4:stdin:2: Warning: define: invalid macro name ignored => indir(`define', `foo', defn(`divnum')) => foo =>0 indir(`divert', defn(`foo')) error-->m4:stdin:5: empty string treated as 0 in builtin `divert' =>  File: m4.info, Node: Builtin, Prev: Indir, Up: Definitions 5.8 Indirect call of builtins ============================= Builtin macros can be called indirectly with `builtin': -- Builtin: builtin (NAME, [ARGS...]) Results in a call to the builtin NAME, which is passed the rest of the arguments ARGS. If NAME does not name a builtin, an error message is printed, and the expansion is void. The macro `builtin' is recognized only with parameters. This can be used even if NAME has been given another definition that has covered the original, or been undefined so that no macro maps to the builtin. pushdef(`define', `hidden') => undefine(`undefine') => define(`foo', `bar') =>hidden foo =>foo builtin(`define', `foo', defn(`divnum')) => foo =>0 builtin(`define', `foo', `BAR') => foo =>BAR undefine(`foo') =>undefine(foo) foo =>BAR builtin(`undefine', `foo') => foo =>foo The NAME argument only matches the original name of the builtin, even when the `--prefix-builtins' option (or `-P', *note Invoking m4: Operation modes.) is in effect. This is different from `indir', which only tracks current macro names. $ m4 -P m4_builtin(`divnum') =>0 m4_builtin(`m4_divnum') error-->m4:stdin:2: undefined builtin `m4_divnum' => m4_indir(`divnum') error-->m4:stdin:3: undefined macro `divnum' => m4_indir(`m4_divnum') =>0 Note that `indir' and `builtin' can be used to invoke builtins without arguments, even when they normally require parameters to be recognized; but it will provoke a warning, and result in a void expansion. builtin =>builtin builtin() error-->m4:stdin:2: undefined builtin `' => builtin(`builtin') error-->m4:stdin:3: Warning: too few arguments to builtin `builtin' => builtin(`builtin',) error-->m4:stdin:4: undefined builtin `' => builtin(`builtin', ``' ') error-->m4:stdin:5: undefined builtin ``' error-->' => indir(`index') error-->m4:stdin:7: Warning: too few arguments to builtin `index' =>  File: m4.info, Node: Conditionals, Next: Debugging, Prev: Definitions, Up: Top 6 Conditionals, loops, and recursion ************************************ Macros, expanding to plain text, perhaps with arguments, are not quite enough. We would like to have macros expand to different things, based on decisions taken at run-time. For that, we need some kind of conditionals. Also, we would like to have some kind of loop construct, so we could do something a number of times, or while some condition is true. * Menu: * Ifdef:: Testing if a macro is defined * Ifelse:: If-else construct, or multibranch * Shift:: Recursion in `m4' * Forloop:: Iteration by counting * Foreach:: Iteration by list contents * Stacks:: Working with definition stacks * Composition:: Building macros with macros  File: m4.info, Node: Ifdef, Next: Ifelse, Up: Conditionals 6.1 Testing if a macro is defined ================================= There are two different builtin conditionals in `m4'. The first is `ifdef': -- Builtin: ifdef (NAME, STRING-1, [STRING-2]) If NAME is defined as a macro, `ifdef' expands to STRING-1, otherwise to STRING-2. If STRING-2 is omitted, it is taken to be the empty string (according to the normal rules). The macro `ifdef' is recognized only with parameters. ifdef(`foo', ``foo' is defined', ``foo' is not defined') =>foo is not defined define(`foo', `') => ifdef(`foo', ``foo' is defined', ``foo' is not defined') =>foo is defined ifdef(`no_such_macro', `yes', `no', `extra argument') error-->m4:stdin:4: Warning: excess arguments to builtin `ifdef' ignored =>no  File: m4.info, Node: Ifelse, Next: Shift, Prev: Ifdef, Up: Conditionals 6.2 If-else construct, or multibranch ===================================== The other conditional, `ifelse', is much more powerful. It can be used as a way to introduce a long comment, as an if-else construct, or as a multibranch, depending on the number of arguments supplied: -- Builtin: ifelse (COMMENT) -- Builtin: ifelse (STRING-1, STRING-2, EQUAL, [NOT-EQUAL]) -- Builtin: ifelse (STRING-1, STRING-2, EQUAL-1, STRING-3, STRING-4, EQUAL-2, ..., [NOT-EQUAL]) Used with only one argument, the `ifelse' simply discards it and produces no output. If called with three or four arguments, `ifelse' expands into EQUAL, if STRING-1 and STRING-2 are equal (character for character), otherwise it expands to NOT-EQUAL. A final fifth argument is ignored, after triggering a warning. If called with six or more arguments, and STRING-1 and STRING-2 are equal, `ifelse' expands into EQUAL-1, otherwise the first three arguments are discarded and the processing starts again. The macro `ifelse' is recognized only with parameters. Using only one argument is a common `m4' idiom for introducing a block comment, as an alternative to repeatedly using `dnl'. This special usage is recognized by GNU `m4', so that in this case, the warning about missing arguments is never triggered. ifelse(`some comments') => ifelse(`foo', `bar') error-->m4:stdin:2: Warning: too few arguments to builtin `ifelse' => Using three or four arguments provides decision points. ifelse(`foo', `bar', `true') => ifelse(`foo', `foo', `true') =>true define(`foo', `bar') => ifelse(foo, `bar', `true', `false') =>true ifelse(foo, `foo', `true', `false') =>false Notice how the first argument was used unquoted; it is common to compare the expansion of a macro with a string. With this macro, you can now reproduce the behavior of blind builtins, where the macro is recognized only with arguments. define(`foo', `ifelse(`$#', `0', ``$0'', `arguments:$#')') => foo =>foo foo() =>arguments:1 foo(`a', `b', `c') =>arguments:3 For an example of a way to make defining blind macros easier, see *note Composition::. The macro `ifelse' can take more than four arguments. If given more than four arguments, `ifelse' works like a `case' or `switch' statement in traditional programming languages. If STRING-1 and STRING-2 are equal, `ifelse' expands into EQUAL-1, otherwise the procedure is repeated with the first three arguments discarded. This calls for an example: ifelse(`foo', `bar', `third', `gnu', `gnats') error-->m4:stdin:1: Warning: excess arguments to builtin `ifelse' ignored =>gnu ifelse(`foo', `bar', `third', `gnu', `gnats', `sixth') => ifelse(`foo', `bar', `third', `gnu', `gnats', `sixth', `seventh') =>seventh ifelse(`foo', `bar', `3', `gnu', `gnats', `6', `7', `8') error-->m4:stdin:4: Warning: excess arguments to builtin `ifelse' ignored =>7 Naturally, the normal case will be slightly more advanced than these examples. A common use of `ifelse' is in macros implementing loops of various kinds.  File: m4.info, Node: Shift, Next: Forloop, Prev: Ifelse, Up: Conditionals 6.3 Recursion in `m4' ===================== There is no direct support for loops in `m4', but macros can be recursive. There is no limit on the number of recursion levels, other than those enforced by your hardware and operating system. Loops can be programmed using recursion and the conditionals described previously. There is a builtin macro, `shift', which can, among other things, be used for iterating through the actual arguments to a macro: -- Builtin: shift (ARG1, ...) Takes any number of arguments, and expands to all its arguments except ARG1, separated by commas, with each argument quoted. The macro `shift' is recognized only with parameters. shift =>shift shift(`bar') => shift(`foo', `bar', `baz') =>bar,baz An example of the use of `shift' is this macro: -- Composite: reverse (...) Takes any number of arguments, and reverses their order. It is implemented as: define(`reverse', `ifelse(`$#', `0', , `$#', `1', ``$1'', `reverse(shift($@)), `$1'')') => reverse => reverse(`foo') =>foo reverse(`foo', `bar', `gnats', `and gnus') =>and gnus, gnats, bar, foo While not a very interesting macro, it does show how simple loops can be made with `shift', `ifelse' and recursion. It also shows that `shift' is usually used with `$@'. Another example of this is an implementation of a short-circuiting conditional operator. -- Composite: cond (TEST-1, STRING-1, EQUAL-1, [TEST-2], [STRING-2], [EQUAL-2], ..., [NOT-EQUAL]) Similar to `ifelse', where an equal comparison between the first two strings results in the third, otherwise the first three arguments are discarded and the process repeats. The difference is that each TEST- is expanded only when it is encountered. This means that every third argument to `cond' is normally given one more level of quoting than the corresponding argument to `ifelse'. Here is the implementation of `cond', along with a demonstration of how it can short-circuit the side effects in `side'. Notice how all the unquoted side effects happen regardless of how many comparisons are made with `ifelse', compared with only the relevant effects with `cond'. define(`cond', `ifelse(`$#', `1', `$1', `ifelse($1, `$2', `$3', `$0(shift(shift(shift($@))))')')')dnl define(`side', `define(`counter', incr(counter))$1')dnl define(`example1', `define(`counter', `0')dnl ifelse(side(`$1'), `yes', `one comparison: ', side(`$1'), `no', `two comparisons: ', side(`$1'), `maybe', `three comparisons: ', `side(`default answer: ')')counter')dnl define(`example2', `define(`counter', `0')dnl cond(`side(`$1')', `yes', `one comparison: ', `side(`$1')', `no', `two comparisons: ', `side(`$1')', `maybe', `three comparisons: ', `side(`default answer: ')')counter')dnl example1(`yes') =>one comparison: 3 example1(`no') =>two comparisons: 3 example1(`maybe') =>three comparisons: 3 example1(`feeling rather indecisive today') =>default answer: 4 example2(`yes') =>one comparison: 1 example2(`no') =>two comparisons: 2 example2(`maybe') =>three comparisons: 3 example2(`feeling rather indecisive today') =>default answer: 4 Another common task that requires iteration is joining a list of arguments into a single string. -- Composite: join ([SEPARATOR], [ARGS...]) -- Composite: joinall ([SEPARATOR], [ARGS...]) Generate a single-quoted string, consisting of each ARG separated by SEPARATOR. While `joinall' always outputs a SEPARATOR between arguments, `join' avoids the SEPARATOR for an empty ARG. Here are some examples of its usage, based on the implementation `m4-1.4.14/examples/join.m4' distributed in this package: $ m4 -I examples include(`join.m4') => join,join(`-'),join(`-', `'),join(`-', `', `') =>,,, joinall,joinall(`-'),joinall(`-', `'),joinall(`-', `', `') =>,,,- join(`-', `1') =>1 join(`-', `1', `2', `3') =>1-2-3 join(`', `1', `2', `3') =>123 join(`-', `', `1', `', `', `2', `') =>1-2 joinall(`-', `', `1', `', `', `2', `') =>-1---2- join(`,', `1', `2', `3') =>1,2,3 define(`nargs', `$#')dnl nargs(join(`,', `1', `2', `3')) =>1 Examining the implementation shows some interesting points about several m4 programming idioms. $ m4 -I examples undivert(`join.m4')dnl =>divert(`-1') =># join(sep, args) - join each non-empty ARG into a single =># string, with each element separated by SEP =>define(`join', =>`ifelse(`$#', `2', ``$2'', => `ifelse(`$2', `', `', ``$2'_')$0(`$1', shift(shift($@)))')') =>define(`_join', =>`ifelse(`$#$2', `2', `', => `ifelse(`$2', `', `', ``$1$2'')$0(`$1', shift(shift($@)))')') =># joinall(sep, args) - join each ARG, including empty ones, =># into a single string, with each element separated by SEP =>define(`joinall', ``$2'_$0(`$1', shift($@))') =>define(`_joinall', =>`ifelse(`$#', `2', `', ``$1$3'$0(`$1', shift(shift($@)))')') =>divert`'dnl First, notice that this implementation creates helper macros `_join' and `_joinall'. This division of labor makes it easier to output the correct number of SEPARATOR instances: `join' and `joinall' are responsible for the first argument, without a separator, while `_join' and `_joinall' are responsible for all remaining arguments, always outputting a separator when outputting an argument. Next, observe how `join' decides to iterate to itself, because the first ARG was empty, or to output the argument and swap over to `_join'. If the argument is non-empty, then the nested `ifelse' results in an unquoted `_', which is concatenated with the `$0' to form the next macro name to invoke. The `joinall' implementation is simpler since it does not have to suppress empty ARG; it always executes once then defers to `_joinall'. Another important idiom is the idea that SEPARATOR is reused for each iteration. Each iteration has one less argument, but rather than discarding `$1' by iterating with `$0(shift($@))', the macro discards `$2' by using `$0(`$1', shift(shift($@)))'. Next, notice that it is possible to compare more than one condition in a single `ifelse' test. The test of `$#$2' against `2' allows `_join' to iterate for two separate reasons--either there are still more than two arguments, or there are exactly two arguments but the last argument is not empty. Finally, notice that these macros require exactly two arguments to terminate recursion, but that they still correctly result in empty output when given no ARGS (i.e., zero or one macro argument). On the first pass when there are too few arguments, the `shift' results in no output, but leaves an empty string to serve as the required second argument for the second pass. Put another way, ``$1', shift($@)' is not the same as `$@', since only the former guarantees at least two arguments. Sometimes, a recursive algorithm requires adding quotes to each element, or treating multiple arguments as a single element: -- Composite: quote (...) -- Composite: dquote (...) -- Composite: dquote_elt (...) Takes any number of arguments, and adds quoting. With `quote', only one level of quoting is added, effectively removing whitespace after commas and turning multiple arguments into a single string. With `dquote', two levels of quoting are added, one around each element, and one around the list. And with `dquote_elt', two levels of quoting are added around each element. An actual implementation of these three macros is distributed as `m4-1.4.14/examples/quote.m4' in this package. First, let's examine their usage: $ m4 -I examples include(`quote.m4') => -quote-dquote-dquote_elt- =>---- -quote()-dquote()-dquote_elt()- =>--`'-`'- -quote(`1')-dquote(`1')-dquote_elt(`1')- =>-1-`1'-`1'- -quote(`1', `2')-dquote(`1', `2')-dquote_elt(`1', `2')- =>-1,2-`1',`2'-`1',`2'- define(`n', `$#')dnl -n(quote(`1', `2'))-n(dquote(`1', `2'))-n(dquote_elt(`1', `2'))- =>-1-1-2- dquote(dquote_elt(`1', `2')) =>``1'',``2'' dquote_elt(dquote(`1', `2')) =>``1',`2'' The last two lines show that when given two arguments, `dquote' results in one string, while `dquote_elt' results in two. Now, examine the implementation. Note that `quote' and `dquote_elt' make decisions based on their number of arguments, so that when called without arguments, they result in nothing instead of a quoted empty string; this is so that it is possible to distinguish between no arguments and an empty first argument. `dquote', on the other hand, results in a string no matter what, since it is still possible to tell whether it was invoked without arguments based on the resulting string. $ m4 -I examples undivert(`quote.m4')dnl =>divert(`-1') =># quote(args) - convert args to single-quoted string =>define(`quote', `ifelse(`$#', `0', `', ``$*'')') =># dquote(args) - convert args to quoted list of quoted strings =>define(`dquote', ``$@'') =># dquote_elt(args) - convert args to list of double-quoted strings =>define(`dquote_elt', `ifelse(`$#', `0', `', `$#', `1', ```$1''', => ```$1'',$0(shift($@))')') =>divert`'dnl It is worth pointing out that `quote(ARGS)' is more efficient than `joinall(`,', ARGS)' for producing the same output. One more useful macro based on `shift' allows portably selecting an arbitrary argument (usually greater than the ninth argument), without relying on the GNU extension of multi-digit arguments (*note Arguments::). -- Composite: argn (N, ...) Expands to argument N out of the remaining arguments. N must be a positive number. Usually invoked as `argn(`N',$@)'. It is implemented as: define(`argn', `ifelse(`$1', 1, ``$2'', `argn(decr(`$1'), shift(shift($@)))')') => argn(`1', `a') =>a define(`foo', `argn(`11', $@)') => foo(`a', `b', `c', `d', `e', `f', `g', `h', `i', `j', `k', `l') =>k  File: m4.info, Node: Forloop, Next: Foreach, Prev: Shift, Up: Conditionals 6.4 Iteration by counting ========================= Here is an example of a loop macro that implements a simple for loop. -- Composite: forloop (ITERATOR, START, END, TEXT) Takes the name in ITERATOR, which must be a valid macro name, and successively assign it each integer value from START to END, inclusive. For each assignment to ITERATOR, append TEXT to the expansion of the `forloop'. TEXT may refer to ITERATOR. Any definition of ITERATOR prior to this invocation is restored. It can, for example, be used for simple counting: $ m4 -I examples include(`forloop.m4') => forloop(`i', `1', `8', `i ') =>1 2 3 4 5 6 7 8 For-loops can be nested, like: $ m4 -I examples include(`forloop.m4') => forloop(`i', `1', `4', `forloop(`j', `1', `8', ` (i, j)') ') => (1, 1) (1, 2) (1, 3) (1, 4) (1, 5) (1, 6) (1, 7) (1, 8) => (2, 1) (2, 2) (2, 3) (2, 4) (2, 5) (2, 6) (2, 7) (2, 8) => (3, 1) (3, 2) (3, 3) (3, 4) (3, 5) (3, 6) (3, 7) (3, 8) => (4, 1) (4, 2) (4, 3) (4, 4) (4, 5) (4, 6) (4, 7) (4, 8) => The implementation of the `forloop' macro is fairly straightforward. The `forloop' macro itself is simply a wrapper, which saves the previous definition of the first argument, calls the internal macro `_forloop', and re-establishes the saved definition of the first argument. The macro `_forloop' expands the fourth argument once, and tests to see if the iterator has reached the final value. If it has not finished, it increments the iterator (using the predefined macro `incr', *note Incr::), and recurses. Here is an actual implementation of `forloop', distributed as `m4-1.4.14/examples/forloop.m4' in this package: $ m4 -I examples undivert(`forloop.m4')dnl =>divert(`-1') =># forloop(var, from, to, stmt) - simple version =>define(`forloop', `pushdef(`$1', `$2')_forloop($@)popdef(`$1')') =>define(`_forloop', => `$4`'ifelse($1, `$3', `', `define(`$1', incr($1))$0($@)')') =>divert`'dnl Notice the careful use of quotes. Certain macro arguments are left unquoted, each for its own reason. Try to find out _why_ these arguments are left unquoted, and see what happens if they are quoted. (As presented, these two macros are useful but not very robust for general use. They lack even basic error handling for cases like START less than END, END not numeric, or ITERATOR not being a macro name. See if you can improve these macros; or *note Answers: Improved forloop.).  File: m4.info, Node: Foreach, Next: Stacks, Prev: Forloop, Up: Conditionals 6.5 Iteration by list contents ============================== Here is an example of a loop macro that implements list iteration. -- Composite: foreach (ITERATOR, PAREN-LIST, TEXT) -- Composite: foreachq (ITERATOR, QUOTE-LIST, TEXT) Takes the name in ITERATOR, which must be a valid macro name, and successively assign it each value from PAREN-LIST or QUOTE-LIST. In `foreach', PAREN-LIST is a comma-separated list of elements contained in parentheses. In `foreachq', QUOTE-LIST is a comma-separated list of elements contained in a quoted string. For each assignment to ITERATOR, append TEXT to the overall expansion. TEXT may refer to ITERATOR. Any definition of ITERATOR prior to this invocation is restored. As an example, this displays each word in a list inside of a sentence, using an implementation of `foreach' distributed as `m4-1.4.14/examples/foreach.m4', and `foreachq' in `m4-1.4.14/examples/foreachq.m4'. $ m4 -I examples include(`foreach.m4') => foreach(`x', (foo, bar, foobar), `Word was: x ')dnl =>Word was: foo =>Word was: bar =>Word was: foobar include(`foreachq.m4') => foreachq(`x', `foo, bar, foobar', `Word was: x ')dnl =>Word was: foo =>Word was: bar =>Word was: foobar It is possible to be more complex; each element of the PAREN-LIST or QUOTE-LIST can itself be a list, to pass as further arguments to a helper macro. This example generates a shell case statement: $ m4 -I examples include(`foreach.m4') => define(`_case', ` $1) $2=" $1";; ')dnl define(`_cat', `$1$2')dnl case $`'1 in =>case $1 in foreach(`x', `(`(`a', `vara')', `(`b', `varb')', `(`c', `varc')')', `_cat(`_case', x)')dnl => a) => vara=" a";; => b) => varb=" b";; => c) => varc=" c";; esac =>esac The implementation of the `foreach' macro is a bit more involved; it is a wrapper around two helper macros. First, `_arg1' is needed to grab the first element of a list. Second, `_foreach' implements the recursion, successively walking through the original list. Here is a simple implementation of `foreach': $ m4 -I examples undivert(`foreach.m4')dnl =>divert(`-1') =># foreach(x, (item_1, item_2, ..., item_n), stmt) =># parenthesized list, simple version =>define(`foreach', `pushdef(`$1')_foreach($@)popdef(`$1')') =>define(`_arg1', `$1') =>define(`_foreach', `ifelse(`$2', `()', `', => `define(`$1', _arg1$2)$3`'$0(`$1', (shift$2), `$3')')') =>divert`'dnl Unfortunately, that implementation is not robust to macro names as list elements. Each iteration of `_foreach' is stripping another layer of quotes, leading to erratic results if list elements are not already fully expanded. The first cut at implementing `foreachq' takes this into account. Also, when using quoted elements in a PAREN-LIST, the overall list must be quoted. A QUOTE-LIST has the nice property of requiring fewer characters to create a list containing the same quoted elements. To see the difference between the two macros, we attempt to pass double-quoted macro names in a list, expecting the macro name on output after one layer of quotes is removed during list iteration and the final layer removed during the final rescan: $ m4 -I examples define(`a', `1')define(`b', `2')define(`c', `3') => include(`foreach.m4') => include(`foreachq.m4') => foreach(`x', `(``a'', ``(b'', ``c)'')', `x ') =>1 =>(2)1 => =>, x =>) foreachq(`x', ```a'', ``(b'', ``c)''', `x ')dnl =>a =>(b =>c) Obviously, `foreachq' did a better job; here is its implementation: $ m4 -I examples undivert(`foreachq.m4')dnl =>include(`quote.m4')dnl =>divert(`-1') =># foreachq(x, `item_1, item_2, ..., item_n', stmt) =># quoted list, simple version =>define(`foreachq', `pushdef(`$1')_foreachq($@)popdef(`$1')') =>define(`_arg1', `$1') =>define(`_foreachq', `ifelse(quote($2), `', `', => `define(`$1', `_arg1($2)')$3`'$0(`$1', `shift($2)', `$3')')') =>divert`'dnl Notice that `_foreachq' had to use the helper macro `quote' defined earlier (*note Shift::), to ensure that the embedded `ifelse' call does not go haywire if a list element contains a comma. Unfortunately, this implementation of `foreachq' has its own severe flaw. Whereas the `foreach' implementation was linear, this macro is quadratic in the number of list elements, and is much more likely to trip up the limit set by the command line option `--nesting-limit' (or `-L', *note Invoking m4: Limits control.). Additionally, this implementation does not expand `defn(`ITERATOR')' very well, when compared with `foreach'. $ m4 -I examples include(`foreach.m4')include(`foreachq.m4') => foreach(`name', `(`a', `b')', ` defn(`name')') => a b foreachq(`name', ``a', `b'', ` defn(`name')') => _arg1(`a', `b') _arg1(shift(`a', `b')) It is possible to have robust iteration with linear behavior and sane ITERATOR contents for either list style. See if you can learn from the best elements of both of these implementations to create robust macros (or *note Answers: Improved foreach.).  File: m4.info, Node: Stacks, Next: Composition, Prev: Foreach, Up: Conditionals 6.6 Working with definition stacks ================================== Thanks to `pushdef', manipulation of a stack is an intrinsic operation in `m4'. Normally, only the topmost definition in a stack is important, but sometimes, it is desirable to manipulate the entire definition stack. -- Composite: stack_foreach (MACRO, ACTION) -- Composite: stack_foreach_lifo (MACRO, ACTION) For each of the `pushdef' definitions associated with MACRO, invoke the macro ACTION with a single argument of that definition. `stack_foreach' visits the oldest definition first, while `stack_foreach_lifo' visits the current definition first. ACTION should not modify or dereference MACRO. There are a few special macros, such as `defn', which cannot be used as the MACRO parameter. A sample implementation of these macros is distributed in the file `m4-1.4.14/examples/stack.m4'. $ m4 -I examples include(`stack.m4') => pushdef(`a', `1')pushdef(`a', `2')pushdef(`a', `3') => define(`show', ``$1' ') => stack_foreach(`a', `show')dnl =>1 =>2 =>3 stack_foreach_lifo(`a', `show')dnl =>3 =>2 =>1 Now for the implementation. Note the definition of a helper macro, `_stack_reverse', which destructively swaps the contents of one stack of definitions into the reverse order in the temporary macro `tmp-$1'. By calling the helper twice, the original order is restored back into the macro `$1'; since the operation is destructive, this explains why `$1' must not be modified or dereferenced during the traversal. The caller can then inject additional code to pass the definition currently being visited to `$2'. The choice of helper names is intentional; since `-' is not valid as part of a macro name, there is no risk of conflict with a valid macro name, and the code is guaranteed to use `defn' where necessary. Finally, note that any macro used in the traversal of a `pushdef' stack, such as `pushdef' or `defn', cannot be handled by `stack_foreach', since the macro would temporarily be undefined during the algorithm. $ m4 -I examples undivert(`stack.m4')dnl =>divert(`-1') =># stack_foreach(macro, action) =># Invoke ACTION with a single argument of each definition =># from the definition stack of MACRO, starting with the oldest. =>define(`stack_foreach', =>`_stack_reverse(`$1', `tmp-$1')'dnl =>`_stack_reverse(`tmp-$1', `$1', `$2(defn(`$1'))')') =># stack_foreach_lifo(macro, action) =># Invoke ACTION with a single argument of each definition =># from the definition stack of MACRO, starting with the newest. =>define(`stack_foreach_lifo', =>`_stack_reverse(`$1', `tmp-$1', `$2(defn(`$1'))')'dnl =>`_stack_reverse(`tmp-$1', `$1')') =>define(`_stack_reverse', =>`ifdef(`$1', `pushdef(`$2', defn(`$1'))$3`'popdef(`$1')$0($@)')') =>divert`'dnl  File: m4.info, Node: Composition, Prev: Stacks, Up: Conditionals 6.7 Building macros with macros =============================== Since m4 is a macro language, it is possible to write macros that can build other macros. First on the list is a way to automate the creation of blind macros. -- Composite: define_blind (NAME, [VALUE]) Defines NAME as a blind macro, such that NAME will expand to VALUE only when given explicit arguments. VALUE should not be the result of `defn' (*note Defn::). This macro is only recognized with parameters, and results in an empty string. Defining a macro to define another macro can be a bit tricky. We want to use a literal `$#' in the argument to the nested `define'. However, if `$' and `#' are adjacent in the definition of `define_blind', then it would be expanded as the number of arguments to `define_blind' rather than the intended number of arguments to NAME. The solution is to pass the difficult characters through extra arguments to a helper macro `_define_blind'. When composing macros, it is a common idiom to need a helper macro to concatenate text that forms parameters in the composed macro, rather than interpreting the text as a parameter of the composing macro. As for the limitation against using `defn', there are two reasons. If a macro was previously defined with `define_blind', then it can safely be renamed to a new blind macro using plain `define'; using `define_blind' to rename it just adds another layer of `ifelse', occupying memory and slowing down execution. And if a macro is a builtin, then it would result in an attempt to define a macro consisting of both text and a builtin token; this is not supported, and the builtin token is flattened to an empty string. With that explanation, here's the definition, and some sample usage. Notice that `define_blind' is itself a blind macro. $ m4 -d define(`define_blind', `ifelse(`$#', `0', ``$0'', `_$0(`$1', `$2', `$'`#', `$'`0')')') => define(`_define_blind', `define(`$1', `ifelse(`$3', `0', ``$4'', `$2')')') => define_blind =>define_blind define_blind(`foo', `arguments were $*') => foo =>foo foo(`bar') =>arguments were bar define(`blah', defn(`foo')) => blah =>blah blah(`a', `b') =>arguments were a,b defn(`blah') =>ifelse(`$#', `0', ``$0'', `arguments were $*') Another interesting composition tactic is argument "currying", or factoring a macro that takes multiple arguments for use in a context that provides exactly one argument. -- Composite: curry (MACRO, ...) Expand to a macro call that takes exactly one argument, then appends that argument to the original arguments and invokes MACRO with the resulting list of arguments. A demonstration of currying makes the intent of this macro a little more obvious. The macro `stack_foreach' mentioned earlier is an example of a context that provides exactly one argument to a macro name. But coupled with currying, we can invoke `reverse' with two arguments for each definition of a macro stack. This example uses the file `m4-1.4.14/examples/curry.m4' included in the distribution. $ m4 -I examples include(`curry.m4')include(`stack.m4') => define(`reverse', `ifelse(`$#', `0', , `$#', `1', ``$1'', `reverse(shift($@)), `$1'')') => pushdef(`a', `1')pushdef(`a', `2')pushdef(`a', `3') => stack_foreach(`a', `:curry(`reverse', `4')') =>:1, 4:2, 4:3, 4 curry(`curry', `reverse', `1')(`2')(`3') =>3, 2, 1 Now for the implementation. Notice how `curry' leaves off with a macro name but no open parenthesis, while still in the middle of collecting arguments for `$1'. The macro `_curry' is the helper macro that takes one argument, then adds it to the list and finally supplies the closing parenthesis. The use of a comma inside the `shift' call allows currying to also work for a macro that takes one argument, although it often makes more sense to invoke that macro directly rather than going through `curry'. $ m4 -I examples undivert(`curry.m4')dnl =>divert(`-1') =># curry(macro, args) =># Expand to a macro call that takes one argument, then invoke =># macro(args, extra). =>define(`curry', `$1(shift($@,)_$0') =>define(`_curry', ``$1')') =>divert`'dnl Unfortunately, with M4 1.4.x, `curry' is unable to handle builtin tokens, which are silently flattened to the empty string when passed through another text macro. This limitation will be lifted in a future release of M4. Putting the last few concepts together, it is possible to copy or rename an entire stack of macro definitions. -- Composite: copy (SOURCE, DEST) -- Composite: rename (SOURCE, DEST) Ensure that DEST is undefined, then define it to the same stack of definitions currently in SOURCE. `copy' leaves SOURCE unchanged, while `rename' undefines SOURCE. There are only a few macros, such as `copy' or `defn', which cannot be copied via this macro. The implementation is relatively straightforward (although since it uses `curry', it is unable to copy builtin macros, such as the second definition of `a' as a synonym for `divnum'. See if you can design a version that works around this limitation, or *note Answers: Improved copy.). $ m4 -I examples include(`curry.m4')include(`stack.m4') => define(`rename', `copy($@)undefine(`$1')')dnl define(`copy', `ifdef(`$2', `errprint(`$2 already defined ')m4exit(`1')', `stack_foreach(`$1', `curry(`pushdef', `$2')')')')dnl pushdef(`a', `1')pushdef(`a', defn(`divnum'))pushdef(`a', `2') => copy(`a', `b') => rename(`b', `c') => a b c =>2 b 2 popdef(`a', `c')c a => 0 popdef(`a', `c')a c =>1 1  File: m4.info, Node: Debugging, Next: Input Control, Prev: Conditionals, Up: Top 7 How to debug macros and input ******************************* When writing macros for `m4', they often do not work as intended on the first try (as is the case with most programming languages). Fortunately, there is support for macro debugging in `m4'. * Menu: * Dumpdef:: Displaying macro definitions * Trace:: Tracing macro calls * Debug Levels:: Controlling debugging output * Debug Output:: Saving debugging output  File: m4.info, Node: Dumpdef, Next: Trace, Up: Debugging 7.1 Displaying macro definitions ================================ If you want to see what a name expands into, you can use the builtin `dumpdef': -- Builtin: dumpdef ([NAMES...]) Accepts any number of arguments. If called without any arguments, it displays the definitions of all known names, otherwise it displays the definitions of the NAMES given. The output is printed to the current debug file (usually standard error), and is sorted by name. If an unknown name is encountered, a warning is printed. The expansion of `dumpdef' is void. $ m4 -d define(`foo', `Hello world.') => dumpdef(`foo') error-->foo: `Hello world.' => dumpdef(`define') error-->define: => The last example shows how builtin macros definitions are displayed. The definition that is dumped corresponds to what would occur if the macro were to be called at that point, even if other definitions are still live due to redefining a macro during argument collection. $ m4 -d pushdef(`f', ``$0'1')pushdef(`f', ``$0'2') => f(popdef(`f')dumpdef(`f')) error-->f: ``$0'1' =>f2 f(popdef(`f')dumpdef(`f')) error-->m4:stdin:3: undefined macro `f' =>f1 *Note Debug Levels::, for information on controlling the details of the display.  File: m4.info, Node: Trace, Next: Debug Levels, Prev: Dumpdef, Up: Debugging 7.2 Tracing macro calls ======================= It is possible to trace macro calls and expansions through the builtins `traceon' and `traceoff': -- Builtin: traceon ([NAMES...]) -- Builtin: traceoff ([NAMES...]) When called without any arguments, `traceon' and `traceoff' will turn tracing on and off, respectively, for all currently defined macros. When called with arguments, only the macros listed in NAMES are affected, whether or not they are currently defined. The expansion of `traceon' and `traceoff' is void. Whenever a traced macro is called and the arguments have been collected, the call is displayed. If the expansion of the macro call is not void, the expansion can be displayed after the call. The output is printed to the current debug file (defaulting to standard error, *note Debug Output::). $ m4 -d define(`foo', `Hello World.') => define(`echo', `$@') => traceon(`foo', `echo') => foo error-->m4trace: -1- foo -> `Hello World.' =>Hello World. echo(`gnus', `and gnats') error-->m4trace: -1- echo(`gnus', `and gnats') -> ``gnus',`and gnats'' =>gnus,and gnats The number between dashes is the depth of the expansion. It is one most of the time, signifying an expansion at the outermost level, but it increases when macro arguments contain unquoted macro calls. The maximum number that will appear between dashes is controlled by the option `--nesting-limit' (or `-L', *note Invoking m4: Limits control.). Additionally, the option `--trace' (or `-t') can be used to invoke `traceon(NAME)' before parsing input. $ m4 -L 3 -t ifelse ifelse(`one level') error-->m4trace: -1- ifelse => ifelse(ifelse(ifelse(`three levels'))) error-->m4trace: -3- ifelse error-->m4trace: -2- ifelse error-->m4trace: -1- ifelse => ifelse(ifelse(ifelse(ifelse(`four levels')))) error-->m4:stdin:3: recursion limit of 3 exceeded, use -L to change it Tracing by name is an attribute that is preserved whether the macro is defined or not. This allows the selection of macros to trace before those macros are defined. $ m4 -d traceoff(`foo') => traceon(`foo') => foo =>foo defn(`foo') => define(`foo', `bar') => foo error-->m4trace: -1- foo -> `bar' =>bar undefine(`foo') => ifdef(`foo', `yes', `no') =>no indir(`foo') error-->m4:stdin:9: undefined macro `foo' => define(`foo', `blah') => foo error-->m4trace: -1- foo -> `blah' =>blah traceoff => foo =>blah Tracing even works on builtins. However, `defn' (*note Defn::) does not transfer tracing status. $ m4 -d traceon(`traceon') => traceon(`traceoff') error-->m4trace: -1- traceon(`traceoff') => traceoff(`traceoff') error-->m4trace: -1- traceoff(`traceoff') => traceoff(`traceon') => traceon(`eval', `m4_divnum') => define(`m4_eval', defn(`eval')) => define(`m4_divnum', defn(`divnum')) => eval(divnum) error-->m4trace: -1- eval(`0') -> `0' =>0 m4_eval(m4_divnum) error-->m4trace: -2- m4_divnum -> `0' =>0 *Note Debug Levels::, for information on controlling the details of the display. The format of the trace output is not specified by POSIX, and varies between implementations of `m4'.  File: m4.info, Node: Debug Levels, Next: Debug Output, Prev: Trace, Up: Debugging 7.3 Controlling debugging output ================================ The `-d' option to `m4' (or `--debug', *note Invoking m4: Debugging options.) controls the amount of details presented in three categories of output. Trace output is requested by `traceon' (*note Trace::), and each line is prefixed by `m4trace:' in relation to a macro invocation. Debug output tracks useful events not associated with a macro invocation, and each line is prefixed by `m4debug:'. Finally, `dumpdef' (*note Dumpdef::) output is affected, with no prefix added to the output lines. The FLAGS following the option can be one or more of the following: `a' In trace output, show the actual arguments that were collected before invoking the macro. This applies to all macro calls if the `t' flag is used, otherwise only the macros covered by calls of `traceon'. Arguments are subject to length truncation specified by the command line option `--arglength' (or `-l'). `c' In trace output, show several trace lines for each macro call. A line is shown when the macro is seen, but before the arguments are collected; a second line when the arguments have been collected and a third line after the call has completed. `e' In trace output, show the expansion of each macro call, if it is not void. This applies to all macro calls if the `t' flag is used, otherwise only the macros covered by calls of `traceon'. The expansion is subject to length truncation specified by the command line option `--arglength' (or `-l'). `f' In debug and trace output, include the name of the current input file in the output line. `i' In debug output, print a message each time the current input file is changed. `l' In debug and trace output, include the current input line number in the output line. `p' In debug output, print a message when a named file is found through the path search mechanism (*note Search Path::), giving the actual file name used. `q' In trace and dumpdef output, quote actual arguments and macro expansions in the display with the current quotes. This is useful in connection with the `a' and `e' flags above. `t' In trace output, trace all macro calls made in this invocation of `m4', regardless of the settings of `traceon'. `x' In trace output, add a unique `macro call id' to each line of the trace output. This is useful in connection with the `c' flag above. `V' A shorthand for all of the above flags. If no flags are specified with the `-d' option, the default is `aeq'. The examples throughout this manual assume the default flags. There is a builtin macro `debugmode', which allows on-the-fly control of the debugging output format: -- Builtin: debugmode ([FLAGS]) The argument FLAGS should be a subset of the letters listed above. As special cases, if the argument starts with a `+', the flags are added to the current debug flags, and if it starts with a `-', they are removed. If no argument is present, all debugging flags are cleared (as if no `-d' was given), and with an empty argument the flags are reset to the default of `aeq'. The expansion of `debugmode' is void. $ m4 define(`foo', `FOO') => traceon(`foo') => debugmode() => foo error-->m4trace: -1- foo -> `FOO' =>FOO debugmode => foo error-->m4trace: -1- foo =>FOO debugmode(`+l') => foo error-->m4trace:8: -1- foo =>FOO The following example demonstrates the behavior of length truncation, when specified on the command line. Note that each argument and the final result are individually truncated. Also, the special tokens for builtin functions are not truncated. $ m4 -d -l 6 define(`echo', `$@')debugmode(`+t') => echo(`1', `long string') error-->m4trace: -1- echo(`1', `long s...') -> ``1',`l...' =>1,long string indir(`echo', defn(`changequote')) error-->m4trace: -2- defn(`change...') error-->m4trace: -1- indir(`echo', ) -> ``'' => This example shows the effects of the debug flags that are not related to macro tracing. $ m4 -dip -I examples error-->m4debug: input read from stdin include(`foo')dnl error-->m4debug: path search for `foo' found `examples/foo' error-->m4debug: input read from examples/foo =>bar error-->m4debug: input reverted to stdin, line 1 ^D error-->m4debug: input exhausted  File: m4.info, Node: Debug Output, Prev: Debug Levels, Up: Debugging 7.4 Saving debugging output =========================== Debug and tracing output can be redirected to files using either the `--debugfile' option to `m4' (*note Invoking m4: Debugging options.), or with the builtin macro `debugfile': -- Builtin: debugfile ([FILE]) Sends all further debug and trace output to FILE, opened in append mode. If FILE is the empty string, debug and trace output are discarded. If `debugfile' is called without any arguments, debug and trace output are sent to standard error. This does not affect warnings, error messages, or `errprint' output, which are always sent to standard error. If FILE cannot be opened, the current debug file is unchanged, and an error is issued. The expansion of `debugfile' is void. $ m4 -d traceon(`divnum') => divnum(`extra') error-->m4:stdin:2: Warning: excess arguments to builtin `divnum' ignored error-->m4trace: -1- divnum(`extra') -> `0' =>0 debugfile() => divnum(`extra') error-->m4:stdin:4: Warning: excess arguments to builtin `divnum' ignored =>0 debugfile => divnum error-->m4trace: -1- divnum -> `0' =>0  File: m4.info, Node: Input Control, Next: File Inclusion, Prev: Debugging, Up: Top 8 Input control *************** This chapter describes various builtin macros for controlling the input to `m4'. * Menu: * Dnl:: Deleting whitespace in input * Changequote:: Changing the quote characters * Changecom:: Changing the comment delimiters * Changeword:: Changing the lexical structure of words * M4wrap:: Saving text until end of input  File: m4.info, Node: Dnl, Next: Changequote, Up: Input Control 8.1 Deleting whitespace in input ================================ The builtin `dnl' stands for "Discard to Next Line": -- Builtin: dnl All characters, up to and including the next newline, are discarded without performing any macro expansion. A warning is issued if the end of the file is encountered without a newline. The expansion of `dnl' is void. It is often used in connection with `define', to remove the newline that follows the call to `define'. Thus define(`foo', `Macro `foo'.')dnl A very simple macro, indeed. foo =>Macro foo. The input up to and including the next newline is discarded, as opposed to the way comments are treated (*note Comments::). Usually, `dnl' is immediately followed by an end of line or some other whitespace. GNU `m4' will produce a warning diagnostic if `dnl' is followed by an open parenthesis. In this case, `dnl' will collect and process all arguments, looking for a matching close parenthesis. All predictable side effects resulting from this collection will take place. `dnl' will return no output. The input following the matching close parenthesis up to and including the next newline, on whatever line containing it, will still be discarded. dnl(`args are ignored, but side effects occur', define(`foo', `like this')) while this text is ignored: undefine(`foo') error-->m4:stdin:1: Warning: excess arguments to builtin `dnl' ignored See how `foo' was defined, foo? =>See how foo was defined, like this? If the end of file is encountered without a newline character, a warning is issued and dnl stops consuming input. m4wrap(`m4wrap(`2 hi ')0 hi dnl 1 hi') => define(`hi', `HI') => ^D error-->m4:stdin:1: Warning: end of file treated as newline =>0 HI 2 HI  File: m4.info, Node: Changequote, Next: Changecom, Prev: Dnl, Up: Input Control 8.2 Changing the quote characters ================================= The default quote delimiters can be changed with the builtin `changequote': -- Builtin: changequote ([START = ``'], [END = `'']) This sets START as the new begin-quote delimiter and END as the new end-quote delimiter. If both arguments are missing, the default quotes (``' and `'') are used. If START is void, then quoting is disabled. Otherwise, if END is missing or void, the default end-quote delimiter (`'') is used. The quote delimiters can be of any length. The expansion of `changequote' is void. changequote(`[', `]') => define([foo], [Macro [foo].]) => foo =>Macro foo. The quotation strings can safely contain eight-bit characters. If no single character is appropriate, START and END can be of any length. Other implementations cap the delimiter length to five characters, but GNU has no inherent limit. changequote(`[[[', `]]]') => define([[[foo]]], [[[Macro [[[[[foo]]]]].]]]) => foo =>Macro [[foo]]. Calling `changequote' with START as the empty string will effectively disable the quoting mechanism, leaving no way to quote text. However, using an empty string is not portable, as some other implementations of `m4' revert to the default quoting, while others preserve the prior non-empty delimiter. If START is not empty, then an empty END will use the default end-quote delimiter of `'', as otherwise, it would be impossible to end a quoted string. Again, this is not portable, as some other `m4' implementations reuse START as the end-quote delimiter, while others preserve the previous non-empty value. Omitting both arguments restores the default begin-quote and end-quote delimiters; fortunately this behavior is portable to all implementations of `m4'. define(`foo', `Macro `FOO'.') => changequote(`', `') => foo =>Macro `FOO'. `foo' =>`Macro `FOO'.' changequote(`,) => foo =>Macro FOO. There is no way in `m4' to quote a string containing an unmatched begin-quote, except using `changequote' to change the current quotes. If the quotes should be changed from, say, `[' to `[[', temporary quote characters have to be defined. To achieve this, two calls of `changequote' must be made, one for the temporary quotes and one for the new quotes. Macros are recognized in preference to the begin-quote string, so if a prefix of START can be recognized as part of a potential macro name, the quoting mechanism is effectively disabled. Unless you use `changeword' (*note Changeword::), this means that START should not begin with a letter, digit, or `_' (underscore). However, even though quoted strings are not recognized, the quote characters can still be discerned in macro expansion and in trace output. define(`echo', `$@') => define(`hi', `HI') => changequote(`q', `Q') => q hi Q hi =>q HI Q HI echo(hi) =>qHIQ changequote => changequote(`-', `EOF') => - hi EOF hi => hi HI changequote => changequote(`1', `2') => hi1hi2 =>hi1hi2 hi 1hi2 =>HI hi Quotes are recognized in preference to argument collection. In particular, if START is a single `(', then argument collection is effectively disabled. For portability with other implementations, it is a good idea to avoid `(', `,', and `)' as the first character in START. define(`echo', `$#:$@:') => define(`hi', `HI') => changequote(`(',`)') => echo(hi) =>0::hi changequote => changequote(`((', `))') => echo(hi) =>1:HI: echo((hi)) =>0::hi changequote => changequote(`,', `)') => echo(hi,hi)bye) =>1:HIhibye: However, if you are not worried about portability, using `(' and `)' as quoting characters has an interesting property--you can use it to compute a quoted string containing the expansion of any quoted text, as long as the expansion results in both balanced quotes and balanced parentheses. The trick is realizing `expand' uses `$1' unquoted, to trigger its expansion using the normal quoting characters, but uses extra parentheses to group unquoted commas that occur in the expansion without consuming whitespace following those commas. Then `_expand' uses `changequote' to convert the extra parentheses back into quoting characters. Note that it takes two more `changequote' invocations to restore the original quotes. Contrast the behavior on whitespace when using `$*', via `quote', to attempt the same task. changequote(`[', `]')dnl define([a], [1, (b)])dnl define([b], [2])dnl define([quote], [[$*]])dnl define([expand], [_$0(($1))])dnl define([_expand], [changequote([(], [)])$1changequote`'changequote(`[', `]')])dnl expand([a, a, [a, a], [[a, a]]]) =>1, (2), 1, (2), a, a, [a, a] quote(a, a, [a, a], [[a, a]]) =>1,(2),1,(2),a, a,[a, a] If END is a prefix of START, the end-quote will be recognized in preference to a nested begin-quote. In particular, changing the quotes to have the same string for START and END disables nesting of quotes. When quote nesting is disabled, it is impossible to double-quote strings across macro expansions, so using the same string is not done very often. define(`hi', `HI') => changequote(`""', `"') => ""hi"""hi" =>hihi ""hi" ""hi" =>hi hi ""hi"" "hi" =>hi" "HI" changequote => `hi`hi'hi' =>hi`hi'hi changequote(`"', `"') => "hi"hi"hi" =>hiHIhi It is an error if the end of file occurs within a quoted string. `hello world' =>hello world `dangling quote ^D error-->m4:stdin:2: ERROR: end of file in string ifelse(`dangling quote ^D error-->m4:stdin:1: ERROR: end of file in string  File: m4.info, Node: Changecom, Next: Changeword, Prev: Changequote, Up: Input Control 8.3 Changing the comment delimiters =================================== The default comment delimiters can be changed with the builtin macro `changecom': -- Builtin: changecom ([START], [END = `']) This sets START as the new begin-comment delimiter and END as the new end-comment delimiter. If both arguments are missing, or START is void, then comments are disabled. Otherwise, if END is missing or void, the default end-comment delimiter of newline is used. The comment delimiters can be of any length. The expansion of `changecom' is void. define(`comment', `COMMENT') => # A normal comment =># A normal comment changecom(`/*', `*/') => # Not a comment anymore =># Not a COMMENT anymore But: /* this is a comment now */ while this is not a comment =>But: /* this is a comment now */ while this is not a COMMENT Note how comments are copied to the output, much as if they were quoted strings. If you want the text inside a comment expanded, quote the begin-comment delimiter. Calling `changecom' without any arguments, or with START as the empty string, will effectively disable the commenting mechanism. To restore the original comment start of `#', you must explicitly ask for it. If START is not empty, then an empty END will use the default end-comment delimiter of newline, as otherwise, it would be impossible to end a comment. However, this is not portable, as some other `m4' implementations preserve the previous non-empty delimiters instead. define(`comment', `COMMENT') => changecom => # Not a comment anymore =># Not a COMMENT anymore changecom(`#', `') => # comment again =># comment again The comment strings can safely contain eight-bit characters. If no single character is appropriate, START and END can be of any length. Other implementations cap the delimiter length to five characters, but GNU has no inherent limit. Comments are recognized in preference to macros. However, this is not compatible with other implementations, where macros and even quoting takes precedence over comments, so it may change in a future release. For portability, this means that START should not begin with a letter, digit, or `_' (underscore), and that neither the start-quote nor the start-comment string should be a prefix of the other. define(`hi', `HI') => define(`hi1hi2', `hello') => changecom(`q', `Q') => q hi Q hi =>q hi Q HI changecom(`1', `2') => hi1hi2 =>hello hi 1hi2 =>HI 1hi2 Comments are recognized in preference to argument collection. In particular, if START is a single `(', then argument collection is effectively disabled. For portability with other implementations, it is a good idea to avoid `(', `,', and `)' as the first character in START. define(`echo', `$#:$*:$@:') => define(`hi', `HI') => changecom(`(',`)') => echo(hi) =>0:::(hi) changecom => changecom(`((', `))') => echo(hi) =>1:HI:HI: echo((hi)) =>0:::((hi)) changecom(`,', `)') => echo(hi,hi)bye) =>1:HI,hi)bye:HI,hi)bye: changecom => echo(hi,`,`'hi',hi) =>3:HI,,HI,HI:HI,,`'hi,HI: echo(hi,`,`'hi',hi`'changecom(`,,', `hi')) =>3:HI,,`'hi,HI:HI,,`'hi,HI: It is an error if the end of file occurs within a comment. changecom(`/*', `*/') => /*dangling comment ^D error-->m4:stdin:2: ERROR: end of file in comment  File: m4.info, Node: Changeword, Next: M4wrap, Prev: Changecom, Up: Input Control 8.4 Changing the lexical structure of words =========================================== The macro `changeword' and all associated functionality is experimental. It is only available if the `--enable-changeword' option was given to `configure', at GNU `m4' installation time. The functionality will go away in the future, to be replaced by other new features that are more efficient at providing the same capabilities. _Do not rely on it_. Please direct your comments about it the same way you would do for bugs. A file being processed by `m4' is split into quoted strings, words (potential macro names) and simple tokens (any other single character). Initially a word is defined by the following regular expression: [_a-zA-Z][_a-zA-Z0-9]* Using `changeword', you can change this regular expression: -- Optional builtin: changeword (REGEX) Changes the regular expression for recognizing macro names to be REGEX. If REGEX is empty, use `[_a-zA-Z][_a-zA-Z0-9]*'. REGEX must obey the constraint that every prefix of the desired final pattern is also accepted by the regular expression. If REGEX contains grouping parentheses, the macro invoked is the portion that matched the first group, rather than the entire matching string. The expansion of `changeword' is void. The macro `changeword' is recognized only with parameters. Relaxing the lexical rules of `m4' might be useful (for example) if you wanted to apply translations to a file of numbers: ifdef(`changeword', `', `errprint(` skipping: no changeword support ')m4exit(`77')')dnl changeword(`[_a-zA-Z0-9]+') => define(`1', `0')1 =>0 Tightening the lexical rules is less useful, because it will generally make some of the builtins unavailable. You could use it to prevent accidental call of builtins, for example: ifdef(`changeword', `', `errprint(` skipping: no changeword support ')m4exit(`77')')dnl define(`_indir', defn(`indir')) => changeword(`_[_a-zA-Z0-9]*') => esyscmd(`foo') =>esyscmd(foo) _indir(`esyscmd', `echo hi') =>hi => Because `m4' constructs its words a character at a time, there is a restriction on the regular expressions that may be passed to `changeword'. This is that if your regular expression accepts `foo', it must also accept `f' and `fo'. ifdef(`changeword', `', `errprint(` skipping: no changeword support ')m4exit(`77')')dnl define(`foo ', `bar ') => dnl This example wants to recognize changeword, dnl, and `foo\n'. dnl First, we check that our regexp will match. regexp(`changeword', `[cd][a-z]*\|foo[ ]') =>0 regexp(`foo ', `[cd][a-z]*\|foo[ ]') =>0 regexp(`f', `[cd][a-z]*\|foo[ ]') =>-1 foo =>foo changeword(`[cd][a-z]*\|foo[ ]') => dnl Even though `foo\n' matches, we forgot to allow `f'. foo =>foo changeword(`[cd][a-z]*\|fo*[ ]?') => dnl Now we can call `foo\n'. foo =>bar `changeword' has another function. If the regular expression supplied contains any grouped subexpressions, then text outside the first of these is discarded before symbol lookup. So: ifdef(`changeword', `', `errprint(` skipping: no changeword support ')m4exit(`77')')dnl ifdef(`__unix__', , `errprint(` skipping: syscmd does not have unix semantics ')m4exit(`77')')dnl changecom(`/*', `*/')dnl define(`foo', `bar')dnl changeword(`#\([_a-zA-Z0-9]*\)') => #esyscmd(`echo foo \#foo') =>foo bar => `m4' now requires a `#' mark at the beginning of every macro invocation, so one can use `m4' to preprocess plain text without losing various words like `divert'. In `m4', macro substitution is based on text, while in TeX, it is based on tokens. `changeword' can throw this difference into relief. For example, here is the same idea represented in TeX and `m4'. First, the TeX version: \def\a{\message{Hello}} \catcode`\@=0 \catcode`\\=12 @a @bye =>Hello Then, the `m4' version: ifdef(`changeword', `', `errprint(` skipping: no changeword support ')m4exit(`77')')dnl define(`a', `errprint(`Hello')')dnl changeword(`@\([_a-zA-Z0-9]*\)') => @a =>errprint(Hello) In the TeX example, the first line defines a macro `a' to print the message `Hello'. The second line defines <@> to be usable instead of <\> as an escape character. The third line defines <\> to be a normal printing character, not an escape. The fourth line invokes the macro `a'. So, when TeX is run on this file, it displays the message `Hello'. When the `m4' example is passed through `m4', it outputs `errprint(Hello)'. The reason for this is that TeX does lexical analysis of macro definition when the macro is _defined_. `m4' just stores the text, postponing the lexical analysis until the macro is _used_. You should note that using `changeword' will slow `m4' down by a factor of about seven, once it is changed to something other than the default regular expression. You can invoke `changeword' with the empty string to restore the default word definition, and regain the parsing speed.  File: m4.info, Node: M4wrap, Prev: Changeword, Up: Input Control 8.5 Saving text until end of input ================================== It is possible to `save' some text until the end of the normal input has been seen. Text can be saved, to be read again by `m4' when the normal input has been exhausted. This feature is normally used to initiate cleanup actions before normal exit, e.g., deleting temporary files. To save input text, use the builtin `m4wrap': -- Builtin: m4wrap (STRING, ...) Stores STRING in a safe place, to be reread when end of input is reached. As a GNU extension, additional arguments are concatenated with a space to the STRING. The expansion of `m4wrap' is void. The macro `m4wrap' is recognized only with parameters. define(`cleanup', `This is the `cleanup' action. ') => m4wrap(`cleanup') => This is the first and last normal input line. =>This is the first and last normal input line. ^D =>This is the cleanup action. The saved input is only reread when the end of normal input is seen, and not if `m4exit' is used to exit `m4'. It is safe to call `m4wrap' from saved text, but then the order in which the saved text is reread is undefined. If `m4wrap' is not used recursively, the saved pieces of text are reread in the opposite order in which they were saved (LIFO--last in, first out). However, this behavior is likely to change in a future release, to match POSIX, so you should not depend on this order. It is possible to emulate POSIX behavior even with older versions of GNU M4 by including the file `m4-1.4.14/examples/wrapfifo.m4' from the distribution: $ m4 -I examples undivert(`wrapfifo.m4')dnl =>dnl Redefine m4wrap to have FIFO semantics. =>define(`_m4wrap_level', `0')dnl =>define(`m4wrap', =>`ifdef(`m4wrap'_m4wrap_level, => `define(`m4wrap'_m4wrap_level, => defn(`m4wrap'_m4wrap_level)`$1')', => `builtin(`m4wrap', `define(`_m4wrap_level', => incr(_m4wrap_level))dnl =>m4wrap'_m4wrap_level)dnl =>define(`m4wrap'_m4wrap_level, `$1')')')dnl include(`wrapfifo.m4') => m4wrap(`a`'m4wrap(`c ', `d')')m4wrap(`b') => ^D =>abc It is likewise possible to emulate LIFO behavior without resorting to the GNU M4 extension of `builtin', by including the file `m4-1.4.14/examples/wraplifo.m4' from the distribution. (Unfortunately, both examples shown here share some subtle bugs. See if you can find and correct them; or *note Answers: Improved m4wrap.). $ m4 -I examples undivert(`wraplifo.m4')dnl =>dnl Redefine m4wrap to have LIFO semantics. =>define(`_m4wrap_level', `0')dnl =>define(`_m4wrap', defn(`m4wrap'))dnl =>define(`m4wrap', =>`ifdef(`m4wrap'_m4wrap_level, => `define(`m4wrap'_m4wrap_level, => `$1'defn(`m4wrap'_m4wrap_level))', => `_m4wrap(`define(`_m4wrap_level', incr(_m4wrap_level))dnl =>m4wrap'_m4wrap_level)dnl =>define(`m4wrap'_m4wrap_level, `$1')')')dnl include(`wraplifo.m4') => m4wrap(`a`'m4wrap(`c ', `d')')m4wrap(`b') => ^D =>bac Here is an example of implementing a factorial function using `m4wrap': define(`f', `ifelse(`$1', `0', `Answer: 0!=1 ', eval(`$1>1'), `0', `Answer: $2$1=eval(`$2$1') ', `m4wrap(`f(decr(`$1'), `$2$1*')')')') => f(`10') => ^D =>Answer: 10*9*8*7*6*5*4*3*2*1=3628800 Invocations of `m4wrap' at the same recursion level are concatenated and rescanned as usual: define(`aa', `AA ') => m4wrap(`a')m4wrap(`a') => ^D =>AA however, the transition between recursion levels behaves like an end of file condition between two input files. m4wrap(`m4wrap(`)')len(abc') => ^D error-->m4:stdin:1: ERROR: end of file in argument list  File: m4.info, Node: File Inclusion, Next: Diversions, Prev: Input Control, Up: Top 9 File inclusion **************** `m4' allows you to include named files at any point in the input. * Menu: * Include:: Including named files * Search Path:: Searching for include files  File: m4.info, Node: Include, Next: Search Path, Up: File Inclusion 9.1 Including named files ========================= There are two builtin macros in `m4' for including files: -- Builtin: include (FILE) -- Builtin: sinclude (FILE) Both macros cause the file named FILE to be read by `m4'. When the end of the file is reached, input is resumed from the previous input file. The expansion of `include' and `sinclude' is therefore the contents of FILE. If FILE does not exist, is a directory, or cannot otherwise be read, the expansion is void, and `include' will fail with an error while `sinclude' is silent. The empty string counts as a file that does not exist. The macros `include' and `sinclude' are recognized only with parameters. include(`none') error-->m4:stdin:1: cannot open `none': No such file or directory => include() error-->m4:stdin:2: cannot open `': No such file or directory => sinclude(`none') => sinclude() => The rest of this section assumes that `m4' is invoked with the `-I' option (*note Invoking m4: Preprocessor features.) pointing to the `m4-1.4.14/examples' directory shipped as part of the GNU `m4' package. The file `m4-1.4.14/examples/incl.m4' in the distribution contains the lines: $ cat examples/incl.m4 =>Include file start =>foo =>Include file end Normally file inclusion is used to insert the contents of a file into the input stream. The contents of the file will be read by `m4' and macro calls in the file will be expanded: $ m4 -I examples define(`foo', `FOO') => include(`incl.m4') =>Include file start =>FOO =>Include file end => The fact that `include' and `sinclude' expand to the contents of the file can be used to define macros that operate on entire files. Here is an example, which defines `bar' to expand to the contents of `incl.m4': $ m4 -I examples define(`bar', include(`incl.m4')) => This is `bar': >>bar<< =>This is bar: >>Include file start =>foo =>Include file end =><< This use of `include' is not trivial, though, as files can contain quotes, commas, and parentheses, which can interfere with the way the `m4' parser works. GNU `m4' seamlessly concatenates the file contents with the next character, even if the included file ended in the middle of a comment, string, or macro call. These conditions are only treated as end of file errors if specified as input files on the command line. In GNU `m4', an alternative method of reading files is using `undivert' (*note Undivert::) on a named file.  File: m4.info, Node: Search Path, Prev: Include, Up: File Inclusion 9.2 Searching for include files =============================== GNU `m4' allows included files to be found in other directories than the current working directory. If the `--prepend-include' or `-B' command-line option was provided (*note Invoking m4: Preprocessor features.), those directories are searched first, in reverse order that those options were listed on the command line. Then `m4' looks in the current working directory. Next comes the directories specified with the `--include' or `-I' option, in the order found on the command line. Finally, if the `M4PATH' environment variable is set, it is expected to contain a colon-separated list of directories, which will be searched in order. If the automatic search for include-files causes trouble, the `p' debug flag (*note Debug Levels::) can help isolate the problem.  File: m4.info, Node: Diversions, Next: Text handling, Prev: File Inclusion, Up: Top 10 Diverting and undiverting output *********************************** Diversions are a way of temporarily saving output. The output of `m4' can at any time be diverted to a temporary file, and be reinserted into the output stream, "undiverted", again at a later time. Numbered diversions are counted from 0 upwards, diversion number 0 being the normal output stream. GNU `m4' tries to keep diversions in memory. However, there is a limit to the overall memory usable by all diversions taken together (512K, currently). When this maximum is about to be exceeded, a temporary file is opened to receive the contents of the biggest diversion still in memory, freeing this memory for other diversions. When creating the temporary file, `m4' honors the value of the environment variable `TMPDIR', and falls back to `/tmp'. Thus, the amount of available disk space provides the only real limit on the number and aggregate size of diversions. Diversions make it possible to generate output in a different order than the input was read. It is possible to implement topological sorting dependencies. For example, GNU Autoconf makes use of diversions under the hood to ensure that the expansion of a prerequisite macro appears in the output prior to the expansion of a dependent macro, regardless of which order the two macros were invoked in the user's input file. * Menu: * Divert:: Diverting output * Undivert:: Undiverting output * Divnum:: Diversion numbers * Cleardivert:: Discarding diverted text  File: m4.info, Node: Divert, Next: Undivert, Up: Diversions 10.1 Diverting output ===================== Output is diverted using `divert': -- Builtin: divert ([NUMBER = `0']) The current diversion is changed to NUMBER. If NUMBER is left out or empty, it is assumed to be zero. If NUMBER cannot be parsed, the diversion is unchanged. The expansion of `divert' is void. When all the `m4' input will have been processed, all existing diversions are automatically undiverted, in numerical order. divert(`1') This text is diverted. divert => This text is not diverted. =>This text is not diverted. ^D => =>This text is diverted. Several calls of `divert' with the same argument do not overwrite the previous diverted text, but append to it. Diversions are printed after any wrapped text is expanded. define(`text', `TEXT') => divert(`1')`diverted text.' divert => m4wrap(`Wrapped text precedes ') => ^D =>Wrapped TEXT precedes diverted text. If output is diverted to a negative diversion, it is simply discarded. This can be used to suppress unwanted output. A common example of unwanted output is the trailing newlines after macro definitions. Here is a common programming idiom in `m4' for avoiding them. divert(`-1') define(`foo', `Macro `foo'.') define(`bar', `Macro `bar'.') divert => Traditional implementations only supported ten diversions. But as a GNU extension, diversion numbers can be as large as positive integers will allow, rather than treating a multi-digit diversion number as a request to discard text. divert(eval(`1<<28'))world divert(`2')hello ^D =>hello =>world Note that `divert' is an English word, but also an active macro without arguments. When processing plain text, the word might appear in normal text and be unintentionally swallowed as a macro invocation. One way to avoid this is to use the `-P' option to rename all builtins (*note Invoking m4: Operation modes.). Another is to write a wrapper that requires a parameter to be recognized. We decided to divert the stream for irrigation. =>We decided to the stream for irrigation. define(`divert', `ifelse(`$#', `0', ``$0'', `builtin(`$0', $@)')') => divert(`-1') Ignored text. divert(`0') => We decided to divert the stream for irrigation. =>We decided to divert the stream for irrigation.  File: m4.info, Node: Undivert, Next: Divnum, Prev: Divert, Up: Diversions 10.2 Undiverting output ======================= Diverted text can be undiverted explicitly using the builtin `undivert': -- Builtin: undivert ([DIVERSIONS...]) Undiverts the numeric DIVERSIONS given by the arguments, in the order given. If no arguments are supplied, all diversions are undiverted, in numerical order. As a GNU extension, DIVERSIONS may contain non-numeric strings, which are treated as the names of files to copy into the output without expansion. A warning is issued if a file could not be opened. The expansion of `undivert' is void. divert(`1') This text is diverted. divert => This text is not diverted. =>This text is not diverted. undivert(`1') => =>This text is diverted. => Notice the last two blank lines. One of them comes from the newline following `undivert', the other from the newline that followed the `divert'! A diversion often starts with a blank line like this. When diverted text is undiverted, it is _not_ reread by `m4', but rather copied directly to the current output, and it is therefore not an error to undivert into a diversion. Undiverting the empty string is the same as specifying diversion 0; in either case nothing happens since the output has already been flushed. divert(`1')diverted text divert => undivert() => undivert(`0') => undivert =>diverted text => divert(`1')more divert(`2')undivert(`1')diverted text`'divert => undivert(`1') => undivert(`2') =>more =>diverted text When a diversion has been undiverted, the diverted text is discarded, and it is not possible to bring back diverted text more than once. divert(`1') This text is diverted first. divert(`0')undivert(`1')dnl => =>This text is diverted first. undivert(`1') => divert(`1') This text is also diverted but not appended. divert(`0')undivert(`1')dnl => =>This text is also diverted but not appended. Attempts to undivert the current diversion are silently ignored. Thus, when the current diversion is not 0, the current diversion does not get rearranged among the other diversions. divert(`1')one divert(`2')two divert(`3')three divert(`2')undivert`'dnl divert`'undivert`'dnl =>two =>one =>three GNU `m4' allows named files to be undiverted. Given a non-numeric argument, the contents of the file named will be copied, uninterpreted, to the current output. This complements the builtin `include' (*note Include::). To illustrate the difference, assume the file `foo' contains: $ cat foo bar then define(`bar', `BAR') => undivert(`foo') =>bar => include(`foo') =>BAR => If the file is not found (or cannot be read), an error message is issued, and the expansion is void. It is possible to intermix files and diversion numbers. divert(`1')diversion one divert(`2')undivert(`foo')dnl divert(`3')diversion three divert`'dnl undivert(`1', `2', `foo', `3')dnl =>diversion one =>bar =>bar =>diversion three  File: m4.info, Node: Divnum, Next: Cleardivert, Prev: Undivert, Up: Diversions 10.3 Diversion numbers ====================== The current diversion is tracked by the builtin `divnum': -- Builtin: divnum Expands to the number of the current diversion. Initial divnum =>Initial 0 divert(`1') Diversion one: divnum divert(`2') Diversion two: divnum ^D => =>Diversion one: 1 => =>Diversion two: 2  File: m4.info, Node: Cleardivert, Prev: Divnum, Up: Diversions 10.4 Discarding diverted text ============================= Often it is not known, when output is diverted, whether the diverted text is actually needed. Since all non-empty diversion are brought back on the main output stream when the end of input is seen, a method of discarding a diversion is needed. If all diversions should be discarded, the easiest is to end the input to `m4' with `divert(`-1')' followed by an explicit `undivert': divert(`1') Diversion one: divnum divert(`2') Diversion two: divnum divert(`-1') undivert ^D No output is produced at all. Clearing selected diversions can be done with the following macro: -- Composite: cleardivert ([DIVERSIONS...]) Discard the contents of each of the listed numeric DIVERSIONS. define(`cleardivert', `pushdef(`_n', divnum)divert(`-1')undivert($@)divert(_n)popdef(`_n')') => It is called just like `undivert', but the effect is to clear the diversions, given by the arguments. (This macro has a nasty bug! You should try to see if you can find it and correct it; or *note Answers: Improved cleardivert.).  File: m4.info, Node: Text handling, Next: Arithmetic, Prev: Diversions, Up: Top 11 Macros for text handling *************************** There are a number of builtins in `m4' for manipulating text in various ways, extracting substrings, searching, substituting, and so on. * Menu: * Len:: Calculating length of strings * Index macro:: Searching for substrings * Regexp:: Searching for regular expressions * Substr:: Extracting substrings * Translit:: Translating characters * Patsubst:: Substituting text by regular expression * Format:: Formatting strings (printf-like)  File: m4.info, Node: Len, Next: Index macro, Up: Text handling 11.1 Calculating length of strings ================================== The length of a string can be calculated by `len': -- Builtin: len (STRING) Expands to the length of STRING, as a decimal number. The macro `len' is recognized only with parameters. len() =>0 len(`abcdef') =>6  File: m4.info, Node: Index macro, Next: Regexp, Prev: Len, Up: Text handling 11.2 Searching for substrings ============================= Searching for substrings is done with `index': -- Builtin: index (STRING, SUBSTRING) Expands to the index of the first occurrence of SUBSTRING in STRING. The first character in STRING has index 0. If SUBSTRING does not occur in STRING, `index' expands to `-1'. The macro `index' is recognized only with parameters. index(`gnus, gnats, and armadillos', `nat') =>7 index(`gnus, gnats, and armadillos', `dag') =>-1 Omitting SUBSTRING evokes a warning, but still produces output; contrast this with an empty SUBSTRING. index(`abc') error-->m4:stdin:1: Warning: too few arguments to builtin `index' =>0 index(`abc', `') =>0 index(`abc', `b') =>1  File: m4.info, Node: Regexp, Next: Substr, Prev: Index macro, Up: Text handling 11.3 Searching for regular expressions ====================================== Searching for regular expressions is done with the builtin `regexp': -- Builtin: regexp (STRING, REGEXP, [REPLACEMENT]) Searches for REGEXP in STRING. The syntax for regular expressions is the same as in GNU Emacs, which is similar to BRE (Basic Regular Expressions) in POSIX. *Note Syntax of Regular Expressions: (emacs)Regexps. Support for ERE (Extended Regular Expressions) is not available, but will be added in GNU M4 2.0. If REPLACEMENT is omitted, `regexp' expands to the index of the first match of REGEXP in STRING. If REGEXP does not match anywhere in STRING, it expands to -1. If REPLACEMENT is supplied, and there was a match, `regexp' changes the expansion to this argument, with `\N' substituted by the text matched by the Nth parenthesized sub-expression of REGEXP, up to nine sub-expressions. The escape `\&' is replaced by the text of the entire regular expression matched. For all other characters, `\' treats the next character literally. A warning is issued if there were fewer sub-expressions than the `\N' requested, or if there is a trailing `\'. If there was no match, `regexp' expands to the empty string. The macro `regexp' is recognized only with parameters. regexp(`GNUs not Unix', `\<[a-z]\w+') =>5 regexp(`GNUs not Unix', `\-1 regexp(`GNUs not Unix', `\w\(\w+\)$', `*** \& *** \1 ***') =>*** Unix *** nix *** regexp(`GNUs not Unix', `\ Here are some more examples on the handling of backslash: regexp(`abc', `\(b\)', `\\\10\a') =>\b0a regexp(`abc', `b', `\1\') error-->m4:stdin:2: Warning: sub-expression 1 not present error-->m4:stdin:2: Warning: trailing \ ignored in replacement => regexp(`abc', `\(\(d\)?\)\(c\)', `\1\2\3\4\5\6') error-->m4:stdin:3: Warning: sub-expression 4 not present error-->m4:stdin:3: Warning: sub-expression 5 not present error-->m4:stdin:3: Warning: sub-expression 6 not present =>c Omitting REGEXP evokes a warning, but still produces output; contrast this with an empty REGEXP argument. regexp(`abc') error-->m4:stdin:1: Warning: too few arguments to builtin `regexp' =>0 regexp(`abc', `') =>0 regexp(`abc', `', `\\def') =>\def  File: m4.info, Node: Substr, Next: Translit, Prev: Regexp, Up: Text handling 11.4 Extracting substrings ========================== Substrings are extracted with `substr': -- Builtin: substr (STRING, FROM, [LENGTH]) Expands to the substring of STRING, which starts at index FROM, and extends for LENGTH characters, or to the end of STRING, if LENGTH is omitted. The starting index of a string is always 0. The expansion is empty if there is an error parsing FROM or LENGTH, if FROM is beyond the end of STRING, or if LENGTH is negative. The macro `substr' is recognized only with parameters. substr(`gnus, gnats, and armadillos', `6') =>gnats, and armadillos substr(`gnus, gnats, and armadillos', `6', `5') =>gnats Omitting FROM evokes a warning, but still produces output. substr(`abc') error-->m4:stdin:1: Warning: too few arguments to builtin `substr' =>abc substr(`abc',) error-->m4:stdin:2: empty string treated as 0 in builtin `substr' =>abc  File: m4.info, Node: Translit, Next: Patsubst, Prev: Substr, Up: Text handling 11.5 Translating characters =========================== Character translation is done with `translit': -- Builtin: translit (STRING, CHARS, [REPLACEMENT]) Expands to STRING, with each character that occurs in CHARS translated into the character from REPLACEMENT with the same index. If REPLACEMENT is shorter than CHARS, the excess characters of CHARS are deleted from the expansion; if CHARS is shorter, the excess characters in REPLACEMENT are silently ignored. If REPLACEMENT is omitted, all characters in STRING that are present in CHARS are deleted from the expansion. If a character appears more than once in CHARS, only the first instance is used in making the translation. Only a single translation pass is made, even if characters in REPLACEMENT also appear in CHARS. As a GNU extension, both CHARS and REPLACEMENT can contain character-ranges, e.g., `a-z' (meaning all lowercase letters) or `0-9' (meaning all digits). To include a dash `-' in CHARS or REPLACEMENT, place it first or last in the entire string, or as the last character of a range. Back-to-back ranges can share a common endpoint. It is not an error for the last character in the range to be `larger' than the first. In that case, the range runs backwards, i.e., `9-0' means the string `9876543210'. The expansion of a range is dependent on the underlying encoding of characters, so using ranges is not always portable between machines. The macro `translit' is recognized only with parameters. translit(`GNUs not Unix', `A-Z') =>s not nix translit(`GNUs not Unix', `a-z', `A-Z') =>GNUS NOT UNIX translit(`GNUs not Unix', `A-Z', `z-a') =>tmfs not fnix translit(`+,-12345', `+--1-5', `<;>a-c-a') =><;>abcba translit(`abcdef', `aabdef', `bcged') =>bgced In the ASCII encoding, the first example deletes all uppercase letters, the second converts lowercase to uppercase, and the third `mirrors' all uppercase letters, while converting them to lowercase. The two first cases are by far the most common, even though they are not portable to EBCDIC or other encodings. The fourth example shows a range ending in `-', as well as back-to-back ranges. The final example shows that `a' is mapped to `b', not `c'; the resulting `b' is not further remapped to `g'; the `d' and `e' are swapped, and the `f' is discarded. Omitting CHARS evokes a warning, but still produces output. translit(`abc') error-->m4:stdin:1: Warning: too few arguments to builtin `translit' =>abc  File: m4.info, Node: Patsubst, Next: Format, Prev: Translit, Up: Text handling 11.6 Substituting text by regular expression ============================================ Global substitution in a string is done by `patsubst': -- Builtin: patsubst (STRING, REGEXP, [REPLACEMENT]) Searches STRING for matches of REGEXP, and substitutes REPLACEMENT for each match. The syntax for regular expressions is the same as in GNU Emacs (*note Regexp::). The parts of STRING that are not covered by any match of REGEXP are copied to the expansion. Whenever a match is found, the search proceeds from the end of the match, so a character from STRING will never be substituted twice. If REGEXP matches a string of zero length, the start position for the search is incremented, to avoid infinite loops. When a replacement is to be made, REPLACEMENT is inserted into the expansion, with `\N' substituted by the text matched by the Nth parenthesized sub-expression of PATSUBST, for up to nine sub-expressions. The escape `\&' is replaced by the text of the entire regular expression matched. For all other characters, `\' treats the next character literally. A warning is issued if there were fewer sub-expressions than the `\N' requested, or if there is a trailing `\'. The REPLACEMENT argument can be omitted, in which case the text matched by REGEXP is deleted. The macro `patsubst' is recognized only with parameters. patsubst(`GNUs not Unix', `^', `OBS: ') =>OBS: GNUs not Unix patsubst(`GNUs not Unix', `\<', `OBS: ') =>OBS: GNUs OBS: not OBS: Unix patsubst(`GNUs not Unix', `\w*', `(\&)') =>(GNUs)() (not)() (Unix)() patsubst(`GNUs not Unix', `\w+', `(\&)') =>(GNUs) (not) (Unix) patsubst(`GNUs not Unix', `[A-Z][a-z]+') =>GN not patsubst(`GNUs not Unix', `not', `NOT\') error-->m4:stdin:6: Warning: trailing \ ignored in replacement =>GNUs NOT Unix Here is a slightly more realistic example, which capitalizes individual words or whole sentences, by substituting calls of the macros `upcase' and `downcase' into the strings. -- Composite: upcase (TEXT) -- Composite: downcase (TEXT) -- Composite: capitalize (TEXT) Expand to TEXT, but with capitalization changed: `upcase' changes all letters to upper case, `downcase' changes all letters to lower case, and `capitalize' changes the first character of each word to upper case and the remaining characters to lower case. First, an example of their usage, using implementations distributed in `m4-1.4.14/examples/capitalize.m4'. $ m4 -I examples include(`capitalize.m4') => upcase(`GNUs not Unix') =>GNUS NOT UNIX downcase(`GNUs not Unix') =>gnus not unix capitalize(`GNUs not Unix') =>Gnus Not Unix Now for the implementation. There is a helper macro `_capitalize' which puts only its first word in mixed case. Then `capitalize' merely parses out the words, and replaces them with an invocation of `_capitalize'. (As presented here, the `capitalize' macro has some subtle flaws. You should try to see if you can find and correct them; or *note Answers: Improved capitalize.). $ m4 -I examples undivert(`capitalize.m4')dnl =>divert(`-1') =># upcase(text) =># downcase(text) =># capitalize(text) =># change case of text, simple version =>define(`upcase', `translit(`$*', `a-z', `A-Z')') =>define(`downcase', `translit(`$*', `A-Z', `a-z')') =>define(`_capitalize', => `regexp(`$1', `^\(\w\)\(\w*\)', => `upcase(`\1')`'downcase(`\2')')') =>define(`capitalize', `patsubst(`$1', `\w+', `_$0(`\&')')') =>divert`'dnl While `regexp' replaces the whole input with the replacement as soon as there is a match, `patsubst' replaces each _occurrence_ of a match and preserves non-matching pieces: define(`patreg', `patsubst($@) regexp($@)')dnl patreg(`bar foo baz Foo', `foo\|Foo', `FOO') =>bar FOO baz FOO =>FOO patreg(`aba abb 121', `\(.\)\(.\)\1', `\2\1\2') =>bab abb 212 =>bab Omitting REGEXP evokes a warning, but still produces output; contrast this with an empty REGEXP argument. patsubst(`abc') error-->m4:stdin:1: Warning: too few arguments to builtin `patsubst' =>abc patsubst(`abc', `') =>abc patsubst(`abc', `', `\\-') =>\-a\-b\-c\-  File: m4.info, Node: Format, Prev: Patsubst, Up: Text handling 11.7 Formatting strings (printf-like) ===================================== Formatted output can be made with `format': -- Builtin: format (FORMAT-STRING, ...) Works much like the C function `printf'. The first argument FORMAT-STRING can contain `%' specifications which are satisfied by additional arguments, and the expansion of `format' is the formatted string. The macro `format' is recognized only with parameters. Its use is best described by a few examples: define(`foo', `The brown fox jumped over the lazy dog') => format(`The string "%s" uses %d characters', foo, len(foo)) =>The string "The brown fox jumped over the lazy dog" uses 38 characters format(`%*.*d', `-1', `-1', `1') =>1 format(`%.0f', `56789.9876') =>56790 len(format(`%-*X', `5000', `1')) =>5000 ifelse(format(`%010F', `infinity'), ` INF', `success', format(`%010F', `infinity'), ` INFINITY', `success', format(`%010F', `infinity')) =>success ifelse(format(`%.1A', `1.999'), `0X1.0P+1', `success', format(`%.1A', `1.999'), `0X2.0P+0', `success', format(`%.1A', `1.999')) =>success format(`%g', `0xa.P+1') =>20 Using the `forloop' macro defined earlier (*note Forloop::), this example shows how `format' can be used to produce tabular output. $ m4 -I examples include(`forloop.m4') => forloop(`i', `1', `10', `format(`%6d squared is %10d ', i, eval(i**2))') => 1 squared is 1 => 2 squared is 4 => 3 squared is 9 => 4 squared is 16 => 5 squared is 25 => 6 squared is 36 => 7 squared is 49 => 8 squared is 64 => 9 squared is 81 => 10 squared is 100 => The builtin `format' is modeled after the ANSI C `printf' function, and supports these `%' specifiers: `c', `s', `d', `o', `x', `X', `u', `a', `A', `e', `E', `f', `F', `g', `G', and `%'; it supports field widths and precisions, and the flags `+', `-', ` ', `0', `#', and `''. For integer specifiers, the width modifiers `hh', `h', and `l' are recognized, and for floating point specifiers, the width modifier `l' is recognized. Items not yet supported include positional arguments, the `n', `p', `S', and `C' specifiers, the `z', `t', `j', `L' and `ll' modifiers, and any platform extensions available in the native `printf'. For more details on the functioning of `printf', see the C Library Manual, or the POSIX specification (for example, `%a' is supported even on platforms that haven't yet implemented C99 hexadecimal floating point output natively). Unrecognized specifiers result in a warning. It is anticipated that a future release of GNU `m4' will support more specifiers, and give better warnings when various problems such as overflow are encountered. Likewise, escape sequences are not yet recognized. format(`%p', `0') error-->m4:stdin:1: Warning: unrecognized specifier in `%p' =>  File: m4.info, Node: Arithmetic, Next: Shell commands, Prev: Text handling, Up: Top 12 Macros for doing arithmetic ****************************** Integer arithmetic is included in `m4', with a C-like syntax. As convenient shorthands, there are builtins for simple increment and decrement operations. * Menu: * Incr:: Decrement and increment operators * Eval:: Evaluating integer expressions  File: m4.info, Node: Incr, Next: Eval, Up: Arithmetic 12.1 Decrement and increment operators ====================================== Increment and decrement of integers are supported using the builtins `incr' and `decr': -- Builtin: incr (NUMBER) -- Builtin: decr (NUMBER) Expand to the numerical value of NUMBER, incremented or decremented, respectively, by one. Except for the empty string, the expansion is empty if NUMBER could not be parsed. The macros `incr' and `decr' are recognized only with parameters. incr(`4') =>5 decr(`7') =>6 incr() error-->m4:stdin:3: empty string treated as 0 in builtin `incr' =>1 decr() error-->m4:stdin:4: empty string treated as 0 in builtin `decr' =>-1  File: m4.info, Node: Eval, Prev: Incr, Up: Arithmetic 12.2 Evaluating integer expressions =================================== Integer expressions are evaluated with `eval': -- Builtin: eval (EXPRESSION, [RADIX = `10'], [WIDTH]) Expands to the value of EXPRESSION. The expansion is empty if a problem is encountered while parsing the arguments. If specified, RADIX and WIDTH control the format of the output. Calculations are done with 32-bit signed numbers. Overflow silently results in wraparound. A warning is issued if division by zero is attempted, or if EXPRESSION could not be parsed. Expressions can contain the following operators, listed in order of decreasing precedence. `()' Parentheses `+ - ~ !' Unary plus and minus, and bitwise and logical negation `**' Exponentiation `* / %' Multiplication, division, and modulo `+ -' Addition and subtraction `<< >>' Shift left or right `> >= < <=' Relational operators `== !=' Equality operators `&' Bitwise and `^' Bitwise exclusive-or `|' Bitwise or `&&' Logical and `||' Logical or The macro `eval' is recognized only with parameters. All binary operators, except exponentiation, are left associative. C operators that perform variable assignment, such as `+=' or `--', are not implemented, since `eval' only operates on constants, not variables. Attempting to use them results in an error. However, since traditional implementations treated `=' as an undocumented alias for `==' as opposed to an assignment operator, this usage is supported as a special case. Be aware that a future version of GNU M4 may support assignment semantics as an extension when POSIX mode is not requested, and that using `=' to check equality is not portable. eval(`2 = 2') error-->m4:stdin:1: Warning: recommend ==, not =, for equality operator =>1 eval(`++0') error-->m4:stdin:2: invalid operator in eval: ++0 => eval(`0 |= 1') error-->m4:stdin:3: invalid operator in eval: 0 |= 1 => Note that some older `m4' implementations use `^' as an alternate operator for the exponentiation, although POSIX requires the C behavior of bitwise exclusive-or. The precedence of the negation operators, `~' and `!', was traditionally lower than equality. The unary operators could not be used reliably more than once on the same term without intervening parentheses. The traditional precedence of the equality operators `==' and `!=' was identical instead of lower than the relational operators such as `<', even through GNU M4 1.4.8. Starting with version 1.4.9, GNU M4 correctly follows POSIX precedence rules. M4 scripts designed to be portable between releases must be aware that parentheses may be required to enforce C precedence rules. Likewise, division by zero, even in the unused branch of a short-circuiting operator, is not always well-defined in other implementations. Following are some examples where the current version of M4 follows C precedence rules, but where older versions and some other implementations of `m4' require explicit parentheses to get the correct result: eval(`1 == 2 > 0') =>1 eval(`(1 == 2) > 0') =>0 eval(`! 0 * 2') =>2 eval(`! (0 * 2)') =>1 eval(`1 | 1 ^ 1') =>1 eval(`(1 | 1) ^ 1') =>0 eval(`+ + - ~ ! ~ 0') =>1 eval(`2 || 1 / 0') =>1 eval(`0 || 1 / 0') error-->m4:stdin:9: divide by zero in eval: 0 || 1 / 0 => eval(`0 && 1 % 0') =>0 eval(`2 && 1 % 0') error-->m4:stdin:11: modulo by zero in eval: 2 && 1 % 0 => As a GNU extension, the operator `**' performs integral exponentiation. The operator is right-associative, and if evaluated, the exponent must be non-negative, and at least one of the arguments must be non-zero, or a warning is issued. eval(`2 ** 3 ** 2') =>512 eval(`(2 ** 3) ** 2') =>64 eval(`0 ** 1') =>0 eval(`2 ** 0') =>1 eval(`0 ** 0') => error-->m4:stdin:5: divide by zero in eval: 0 ** 0 eval(`4 ** -2') error-->m4:stdin:6: negative exponent in eval: 4 ** -2 => Within EXPRESSION, (but not RADIX or WIDTH), numbers without a special prefix are decimal. A simple `0' prefix introduces an octal number. `0x' introduces a hexadecimal number. As GNU extensions, `0b' introduces a binary number. `0r' introduces a number expressed in any radix between 1 and 36: the prefix should be immediately followed by the decimal expression of the radix, a colon, then the digits making the number. For radix 1, leading zeros are ignored, and all remaining digits must be `1'; for all other radices, the digits are `0', `1', `2', .... Beyond `9', the digits are `a', `b' ... up to `z'. Lower and upper case letters can be used interchangeably in numbers prefixes and as number digits. Parentheses may be used to group subexpressions whenever needed. For the relational operators, a true relation returns `1', and a false relation return `0'. Here are a few examples of use of `eval'. eval(`-3 * 5') =>-15 eval(`-99 / 10') =>-9 eval(`-99 % 10') =>-9 eval(`99 % -10') =>9 eval(index(`Hello world', `llo') >= 0) =>1 eval(`0r1:0111 + 0b100 + 0r3:12') =>12 define(`square', `eval(`($1) ** 2')') => square(`9') =>81 square(square(`5')` + 1') =>676 define(`foo', `666') => eval(`foo / 6') error-->m4:stdin:11: bad expression in eval: foo / 6 => eval(foo / 6) =>111 As the last two lines show, `eval' does not handle macro names, even if they expand to a valid expression (or part of a valid expression). Therefore all macros must be expanded before they are passed to `eval'. Some calculations are not portable to other implementations, since they have undefined semantics in C, but GNU `m4' has well-defined behavior on overflow. When shifting, an out-of-range shift amount is implicitly brought into the range of 32-bit signed integers using an implicit bit-wise and with 0x1f). define(`max_int', eval(`0x7fffffff')) => define(`min_int', incr(max_int)) => eval(min_int` < 0') =>1 eval(max_int` > 0') =>1 ifelse(eval(min_int` / -1'), min_int, `overflow occurred') =>overflow occurred min_int =>-2147483648 eval(`0x80000000 % -1') =>0 eval(`-4 >> 1') =>-2 eval(`-4 >> 33') =>-2 If RADIX is specified, it specifies the radix to be used in the expansion. The default radix is 10; this is also the case if RADIX is the empty string. A warning results if the radix is outside the range of 1 through 36, inclusive. The result of `eval' is always taken to be signed. No radix prefix is output, and for radices greater than 10, the digits are lower case. The WIDTH argument specifies the minimum output width, excluding any negative sign. The result is zero-padded to extend the expansion to the requested width. A warning results if the width is negative. If RADIX or WIDTH is out of bounds, the expansion of `eval' is empty. eval(`666', `10') =>666 eval(`666', `11') =>556 eval(`666', `6') =>3030 eval(`666', `6', `10') =>0000003030 eval(`-666', `6', `10') =>-0000003030 eval(`10', `', `0') =>10 `0r1:'eval(`10', `1', `11') =>0r1:01111111111 eval(`10', `16') =>a eval(`1', `37') error-->m4:stdin:9: radix 37 in builtin `eval' out of range => eval(`1', , `-1') error-->m4:stdin:10: negative width to builtin `eval' => eval() error-->m4:stdin:11: empty string treated as 0 in builtin `eval' =>0  File: m4.info, Node: Shell commands, Next: Miscellaneous, Prev: Arithmetic, Up: Top 13 Macros for running shell commands ************************************ There are a few builtin macros in `m4' that allow you to run shell commands from within `m4'. Note that the definition of a valid shell command is system dependent. On UNIX systems, this is the typical `/bin/sh'. But on other systems, such as native Windows, the shell has a different syntax of commands that it understands. Some examples in this chapter assume `/bin/sh', and also demonstrate how to quit early with a known exit value if this is not the case. * Menu: * Platform macros:: Determining the platform * Syscmd:: Executing simple commands * Esyscmd:: Reading the output of commands * Sysval:: Exit status * Mkstemp:: Making temporary files  File: m4.info, Node: Platform macros, Next: Syscmd, Up: Shell commands 13.1 Determining the platform ============================= Sometimes it is desirable for an input file to know which platform `m4' is running on. GNU `m4' provides several macros that are predefined to expand to the empty string; checking for their existence will confirm platform details. -- Optional builtin: __gnu__ -- Optional builtin: __os2__ -- Optional builtin: os2 -- Optional builtin: __unix__ -- Optional builtin: unix -- Optional builtin: __windows__ -- Optional builtin: windows Each of these macros is conditionally defined as needed to describe the environment of `m4'. If defined, each macro expands to the empty string. For now, these macros silently ignore all arguments, but in a future release of M4, they might warn if arguments are present. When GNU extensions are in effect (that is, when you did not use the `-G' option, *note Invoking m4: Limits control.), GNU `m4' will define the macro `__gnu__' to expand to the empty string. $ m4 __gnu__ => __gnu__(`ignored') => Extensions are ifdef(`__gnu__', `active', `inactive') =>Extensions are active $ m4 -G __gnu__ =>__gnu__ __gnu__(`ignored') =>__gnu__(ignored) Extensions are ifdef(`__gnu__', `active', `inactive') =>Extensions are inactive On UNIX systems, GNU `m4' will define `__unix__' by default, or `unix' when the `-G' option is specified. On native Windows systems, GNU `m4' will define `__windows__' by default, or `windows' when the `-G' option is specified. On OS/2 systems, GNU `m4' will define `__os2__' by default, or `os2' when the `-G' option is specified. If GNU `m4' does not provide a platform macro for your system, please report that as a bug. define(`provided', `0') => ifdef(`__unix__', `define(`provided', incr(provided))') => ifdef(`__windows__', `define(`provided', incr(provided))') => ifdef(`__os2__', `define(`provided', incr(provided))') => provided =>1  File: m4.info, Node: Syscmd, Next: Esyscmd, Prev: Platform macros, Up: Shell commands 13.2 Executing simple commands ============================== Any shell command can be executed, using `syscmd': -- Builtin: syscmd (SHELL-COMMAND) Executes SHELL-COMMAND as a shell command. The expansion of `syscmd' is void, _not_ the output from SHELL-COMMAND! Output or error messages from SHELL-COMMAND are not read by `m4'. *Note Esyscmd::, if you need to process the command output. Prior to executing the command, `m4' flushes its buffers. The default standard input, output and error of SHELL-COMMAND are the same as those of `m4'. By default, the SHELL-COMMAND will be used as the argument to the `-c' option of the `/bin/sh' shell (or the version of `sh' specified by `command -p getconf PATH', if your system supports that). If you prefer a different shell, the `configure' script can be given the option `--with-syscmd-shell=LOCATION' to set the location of an alternative shell at GNU `m4' installation; the alternative shell must still support `-c'. The macro `syscmd' is recognized only with parameters. define(`foo', `FOO') => syscmd(`echo foo') =>foo => Note how the expansion of `syscmd' keeps the trailing newline of the command, as well as using the newline that appeared after the macro. The following is an example of SHELL-COMMAND using the same standard input as `m4': $ echo "m4wrap(\`syscmd(\`cat')')" | m4 => It tells `m4' to read all of its input before executing the wrapped text, then hand a valid (albeit emptied) pipe as standard input for the `cat' subcommand. Therefore, you should be careful when using standard input (either by specifying no files, or by passing `-' as a file name on the command line, *note Invoking m4: Command line files.), and also invoking subcommands via `syscmd' or `esyscmd' that consume data from standard input. When standard input is a seekable file, the subprocess will pick up with the next character not yet processed by `m4'; when it is a pipe or other non-seekable file, there is no guarantee how much data will already be buffered by `m4' and thus unavailable to the child.  File: m4.info, Node: Esyscmd, Next: Sysval, Prev: Syscmd, Up: Shell commands 13.3 Reading the output of commands =================================== If you want `m4' to read the output of a shell command, use `esyscmd': -- Builtin: esyscmd (SHELL-COMMAND) Expands to the standard output of the shell command SHELL-COMMAND. Prior to executing the command, `m4' flushes its buffers. The default standard input and standard error of SHELL-COMMAND are the same as those of `m4'. The error output of SHELL-COMMAND is not a part of the expansion: it will appear along with the error output of `m4'. By default, the SHELL-COMMAND will be used as the argument to the `-c' option of the `/bin/sh' shell (or the version of `sh' specified by `command -p getconf PATH', if your system supports that). If you prefer a different shell, the `configure' script can be given the option `--with-syscmd-shell=LOCATION' to set the location of an alternative shell at GNU `m4' installation; the alternative shell must still support `-c'. The macro `esyscmd' is recognized only with parameters. define(`foo', `FOO') => esyscmd(`echo foo') =>FOO => Note how the expansion of `esyscmd' keeps the trailing newline of the command, as well as using the newline that appeared after the macro. Just as with `syscmd', care must be exercised when sharing standard input between `m4' and the child process of `esyscmd'.  File: m4.info, Node: Sysval, Next: Mkstemp, Prev: Esyscmd, Up: Shell commands 13.4 Exit status ================ To see whether a shell command succeeded, use `sysval': -- Builtin: sysval Expands to the exit status of the last shell command run with `syscmd' or `esyscmd'. Expands to 0 if no command has been run yet. sysval =>0 syscmd(`false') => ifelse(sysval, `0', `zero', `non-zero') =>non-zero syscmd(`exit 2') => sysval =>2 syscmd(`true') => sysval =>0 esyscmd(`false') => ifelse(sysval, `0', `zero', `non-zero') =>non-zero esyscmd(`echo dnl && exit 127') => sysval =>127 esyscmd(`true') => sysval =>0 `sysval' results in 127 if there was a problem executing the command, for example, if the system-imposed argument length is exceeded, or if there were not enough resources to fork. It is not possible to distinguish between failed execution and successful execution that had an exit status of 127, unless there was output from the child process. On UNIX platforms, where it is possible to detect when command execution is terminated by a signal, rather than a normal exit, the result is the signal number shifted left by eight bits. dnl This test assumes kill is a shell builtin, and that signals are dnl recognizable. ifdef(`__unix__', , `errprint(` skipping: syscmd does not have unix semantics ')m4exit(`77')')dnl syscmd(`kill -9 $$') => sysval =>2304 syscmd() => sysval =>0 esyscmd(`kill -9 $$') => sysval =>2304  File: m4.info, Node: Mkstemp, Prev: Sysval, Up: Shell commands 13.5 Making temporary files =========================== Commands specified to `syscmd' or `esyscmd' might need a temporary file, for output or for some other purpose. There is a builtin macro, `mkstemp', for making a temporary file: -- Builtin: mkstemp (TEMPLATE) -- Builtin: maketemp (TEMPLATE) Expands to the quoted name of a new, empty file, made from the string TEMPLATE, which should end with the string `XXXXXX'. The six `X' characters are then replaced with random characters matching the regular expression `[a-zA-Z0-9._-]', in order to make the file name unique. If fewer than six `X' characters are found at the end of `template', the result will be longer than the template. The created file will have access permissions as if by `chmod =rw,go=', meaning that the current umask of the `m4' process is taken into account, and at most only the current user can read and write the file. The traditional behavior, standardized by POSIX, is that `maketemp' merely replaces the trailing `X' with the process id, without creating a file or quoting the expansion, and without ensuring that the resulting string is a unique file name. In part, this means that using the same TEMPLATE twice in the same input file will result in the same expansion. This behavior is a security hole, as it is very easy for another process to guess the name that will be generated, and thus interfere with a subsequent use of `syscmd' trying to manipulate that file name. Hence, POSIX has recommended that all new implementations of `m4' provide the secure `mkstemp' builtin, and that users of `m4' check for its existence. The expansion is void and an error issued if a temporary file could not be created. The macros `mkstemp' and `maketemp' are recognized only with parameters. If you try this next example, you will most likely get different output for the two file names, since the replacement characters are randomly chosen: $ m4 define(`tmp', `oops') => maketemp(`/tmp/fooXXXXXX') =>/tmp/fooa07346 ifdef(`mkstemp', `define(`maketemp', defn(`mkstemp'))', `define(`mkstemp', defn(`maketemp'))dnl errprint(`warning: potentially insecure maketemp implementation ')') => mkstemp(`doc') =>docQv83Uw Unless you use the `--traditional' command line option (or `-G', *note Invoking m4: Limits control.), the GNU version of `maketemp' is secure. This means that using the same template to multiple calls will generate multiple files. However, we recommend that you use the new `mkstemp' macro, introduced in GNU M4 1.4.8, which is secure even in traditional mode. Also, as of M4 1.4.11, the secure implementation quotes the resulting file name, so that you are guaranteed to know what file was created even if the random file name happens to match an existing macro. Notice that this example is careful to use `defn' to avoid unintended expansion of `foo'. $ m4 define(`foo', `errprint(`oops')') => syscmd(`rm -f foo-??????')sysval =>0 define(`file1', maketemp(`foo-XXXXXX'))dnl ifelse(esyscmd(`echo \` foo-?????? \''), ` foo-?????? ', `no file', `created') =>created define(`file2', maketemp(`foo-XX'))dnl define(`file3', mkstemp(`foo-XXXXXX'))dnl ifelse(len(defn(`file1')), len(defn(`file2')), `same length', `different') =>same length ifelse(defn(`file1'), defn(`file2'), `same', `different file') =>different file ifelse(defn(`file2'), defn(`file3'), `same', `different file') =>different file ifelse(defn(`file1'), defn(`file3'), `same', `different file') =>different file syscmd(`rm 'defn(`file1') defn(`file2') defn(`file3')) => sysval =>0  File: m4.info, Node: Miscellaneous, Next: Frozen files, Prev: Shell commands, Up: Top 14 Miscellaneous builtin macros ******************************* This chapter describes various builtins, that do not really belong in any of the previous chapters. * Menu: * Errprint:: Printing error messages * Location:: Printing current location * M4exit:: Exiting from `m4'  File: m4.info, Node: Errprint, Next: Location, Up: Miscellaneous 14.1 Printing error messages ============================ You can print error messages using `errprint': -- Builtin: errprint (MESSAGE, ...) Prints MESSAGE and the rest of the arguments to standard error, separated by spaces. Standard error is used, regardless of the `--debugfile' option (*note Invoking m4: Debugging options.). The expansion of `errprint' is void. The macro `errprint' is recognized only with parameters. errprint(`Invalid arguments to forloop ') error-->Invalid arguments to forloop => errprint(`1')errprint(`2',`3 ') error-->12 3 => A trailing newline is _not_ printed automatically, so it should be supplied as part of the argument, as in the example. Unfortunately, the exact output of `errprint' is not very portable to other `m4' implementations: POSIX requires that all arguments be printed, but some implementations of `m4' only print the first. Furthermore, some BSD implementations always append a newline for each `errprint' call, regardless of whether the last argument already had one, and POSIX is silent on whether this is acceptable.  File: m4.info, Node: Location, Next: M4exit, Prev: Errprint, Up: Miscellaneous 14.2 Printing current location ============================== To make it possible to specify the location of an error, three utility builtins exist: -- Builtin: __file__ -- Builtin: __line__ -- Builtin: __program__ Expand to the quoted name of the current input file, the current input line number in that file, and the quoted name of the current invocation of `m4'. errprint(__program__:__file__:__line__: `input error ') error-->m4:stdin:1: input error => Line numbers start at 1 for each file. If the file was found due to the `-I' option or `M4PATH' environment variable, that is reflected in the file name. The syncline option (`-s', *note Invoking m4: Preprocessor features.), and the `f' and `l' flags of `debugmode' (*note Debug Levels::), also use this notion of current file and line. Redefining the three location macros has no effect on syncline, debug, warning, or error message output. This example reuses the file `incl.m4' mentioned earlier (*note Include::): $ m4 -I examples define(`foo', ``$0' called at __file__:__line__') => foo =>foo called at stdin:2 include(`incl.m4') =>Include file start =>foo called at examples/incl.m4:2 =>Include file end => The location of macros invoked during the rescanning of macro expansion text corresponds to the location in the file where the expansion was triggered, regardless of how many newline characters the expansion text contains. As of GNU M4 1.4.8, the location of text wrapped with `m4wrap' (*note M4wrap::) is the point at which the `m4wrap' was invoked. Previous versions, however, behaved as though wrapped text came from line 0 of the file "". define(`echo', `$@') => define(`foo', `echo(__line__ __line__)') => echo(__line__ __line__) =>4 =>5 m4wrap(`foo ') => foo(errprint(__line__ __line__ )) error-->8 error-->9 =>8 =>8 __line__ =>11 m4wrap(`__line__ ') => ^D =>12 =>6 =>6 The `__program__' macro behaves like `$0' in shell terminology. If you invoke `m4' through an absolute path or a link with a different spelling, rather than by relying on a `PATH' search for plain `m4', it will affect how `__program__' expands. The intent is that you can use it to produce error messages with the same formatting that `m4' produces internally. It can also be used within `syscmd' (*note Syscmd::) to pick the same version of `m4' that is currently running, rather than whatever version of `m4' happens to be first in `PATH'. It was first introduced in GNU M4 1.4.6.  File: m4.info, Node: M4exit, Prev: Location, Up: Miscellaneous 14.3 Exiting from `m4' ====================== If you need to exit from `m4' before the entire input has been read, you can use `m4exit': -- Builtin: m4exit ([CODE = `0']) Causes `m4' to exit, with exit status CODE. If CODE is left out, the exit status is zero. If CODE cannot be parsed, or is outside the range of 0 to 255, the exit status is one. No further input is read, and all wrapped and diverted text is discarded. m4wrap(`This text is lost due to `m4exit'.') => divert(`1') So is this. divert => m4exit And this is never read. A common use of this is to abort processing: -- Composite: fatal_error (MESSAGE) Abort processing with an error message and non-zero status. Prefix MESSAGE with details about where the error occurred, and print the resulting string to standard error. define(`fatal_error', `errprint(__program__:__file__:__line__`: fatal error: $* ')m4exit(`1')') => fatal_error(`this is a BAD one, buster') error-->m4:stdin:4: fatal error: this is a BAD one, buster After this macro call, `m4' will exit with exit status 1. This macro is only intended for error exits, since the normal exit procedures are not followed, i.e., diverted text is not undiverted, and saved text (*note M4wrap::) is not reread. (This macro could be made more robust to earlier versions of `m4'. You should try to see if you can find weaknesses and correct them; or *note Answers: Improved fatal_error.). Note that it is still possible for the exit status to be different than what was requested by `m4exit'. If `m4' detects some other error, such as a write error on standard output, the exit status will be non-zero even if `m4exit' requested zero. If standard input is seekable, then the file will be positioned at the next unread character. If it is a pipe or other non-seekable file, then there are no guarantees how much data `m4' might have read into buffers, and thus discarded.  File: m4.info, Node: Frozen files, Next: Compatibility, Prev: Miscellaneous, Up: Top 15 Fast loading of frozen state ******************************* Some bigger `m4' applications may be built over a common base containing hundreds of definitions and other costly initializations. Usually, the common base is kept in one or more declarative files, which files are listed on each `m4' invocation prior to the user's input file, or else each input file uses `include'. Reading the common base of a big application, over and over again, may be time consuming. GNU `m4' offers some machinery to speed up the start of an application using lengthy common bases. * Menu: * Using frozen files:: Using frozen files * Frozen file format:: Frozen file format  File: m4.info, Node: Using frozen files, Next: Frozen file format, Up: Frozen files 15.1 Using frozen files ======================= Suppose a user has a library of `m4' initializations in `base.m4', which is then used with multiple input files: $ m4 base.m4 input1.m4 $ m4 base.m4 input2.m4 $ m4 base.m4 input3.m4 Rather than spending time parsing the fixed contents of `base.m4' every time, the user might rather execute: $ m4 -F base.m4f base.m4 once, and further execute, as often as needed: $ m4 -R base.m4f input1.m4 $ m4 -R base.m4f input2.m4 $ m4 -R base.m4f input3.m4 with the varying input. The first call, containing the `-F' option, only reads and executes file `base.m4', defining various application macros and computing other initializations. Once the input file `base.m4' has been completely processed, GNU `m4' produces in `base.m4f' a "frozen" file, that is, a file which contains a kind of snapshot of the `m4' internal state. Later calls, containing the `-R' option, are able to reload the internal state of `m4', from `base.m4f', _prior_ to reading any other input files. This means instead of starting with a virgin copy of `m4', input will be read after having effectively recovered the effect of a prior run. In our example, the effect is the same as if file `base.m4' has been read anew. However, this effect is achieved a lot faster. Only one frozen file may be created or read in any one `m4' invocation. It is not possible to recover two frozen files at once. However, frozen files may be updated incrementally, through using `-R' and `-F' options simultaneously. For example, if some care is taken, the command: $ m4 file1.m4 file2.m4 file3.m4 file4.m4 could be broken down in the following sequence, accumulating the same output: $ m4 -F file1.m4f file1.m4 $ m4 -R file1.m4f -F file2.m4f file2.m4 $ m4 -R file2.m4f -F file3.m4f file3.m4 $ m4 -R file3.m4f file4.m4 Some care is necessary because not every effort has been made for this to work in all cases. In particular, the trace attribute of macros is not handled, nor the current setting of `changeword'. Currently, `m4wrap' and `sysval' also have problems. Also, interactions for some options of `m4', being used in one call and not in the next, have not been fully analyzed yet. On the other end, you may be confident that stacks of `pushdef' definitions are handled correctly, as well as undefined or renamed builtins, and changed strings for quotes or comments. And future releases of GNU M4 will improve on the utility of frozen files. When an `m4' run is to be frozen, the automatic undiversion which takes place at end of execution is inhibited. Instead, all positively numbered diversions are saved into the frozen file. The active diversion number is also transmitted. A frozen file to be reloaded need not reside in the current directory. It is looked up the same way as an `include' file (*note Search Path::). If the frozen file was generated with a newer version of `m4', and contains directives that an older `m4' cannot parse, attempting to load the frozen file with option `-R' will cause `m4' to exit with status 63 to indicate version mismatch.  File: m4.info, Node: Frozen file format, Prev: Using frozen files, Up: Frozen files 15.2 Frozen file format ======================= Frozen files are sharable across architectures. It is safe to write a frozen file on one machine and read it on another, given that the second machine uses the same or newer version of GNU `m4'. It is conventional, but not required, to give a frozen file the suffix of `.m4f'. These are simple (editable) text files, made up of directives, each starting with a capital letter and ending with a newline (). Wherever a directive is expected, the character `#' introduces a comment line; empty lines are also ignored if they are not part of an embedded string. In the following descriptions, each LEN refers to the length of the corresponding strings STR in the next line of input. Numbers are always expressed in decimal. There are no escape characters. The directives are: `C LEN1 , LEN2 STR1 STR2 ' Uses STR1 and STR2 as the begin-comment and end-comment strings. If omitted, then `#' and are the comment delimiters. `D NUMBER, LEN STR ' Selects diversion NUMBER, making it current, then copy STR in the current diversion. NUMBER may be a negative number for a non-existing diversion. To merely specify an active selection, use this command with an empty STR. With 0 as the diversion NUMBER, STR will be issued on standard output at reload time. GNU `m4' will not produce the `D' directive with non-zero length for diversion 0, but this can be done with manual edits. This directive may appear more than once for the same diversion, in which case the diversion is the concatenation of the various uses. If omitted, then diversion 0 is current. `F LEN1 , LEN2 STR1 STR2 ' Defines, through `pushdef', a definition for STR1 expanding to the function whose builtin name is STR2. If the builtin does not exist (for example, if the frozen file was produced by a copy of `m4' compiled with changeword support, but the version of `m4' reloading was compiled without it), the reload is silent, but any subsequent use of the definition of STR1 will result in a warning. This directive may appear more than once for the same name, and its order, along with `T', is important. If omitted, you will have no access to any builtins. `Q LEN1 , LEN2 STR1 STR2 ' Uses STR1 and STR2 as the begin-quote and end-quote strings. If omitted, then ``' and `'' are the quote delimiters. `T LEN1 , LEN2 STR1 STR2 ' Defines, though `pushdef', a definition for STR1 expanding to the text given by STR2. This directive may appear more than once for the same name, and its order, along with `F', is important. `V NUMBER ' Confirms the format of the file. `m4' 1.4.14 only creates and understands frozen files where NUMBER is 1. This directive must be the first non-comment in the file, and may not appear more than once.  File: m4.info, Node: Compatibility, Next: Answers, Prev: Frozen files, Up: Top 16 Compatibility with other versions of `m4' ******************************************** This chapter describes the many of the differences between this implementation of `m4', and of other implementations found under UNIX, such as System V Release 3, Solaris, and BSD flavors. In particular, it lists the known differences and extensions to POSIX. However, the list is not necessarily comprehensive. At the time of this writing, POSIX 2001 (also known as IEEE Std 1003.1-2001) is the latest standard, although a new version of POSIX is under development and includes several proposals for modifying what `m4' is required to do. The requirements for `m4' are shared between SUSv3 and POSIX, and can be viewed at `http://www.opengroup.org/onlinepubs/000095399/utilities/m4.html'. * Menu: * Extensions:: Extensions in GNU M4 * Incompatibilities:: Facilities in System V m4 not in GNU M4 * Other Incompatibilities:: Other incompatibilities  File: m4.info, Node: Extensions, Next: Incompatibilities, Up: Compatibility 16.1 Extensions in GNU M4 ========================= This version of `m4' contains a few facilities that do not exist in System V `m4'. These extra facilities are all suppressed by using the `-G' command line option (*note Invoking m4: Limits control.), unless overridden by other command line options. * In the `$N' notation for macro arguments, N can contain several digits, while the System V `m4' only accepts one digit. This allows macros in GNU `m4' to take any number of arguments, and not only nine (*note Arguments::). This means that `define(`foo', `$11')' is ambiguous between implementations. To portably choose between grabbing the first parameter and appending 1 to the expansion, or grabbing the eleventh parameter, you can do the following: define(`a1', `A1') => dnl First argument, concatenated with 1 define(`_1', `$1')define(`first1', `_1($@)1') => dnl Eleventh argument, portable define(`_9', `$9')define(`eleventh', `_9(shift(shift($@)))') => dnl Eleventh argument, GNU style define(`Eleventh', `$11') => first1(`a', `b', `c', `d', `e', `f', `g', `h', `i', `j', `k') =>A1 eleventh(`a', `b', `c', `d', `e', `f', `g', `h', `i', `j', `k') =>k Eleventh(`a', `b', `c', `d', `e', `f', `g', `h', `i', `j', `k') =>k Also see the `argn' macro (*note Shift::). * The `divert' (*note Divert::) macro can manage more than 9 diversions. GNU `m4' treats all positive numbers as valid diversions, rather than discarding diversions greater than 9. * Files included with `include' and `sinclude' are sought in a user specified search path, if they are not found in the working directory. The search path is specified by the `-I' option and the `M4PATH' environment variable (*note Search Path::). * Arguments to `undivert' can be non-numeric, in which case the named file will be included uninterpreted in the output (*note Undivert::). * Formatted output is supported through the `format' builtin, which is modeled after the C library function `printf' (*note Format::). * Searches and text substitution through basic regular expressions are supported by the `regexp' (*note Regexp::) and `patsubst' (*note Patsubst::) builtins. Some BSD implementations use extended regular expressions instead. * The output of shell commands can be read into `m4' with `esyscmd' (*note Esyscmd::). * There is indirect access to any builtin macro with `builtin' (*note Builtin::). * Macros can be called indirectly through `indir' (*note Indir::). * The name of the program, the current input file, and the current input line number are accessible through the builtins `__program__', `__file__', and `__line__' (*note Location::). * The format of the output from `dumpdef' and macro tracing can be controlled with `debugmode' (*note Debug Levels::). * The destination of trace and debug output can be controlled with `debugfile' (*note Debug Output::). * The `maketemp' (*note Mkstemp::) macro behaves like `mkstemp', creating a new file with a unique name on every invocation, rather than following the insecure behavior of replacing the trailing `X' characters with the `m4' process id. * POSIX only requires support for the command line options `-s', `-D', and `-U', so all other options accepted by GNU M4 are extensions. *Note Invoking m4::, for a description of these options. The debugging and tracing facilities in GNU `m4' are much more extensive than in most other versions of `m4'.  File: m4.info, Node: Incompatibilities, Next: Other Incompatibilities, Prev: Extensions, Up: Compatibility 16.2 Facilities in System V `m4' not in GNU `m4' ================================================ The version of `m4' from System V contains a few facilities that have not been implemented in GNU `m4' yet. Additionally, POSIX requires some behaviors that GNU `m4' has not implemented yet. Relying on these behaviors is non-portable, as a future release of GNU `m4' may change. * POSIX requires support for multiple arguments to `defn', without any clarification on how `defn' behaves when one of the multiple arguments names a builtin. System V `m4' and some other implementations allow mixing builtins and text macros into a single macro. GNU `m4' only supports joining multiple text arguments, although a future implementation may lift this restriction to behave more like System V. The only portable way to join text macros with builtins is via helper macros and implicit concatenation of macro results. * POSIX requires an application to exit with non-zero status if it wrote an error message to stderr. This has not yet been consistently implemented for the various builtins that are required to issue an error (such as `eval' (*note Eval::) when an argument cannot be parsed). * Some traditional implementations only allow reading standard input once, but GNU `m4' correctly handles multiple instances of `-' on the command line. * POSIX requires `m4wrap' (*note M4wrap::) to act in FIFO (first-in, first-out) order, but GNU `m4' currently uses LIFO order. Furthermore, POSIX states that only the first argument to `m4wrap' is saved for later evaluation, but GNU `m4' saves and processes all arguments, with output separated by spaces. * POSIX states that builtins that require arguments, but are called without arguments, have undefined behavior. Traditional implementations simply behave as though empty strings had been passed. For example, `a`'define`'b' would expand to `ab'. But GNU `m4' ignores certain builtins if they have missing arguments, giving `adefineb' for the above example. * Traditional implementations handle `define(`f',`1')' (*note Define::) by undefining the entire stack of previous definitions, and if doing `undefine(`f')' first. GNU `m4' replaces just the top definition on the stack, as if doing `popdef(`f')' followed by `pushdef(`f',`1')'. POSIX allows either behavior. * POSIX 2001 requires `syscmd' (*note Syscmd::) to evaluate command output for macro expansion, but this was a mistake that is anticipated to be corrected in the next version of POSIX. GNU `m4' follows traditional behavior in `syscmd' where output is not rescanned, and provides the extension `esyscmd' that does scan the output. * At one point, POSIX required `changequote(ARG)' (*note Changequote::) to use newline as the close quote, but this was a bug, and the next version of POSIX is anticipated to state that using empty strings or just one argument is unspecified. Meanwhile, the GNU `m4' behavior of treating an empty end-quote delimiter as `'' is not portable, as Solaris treats it as repeating the start-quote delimiter, and BSD treats it as leaving the previous end-quote delimiter unchanged. For predictable results, never call changequote with just one argument, or with empty strings for arguments. * At one point, POSIX required `changecom(ARG,)' (*note Changecom::) to make it impossible to end a comment, but this is a bug, and the next version of POSIX is anticipated to state that using empty strings is unspecified. Meanwhile, the GNU `m4' behavior of treating an empty end-comment delimiter as newline is not portable, as BSD treats it as leaving the previous end-comment delimiter unchanged. It is also impossible in BSD implementations to disable comments, even though that is required by POSIX. For predictable results, never call changecom with empty strings for arguments. * Most implementations of `m4' give macros a higher precedence than comments when parsing, meaning that if the start delimiter given to `changecom' (*note Changecom::) starts with a macro name, comments are effectively disabled. POSIX does not specify what the precedence is, so this version of GNU `m4' parser recognizes comments, then macros, then quoted strings. * Traditional implementations allow argument collection, but not string and comment processing, to span file boundaries. Thus, if `a.m4' contains `len(', and `b.m4' contains `abc)', `m4 a.m4 b.m4' outputs `3' with traditional `m4', but gives an error message that the end of file was encountered inside a macro with GNU `m4'. On the other hand, traditional implementations do end of file processing for files included with `include' or `sinclude' (*note Include::), while GNU `m4' seamlessly integrates the content of those files. Thus `include(`a.m4')include(`b.m4')' will output `3' instead of giving an error. * Traditional `m4' treats `traceon' (*note Trace::) without arguments as a global variable, independent of named macro tracing. Also, once a macro is undefined, named tracing of that macro is lost. On the other hand, when GNU `m4' encounters `traceon' without arguments, it turns tracing on for all existing definitions at the time, but does not trace future definitions; `traceoff' without arguments turns tracing off for all definitions regardless of whether they were also traced by name; and tracing by name, such as with `-tfoo' at the command line or `traceon(`foo')' in the input, is an attribute that is preserved even if the macro is currently undefined. Additionally, while POSIX requires trace output, it makes no demands on the formatting of that output. Parsing trace output is not guaranteed to be reliable, even between different releases of GNU M4; however, the intent is that any future changes in trace output will only occur under the direction of additional `debugmode' flags (*note Debug Levels::). * POSIX requires `eval' (*note Eval::) to treat all operators with the same precedence as C. However, earlier versions of GNU `m4' followed the traditional behavior of other `m4' implementations, where bitwise and logical negation (`~' and `!') have lower precedence than equality operators; and where equality operators (`==' and `!=') had the same precedence as relational operators (such as `<'). Use explicit parentheses to ensure proper precedence. As extensions to POSIX, GNU `m4' gives well-defined semantics to operations that C leaves undefined, such as when overflow occurs, when shifting negative numbers, or when performing division by zero. POSIX also requires `=' to cause an error, but many traditional implementations allowed it as an alias for `=='. * POSIX 2001 requires `translit' (*note Translit::) to treat each character of the second and third arguments literally. However, it is anticipated that the next version of POSIX will allow the GNU `m4' behavior of treating `-' as a range operator. * POSIX requires `m4' to honor the locale environment variables of `LANG', `LC_ALL', `LC_CTYPE', `LC_MESSAGES', and `NLSPATH', but this has not yet been implemented in GNU `m4'. * POSIX states that only unquoted leading newlines and blanks (that is, space and tab) are ignored when collecting macro arguments. However, this appears to be a bug in POSIX, since most traditional implementations also ignore all whitespace (formfeed, carriage return, and vertical tab). GNU `m4' follows tradition and ignores all leading unquoted whitespace. * A strictly-compliant POSIX client is not allowed to use command-line arguments not specified by POSIX. However, since this version of M4 ignores `POSIXLY_CORRECT' and enables the option `--gnu' by default (*note Invoking m4: Limits control.), a client desiring to be strictly compliant has no way to disable GNU extensions that conflict with POSIX when directly invoking the compiled `m4'. A future version of `GNU' M4 will honor the environment variable `POSIXLY_CORRECT', implicitly enabling `--traditional' if it is set, in order to allow a strictly-compliant client. In the meantime, a client needing strict POSIX compliance can use the workaround of invoking a shell script wrapper, where the wrapper then adds `--traditional' to the arguments passed to the compiled `m4'.  File: m4.info, Node: Other Incompatibilities, Prev: Incompatibilities, Up: Compatibility 16.3 Other incompatibilities ============================ There are a few other incompatibilities between this implementation of `m4', and the System V version. * GNU `m4' implements sync lines differently from System V `m4', when text is being diverted. GNU `m4' outputs the sync lines when the text is being diverted, and System V `m4' when the diverted text is being brought back. The problem is which lines and file names should be attached to text that is being, or has been, diverted. System V `m4' regards all the diverted text as being generated by the source line containing the `undivert' call, whereas GNU `m4' regards the diverted text as being generated at the time it is diverted. The sync line option is used mostly when using `m4' as a front end to a compiler. If a diverted line causes a compiler error, the error messages should most probably refer to the place where the diversion was made, and not where it was inserted again. divert(2)2 divert(1)1 divert`'0 =>#line 3 "stdin" =>0 ^D =>#line 2 "stdin" =>1 =>#line 1 "stdin" =>2 The current `m4' implementation has a limitation that the syncline output at the start of each diversion occurs no matter what, even if the previous diversion did not end with a newline. This goes contrary to the claim that synclines appear on a line by themselves, so this limitation may be corrected in a future version of `m4'. In the meantime, when using `-s', it is wisest to make sure all diversions end with newline. * GNU `m4' makes no attempt at prohibiting self-referential definitions like: define(`x', `x') => define(`x', `x ') => There is nothing inherently wrong with defining `x' to return `x'. The wrong thing is to expand `x' unquoted, because that would cause an infinite rescan loop. In `m4', one might use macros to hold strings, as we do for variables in other programming languages, further checking them with: ifelse(defn(`HOLDER'), `VALUE', ...) In cases like this one, an interdiction for a macro to hold its own name would be a useless limitation. Of course, this leaves more rope for the GNU `m4' user to hang himself! Rescanning hangs may be avoided through careful programming, a little like for endless loops in traditional programming languages.  File: m4.info, Node: Answers, Next: Copying This Package, Prev: Compatibility, Up: Top 17 Correct version of some examples *********************************** Some of the examples in this manuals are buggy or not very robust, for demonstration purposes. Improved versions of these composite macros are presented here. * Menu: * Improved exch:: Solution for `exch' * Improved forloop:: Solution for `forloop' * Improved foreach:: Solution for `foreach' * Improved copy:: Solution for `copy' * Improved m4wrap:: Solution for `m4wrap' * Improved cleardivert:: Solution for `cleardivert' * Improved capitalize:: Solution for `capitalize' * Improved fatal_error:: Solution for `fatal_error'  File: m4.info, Node: Improved exch, Next: Improved forloop, Up: Answers 17.1 Solution for `exch' ======================== The `exch' macro (*note Arguments::) as presented requires clients to double quote their arguments. A nicer definition, which lets clients follow the rule of thumb of one level of quoting per level of parentheses, involves adding quotes in the definition of `exch', as follows: define(`exch', ``$2', `$1'') => define(exch(`expansion text', `macro')) => macro =>expansion text  File: m4.info, Node: Improved forloop, Next: Improved foreach, Prev: Improved exch, Up: Answers 17.2 Solution for `forloop' =========================== The `forloop' macro (*note Forloop::) as presented earlier can go into an infinite loop if given an iterator that is not parsed as a macro name. It does not do any sanity checking on its numeric bounds, and only permits decimal numbers for bounds. Here is an improved version, shipped as `m4-1.4.14/examples/forloop2.m4'; this version also optimizes overhead by calling four macros instead of six per iteration (excluding those in TEXT), by not dereferencing the ITERATOR in the helper `_forloop'. $ m4 -d -I examples undivert(`forloop2.m4')dnl =>divert(`-1') =># forloop(var, from, to, stmt) - improved version: =># works even if VAR is not a strict macro name =># performs sanity check that FROM is larger than TO =># allows complex numerical expressions in TO and FROM =>define(`forloop', `ifelse(eval(`($2) <= ($3)'), `1', => `pushdef(`$1')_$0(`$1', eval(`$2'), => eval(`$3'), `$4')popdef(`$1')')') =>define(`_forloop', => `define(`$1', `$2')$4`'ifelse(`$2', `$3', `', => `$0(`$1', incr(`$2'), `$3', `$4')')') =>divert`'dnl include(`forloop2.m4') => forloop(`i', `2', `1', `no iteration occurs') => forloop(`', `1', `2', ` odd iterator name') => odd iterator name odd iterator name forloop(`i', `5 + 5', `0xc', ` 0x`'eval(i, `16')') => 0xa 0xb 0xc forloop(`i', `a', `b', `non-numeric bounds') error-->m4:stdin:6: bad expression in eval (bad input): (a) <= (b) => One other change to notice is that the improved version used `_$0' rather than `_foreach' to invoke the helper routine. In general, this is a good practice to follow, because then the set of macros can be uniformly transformed. The following example shows a transformation that doubles the current quoting and appends a suffix `2' to each transformed macro. If `foreach' refers to the literal `_foreach', then `foreach2' invokes `_foreach' instead of the intended `_foreach2', and the mixing of quoting paradigms leads to an infinite recursion loop in this example. $ m4 -d -L 9 -I examples define(`arg1', `$1')include(`forloop2.m4')include(`quote.m4') => define(`double', `define(`$1'`2', arg1(patsubst(dquote(defn(`$1')), `[`']', `\&\&')))') => double(`forloop')double(`_forloop')defn(`forloop2') =>ifelse(eval(``($2) <= ($3)''), ``1'', => ``pushdef(``$1'')_$0(``$1'', eval(``$2''), => eval(``$3''), ``$4'')popdef(``$1'')'') forloop(i, 1, 5, `ifelse(')forloop(i, 1, 5, `)') => changequote(`[', `]')changequote([``], ['']) => forloop2(i, 1, 5, ``ifelse('')forloop2(i, 1, 5, ``)'') => changequote`'include(`forloop.m4') => double(`forloop')double(`_forloop')defn(`forloop2') =>pushdef(``$1'', ``$2'')_forloop($@)popdef(``$1'') forloop(i, 1, 5, `ifelse(')forloop(i, 1, 5, `)') => changequote(`[', `]')changequote([``], ['']) => forloop2(i, 1, 5, ``ifelse('')forloop2(i, 1, 5, ``)'') error-->m4:stdin:12: recursion limit of 9 exceeded, use -L to change it One more optimization is still possible. Instead of repeatedly assigning a variable then invoking or dereferencing it, it is possible to pass the current iterator value as a single argument. Coupled with `curry' if other arguments are needed (*note Composition::), or with helper macros if the argument is needed in more than one place in the expansion, the output can be generated with three, rather than four, macros of overhead per iteration. Notice how the file `m4-1.4.14/examples/forloop3.m4' rearranges the arguments of the helper `_forloop' to take two arguments that are placed around the current value. By splitting a balanced set of parantheses across multiple arguments, the helper macro can now be shared by `forloop' and the new `forloop_arg'. $ m4 -I examples include(`forloop3.m4') => undivert(`forloop3.m4')dnl =>divert(`-1') =># forloop_arg(from, to, macro) - invoke MACRO(value) for =># each value between FROM and TO, without define overhead =>define(`forloop_arg', `ifelse(eval(`($1) <= ($2)'), `1', => `_forloop(`$1', eval(`$2'), `$3(', `)')')') =># forloop(var, from, to, stmt) - refactored to share code =>define(`forloop', `ifelse(eval(`($2) <= ($3)'), `1', => `pushdef(`$1')_forloop(eval(`$2'), eval(`$3'), => `define(`$1',', `)$4')popdef(`$1')')') =>define(`_forloop', => `$3`$1'$4`'ifelse(`$1', `$2', `', => `$0(incr(`$1'), `$2', `$3', `$4')')') =>divert`'dnl forloop(`i', `1', `3', ` i') => 1 2 3 define(`echo', `$@') => forloop_arg(`1', `3', ` echo') => 1 2 3 include(`curry.m4') => forloop_arg(`1', `3', `curry(`pushdef', `a')') => a =>3 popdef(`a')a =>2 popdef(`a')a =>1 popdef(`a')a =>a Of course, it is possible to make even more improvements, such as adding an optional step argument, or allowing iteration through descending sequences. GNU Autoconf provides some of these additional bells and whistles in its `m4_for' macro.  File: m4.info, Node: Improved foreach, Next: Improved copy, Prev: Improved forloop, Up: Answers 17.3 Solution for `foreach' =========================== The `foreach' and `foreachq' macros (*note Foreach::) as presented earlier each have flaws. First, we will examine and fix the quadratic behavior of `foreachq': $ m4 -I examples include(`foreachq.m4') => traceon(`shift')debugmode(`aq') => foreachq(`x', ``1', `2', `3', `4'', `x ')dnl =>1 error-->m4trace: -3- shift(`1', `2', `3', `4') error-->m4trace: -2- shift(`1', `2', `3', `4') =>2 error-->m4trace: -4- shift(`1', `2', `3', `4') error-->m4trace: -3- shift(`2', `3', `4') error-->m4trace: -3- shift(`1', `2', `3', `4') error-->m4trace: -2- shift(`2', `3', `4') =>3 error-->m4trace: -5- shift(`1', `2', `3', `4') error-->m4trace: -4- shift(`2', `3', `4') error-->m4trace: -3- shift(`3', `4') error-->m4trace: -4- shift(`1', `2', `3', `4') error-->m4trace: -3- shift(`2', `3', `4') error-->m4trace: -2- shift(`3', `4') =>4 error-->m4trace: -6- shift(`1', `2', `3', `4') error-->m4trace: -5- shift(`2', `3', `4') error-->m4trace: -4- shift(`3', `4') error-->m4trace: -3- shift(`4') Each successive iteration was adding more quoted `shift' invocations, and the entire list contents were passing through every iteration. In general, when recursing, it is a good idea to make the recursion use fewer arguments, rather than adding additional quoted uses of `shift'. By doing so, `m4' uses less memory, invokes fewer macros, is less likely to run into machine limits, and most importantly, performs faster. The fixed version of `foreachq' can be found in `m4-1.4.14/examples/foreachq2.m4': $ m4 -I examples include(`foreachq2.m4') => undivert(`foreachq2.m4')dnl =>include(`quote.m4')dnl =>divert(`-1') =># foreachq(x, `item_1, item_2, ..., item_n', stmt) =># quoted list, improved version =>define(`foreachq', `pushdef(`$1')_$0($@)popdef(`$1')') =>define(`_arg1q', ``$1'') =>define(`_rest', `ifelse(`$#', `1', `', `dquote(shift($@))')') =>define(`_foreachq', `ifelse(`$2', `', `', => `define(`$1', _arg1q($2))$3`'$0(`$1', _rest($2), `$3')')') =>divert`'dnl traceon(`shift')debugmode(`aq') => foreachq(`x', ``1', `2', `3', `4'', `x ')dnl =>1 error-->m4trace: -3- shift(`1', `2', `3', `4') =>2 error-->m4trace: -3- shift(`2', `3', `4') =>3 error-->m4trace: -3- shift(`3', `4') =>4 Note that the fixed version calls unquoted helper macros in `_foreachq' to trim elements immediately; those helper macros in turn must re-supply the layer of quotes lost in the macro invocation. Contrast the use of `_arg1q', which quotes the first list element, with `_arg1' of the earlier implementation that returned the first list element directly. Additionally, by calling the helper method immediately, the `defn(`ITERATOR')' no longer contains unexpanded macros. The astute m4 programmer might notice that the solution above still uses more memory and macro invocations, and thus more time, than strictly necessary. Note that `$2', which contains an arbitrarily long quoted list, is expanded and rescanned three times per iteration of `_foreachq'. Furthermore, every iteration of the algorithm effectively unboxes then reboxes the list, which costs a couple of macro invocations. It is possible to rewrite the algorithm for a bit more speed by swapping the order of the arguments to `_foreachq' in order to operate on an unboxed list in the first place, and by using the fixed-length `$#' instead of an arbitrary length list as the key to end recursion. The result is an overhead of six macro invocations per loop (excluding any macros in TEXT), instead of eight. This alternative approach is available as `m4-1.4.14/examples/foreach3.m4': $ m4 -I examples include(`foreachq3.m4') => undivert(`foreachq3.m4')dnl =>divert(`-1') =># foreachq(x, `item_1, item_2, ..., item_n', stmt) =># quoted list, alternate improved version =>define(`foreachq', `ifelse(`$2', `', `', => `pushdef(`$1')_$0(`$1', `$3', `', $2)popdef(`$1')')') =>define(`_foreachq', `ifelse(`$#', `3', `', => `define(`$1', `$4')$2`'$0(`$1', `$2', => shift(shift(shift($@))))')') =>divert`'dnl traceon(`shift')debugmode(`aq') => foreachq(`x', ``1', `2', `3', `4'', `x ')dnl =>1 error-->m4trace: -4- shift(`x', `x error-->', `', `1', `2', `3', `4') error-->m4trace: -3- shift(`x error-->', `', `1', `2', `3', `4') error-->m4trace: -2- shift(`', `1', `2', `3', `4') =>2 error-->m4trace: -4- shift(`x', `x error-->', `1', `2', `3', `4') error-->m4trace: -3- shift(`x error-->', `1', `2', `3', `4') error-->m4trace: -2- shift(`1', `2', `3', `4') =>3 error-->m4trace: -4- shift(`x', `x error-->', `2', `3', `4') error-->m4trace: -3- shift(`x error-->', `2', `3', `4') error-->m4trace: -2- shift(`2', `3', `4') =>4 error-->m4trace: -4- shift(`x', `x error-->', `3', `4') error-->m4trace: -3- shift(`x error-->', `3', `4') error-->m4trace: -2- shift(`3', `4') In the current version of M4, every instance of `$@' is rescanned as it is encountered. Thus, the `foreachq3.m4' alternative uses much less memory than `foreachq2.m4', and executes as much as 10% faster, since each iteration encounters fewer `$@'. However, the implementation of rescanning every byte in `$@' is quadratic in the number of bytes scanned (for example, making the broken version in `foreachq.m4' cubic, rather than quadratic, in behavior). A future release of M4 will improve the underlying implementation by reusing results of previous scans, so that both styles of `foreachq' can become linear in the number of bytes scanned. Notice how the implementation injects an empty argument prior to expanding `$2' within `foreachq'; the helper macro `_foreachq' then ignores the third argument altogether, and ends recursion when there are three arguments left because there was nothing left to pass through `shift'. Thus, each iteration only needs one `ifelse', rather than the two conditionals used in the version from `foreachq2.m4'. So far, all of the implementations of `foreachq' presented have been quadratic with M4 1.4.x. But `forloop' is linear, because each iteration parses a constant amount of arguments. So, it is possible to design a variant that uses `forloop' to do the iteration, then uses `$@' only once at the end, giving a linear result even with older M4 implementations. This implementation relies on the GNU extension that `$10' expands to the tenth argument rather than the first argument concatenated with `0'. The trick is to define an intermediate macro that repeats the text `m4_define(`$1', `$N')$2`'', with `n' set to successive integers corresponding to each argument. The helper macro `_foreachq_' is needed in order to generate the literal sequences such as `$1' into the intermediate macro, rather than expanding them as the arguments of `_foreachq'. With this approach, no `shift' calls are even needed! Even though there are seven macros of overhead per iteration instead of six in `foreachq3.m4', the linear scaling is apparent at relatively small list sizes. However, this approach will need adjustment when a future version of M4 follows POSIX by no longer treating `$10' as the tenth argument; the anticipation is that `${10}' can be used instead, although that alternative syntax is not yet supported. $ m4 -I examples include(`foreachq4.m4') => undivert(`foreachq4.m4')dnl =>include(`forloop2.m4')dnl =>divert(`-1') =># foreachq(x, `item_1, item_2, ..., item_n', stmt) =># quoted list, version based on forloop =>define(`foreachq', =>`ifelse(`$2', `', `', `_$0(`$1', `$3', $2)')') =>define(`_foreachq', =>`pushdef(`$1', forloop(`$1', `3', `$#', => `$0_(`1', `2', indir(`$1'))')`popdef( => `$1')')indir(`$1', $@)') =>define(`_foreachq_', =>``define(`$$1', `$$3')$$2`''') =>divert`'dnl traceon(`shift')debugmode(`aq') => foreachq(`x', ``1', `2', `3', `4'', `x ')dnl =>1 =>2 =>3 =>4 For yet another approach, the improved version of `foreach', available in `m4-1.4.14/examples/foreach2.m4', simply overquotes the arguments to `_foreach' to begin with, using `dquote_elt'. Then `_foreach' can just use `_arg1' to remove the extra layer of quoting that was added up front: $ m4 -I examples include(`foreach2.m4') => undivert(`foreach2.m4')dnl =>include(`quote.m4')dnl =>divert(`-1') =># foreach(x, (item_1, item_2, ..., item_n), stmt) =># parenthesized list, improved version =>define(`foreach', `pushdef(`$1')_$0(`$1', => (dquote(dquote_elt$2)), `$3')popdef(`$1')') =>define(`_arg1', `$1') =>define(`_foreach', `ifelse(`$2', `(`')', `', => `define(`$1', _arg1$2)$3`'$0(`$1', (dquote(shift$2)), `$3')')') =>divert`'dnl traceon(`shift')debugmode(`aq') => foreach(`x', `(`1', `2', `3', `4')', `x ')dnl error-->m4trace: -4- shift(`1', `2', `3', `4') error-->m4trace: -4- shift(`2', `3', `4') error-->m4trace: -4- shift(`3', `4') =>1 error-->m4trace: -3- shift(``1'', ``2'', ``3'', ``4'') =>2 error-->m4trace: -3- shift(``2'', ``3'', ``4'') =>3 error-->m4trace: -3- shift(``3'', ``4'') =>4 error-->m4trace: -3- shift(``4'') It is likewise possible to write a variant of `foreach' that performs in linear time on M4 1.4.x; the easiest method is probably writing a version of `foreach' that unboxes its list, then invokes `_foreachq' as previously defined in `foreachq4.m4'. In summary, recursion over list elements is trickier than it appeared at first glance, but provides a powerful idiom within `m4' processing. As a final demonstration, both list styles are now able to handle several scenarios that would wreak havoc on one or both of the original implementations. This points out one other difference between the list styles. `foreach' evaluates unquoted list elements only once, in preparation for calling `_foreach', similary for `foreachq' as provided by `foreachq3.m4' or `foreachq4.m4'. But `foreachq', as provided by `foreachq2.m4', evaluates unquoted list elements twice while visiting the first list element, once in `_arg1q' and once in `_rest'. When deciding which list style to use, one must take into account whether repeating the side effects of unquoted list elements will have any detrimental effects. $ m4 -I examples include(`foreach2.m4') => include(`foreachq2.m4') => dnl 0-element list: foreach(`x', `', `') / foreachq(`x', `', `') => / dnl 1-element list of empty element foreach(`x', `()', `') / foreachq(`x', ``'', `') =><> / <> dnl 2-element list of empty elements foreach(`x', `(`',`')', `') / foreachq(`x', ``',`'', `') =><><> / <><> dnl 1-element list of a comma foreach(`x', `(`,')', `') / foreachq(`x', ``,'', `') =><,> / <,> dnl 2-element list of unbalanced parentheses foreach(`x', `(`(', `)')', `') / foreachq(`x', ``(', `)'', `') =><(><)> / <(><)> define(`ab', `oops')dnl using defn(`iterator') foreach(`x', `(`a', `b')', `defn(`x')') /dnl foreachq(`x', ``a', `b'', `defn(`x')') =>ab / ab define(`active', `ACT, IVE') => traceon(`active') => dnl list of unquoted macros; expansion occurs before recursion foreach(`x', `(active, active)', ` ')dnl error-->m4trace: -4- active -> `ACT, IVE' error-->m4trace: -4- active -> `ACT, IVE' => => => => foreachq(`x', `active, active', ` ')dnl error-->m4trace: -3- active -> `ACT, IVE' error-->m4trace: -3- active -> `ACT, IVE' => error-->m4trace: -3- active -> `ACT, IVE' error-->m4trace: -3- active -> `ACT, IVE' => => => dnl list of quoted macros; expansion occurs during recursion foreach(`x', `(`active', `active')', ` ')dnl error-->m4trace: -1- active -> `ACT, IVE' => error-->m4trace: -1- active -> `ACT, IVE' => foreachq(`x', ``active', `active'', ` ')dnl error-->m4trace: -1- active -> `ACT, IVE' => error-->m4trace: -1- active -> `ACT, IVE' => dnl list of double-quoted macro names; no expansion foreach(`x', `(``active'', ``active'')', ` ')dnl => => foreachq(`x', ```active'', ``active''', ` ')dnl => =>  File: m4.info, Node: Improved copy, Next: Improved m4wrap, Prev: Improved foreach, Up: Answers 17.4 Solution for `copy' ======================== The macro `copy' presented above is unable to handle builtin tokens with M4 1.4.x, because it tries to pass the builtin token through the macro `curry', where it is silently flattened to an empty string (*note Composition::). Rather than using the problematic `curry' to work around the limitation that `stack_foreach' expects to invoke a macro that takes exactly one argument, we can write a new macro that lets us form the exact two-argument `pushdef' call sequence needed, so that we are no longer passing a builtin token through a text macro. -- Composite: stack_foreach_sep (MACRO, PRE, POST, SEP) -- Composite: stack_foreach_sep_lifo (MACRO, PRE, POST, SEP) For each of the `pushdef' definitions associated with MACRO, expand the sequence `PRE`'definition`'POST'. Additionally, expand SEP between definitions. `stack_foreach_sep' visits the oldest definition first, while `stack_foreach_sep_lifo' visits the current definition first. The expansion may dereference MACRO, but should not modify it. There are a few special macros, such as `defn', which cannot be used as the MACRO parameter. Note that `stack_foreach(`MACRO', `ACTION')' is equivalent to `stack_foreach_sep(`MACRO', `ACTION(', `)')'. By supplying explicit parentheses, split among the PRE and POST arguments to `stack_foreach_sep', it is now possible to construct macro calls with more than one argument, without passing builtin tokens through a macro call. It is likewise possible to directly reference the stack definitions without a macro call, by leaving PRE and POST empty. Thus, in addition to fixing `copy' on builtin tokens, it also executes with fewer macro invocations. The new macro also adds a separator that is only output after the first iteration of the helper `_stack_reverse_sep', implemented by prepending the original SEP to PRE and omitting a SEP argument in subsequent iterations. Note that the empty string that separates SEP from PRE is provided as part of the fourth argument when originally calling `_stack_reverse_sep', and not by writing `$4`'$3' as the third argument in the recursive call; while the other approach would give the same output, it does so at the expense of increasing the argument size on each iteration of `_stack_reverse_sep', which results in quadratic instead of linear execution time. The improved stack walking macros are available in `m4-1.4.14/examples/stack_sep.m4': $ m4 -I examples include(`stack_sep.m4') => define(`copy', `ifdef(`$2', `errprint(`$2 already defined ')m4exit(`1')', `stack_foreach_sep(`$1', `pushdef(`$2',', `)')')')dnl pushdef(`a', `1')pushdef(`a', defn(`divnum')) => copy(`a', `b') => b =>0 popdef(`b') => b =>1 pushdef(`c', `1')pushdef(`c', `2') => stack_foreach_sep_lifo(`c', `', `', `, ') =>2, 1 undivert(`stack_sep.m4')dnl =>divert(`-1') =># stack_foreach_sep(macro, pre, post, sep) =># Invoke PRE`'defn`'POST with a single argument of each definition =># from the definition stack of MACRO, starting with the oldest, and =># separated by SEP between definitions. =>define(`stack_foreach_sep', =>`_stack_reverse_sep(`$1', `tmp-$1')'dnl =>`_stack_reverse_sep(`tmp-$1', `$1', `$2`'defn(`$1')$3', `$4`'')') =># stack_foreach_sep_lifo(macro, pre, post, sep) =># Like stack_foreach_sep, but starting with the newest definition. =>define(`stack_foreach_sep_lifo', =>`_stack_reverse_sep(`$1', `tmp-$1', `$2`'defn(`$1')$3', `$4`'')'dnl =>`_stack_reverse_sep(`tmp-$1', `$1')') =>define(`_stack_reverse_sep', =>`ifdef(`$1', `pushdef(`$2', defn(`$1'))$3`'popdef(`$1')$0( => `$1', `$2', `$4$3')')') =>divert`'dnl  File: m4.info, Node: Improved m4wrap, Next: Improved cleardivert, Prev: Improved copy, Up: Answers 17.5 Solution for `m4wrap' ========================== The replacement `m4wrap' versions presented above, designed to guarantee FIFO or LIFO order regardless of the underlying M4 implementation, share a bug when dealing with wrapped text that looks like parameter expansion. Note how the invocation of `m4wrapN' interprets these parameters, while using the builtin preserves them for their intended use. $ m4 -I examples include(`wraplifo.m4') => m4wrap(`define(`foo', ``$0:'-$1-$*-$#-')foo(`a', `b') ') => builtin(`m4wrap', ``'define(`bar', ``$0:'-$1-$*-$#-')bar(`a', `b') ') => ^D =>bar:-a-a,b-2- =>m4wrap0:---0- Additionally, the computation of `_m4wrap_level' and creation of multiple `m4wrapN' placeholders in the original examples is more expensive in time and memory than strictly necessary. Notice how the improved version grabs the wrapped text via `defn' to avoid parameter expansion, then undefines `_m4wrap_text', before stripping a level of quotes with `_arg1' to expand the text. That way, each level of wrapping reuses the single placeholder, which starts each nesting level in an undefined state. Finally, it is worth emulating the GNU M4 extension of saving all arguments to `m4wrap', separated by a space, rather than saving just the first argument. This is done with the `join' macro documented previously (*note Shift::). The improved LIFO example is shipped as `m4-1.4.14/examples/wraplifo2.m4', and can easily be converted to a FIFO solution by swapping the adjacent invocations of `joinall' and `defn'. $ m4 -I examples include(`wraplifo2.m4') => undivert(`wraplifo2.m4')dnl =>dnl Redefine m4wrap to have LIFO semantics, improved example. =>include(`join.m4')dnl =>define(`_m4wrap', defn(`m4wrap'))dnl =>define(`_arg1', `$1')dnl =>define(`m4wrap', =>`ifdef(`_$0_text', => `define(`_$0_text', joinall(` ', $@)defn(`_$0_text'))', => `_$0(`_arg1(defn(`_$0_text')undefine(`_$0_text'))')dnl =>define(`_$0_text', joinall(` ', $@))')')dnl m4wrap(`define(`foo', ``$0:'-$1-$*-$#-')foo(`a', `b') ') => m4wrap(`lifo text m4wrap(`nested', `', `$@ ')') => ^D =>lifo text =>foo:-a-a,b-2- =>nested $@  File: m4.info, Node: Improved cleardivert, Next: Improved capitalize, Prev: Improved m4wrap, Up: Answers 17.6 Solution for `cleardivert' =============================== The `cleardivert' macro (*note Cleardivert::) cannot, as it stands, be called without arguments to clear all pending diversions. That is because using undivert with an empty string for an argument is different than using it with no arguments at all. Compare the earlier definition with one that takes the number of arguments into account: define(`cleardivert', `pushdef(`_n', divnum)divert(`-1')undivert($@)divert(_n)popdef(`_n')') => divert(`1')one divert => cleardivert => undivert =>one => define(`cleardivert', `pushdef(`_num', divnum)divert(`-1')ifelse(`$#', `0', `undivert`'', `undivert($@)')divert(_num)popdef(`_num')') => divert(`2')two divert => cleardivert => undivert =>  File: m4.info, Node: Improved capitalize, Next: Improved fatal_error, Prev: Improved cleardivert, Up: Answers 17.7 Solution for `capitalize' ============================== The `capitalize' macro (*note Patsubst::) as presented earlier does not allow clients to follow the quoting rule of thumb. Consider the three macros `active', `Active', and `ACTIVE', and the difference between calling `capitalize' with the expansion of a macro, expanding the result of a case change, and changing the case of a double-quoted string: $ m4 -I examples include(`capitalize.m4')dnl define(`active', `act1, ive')dnl define(`Active', `Act2, Ive')dnl define(`ACTIVE', `ACT3, IVE')dnl upcase(active) =>ACT1,IVE upcase(`active') =>ACT3, IVE upcase(``active'') =>ACTIVE downcase(ACTIVE) =>act3,ive downcase(`ACTIVE') =>act1, ive downcase(``ACTIVE'') =>active capitalize(active) =>Act1 capitalize(`active') =>Active capitalize(``active'') =>_capitalize(`active') define(`A', `OOPS') => capitalize(active) =>OOPSct1 capitalize(`active') =>OOPSctive First, when `capitalize' is called with more than one argument, it was throwing away later arguments, whereas `upcase' and `downcase' used `$*' to collect them all. The fix is simple: use `$*' consistently. Next, with single-quoting, `capitalize' outputs a single character, a set of quotes, then the rest of the characters, making it impossible to invoke `Active' after the fact, and allowing the alternate macro `A' to interfere. Here, the solution is to use additional quoting in the helper macros, then pass the final over-quoted output string through `_arg1' to remove the extra quoting and finally invoke the concatenated portions as a single string. Finally, when passed a double-quoted string, the nested macro `_capitalize' is never invoked because it ended up nested inside quotes. This one is the toughest to fix. In short, we have no idea how many levels of quotes are in effect on the substring being altered by `patsubst'. If the replacement string cannot be expressed entirely in terms of literal text and backslash substitutions, then we need a mechanism to guarantee that the helper macros are invoked outside of quotes. In other words, this sounds like a job for `changequote' (*note Changequote::). By changing the active quoting characters, we can guarantee that replacement text injected by `patsubst' always occurs in the middle of a string that has exactly one level of over-quoting using alternate quotes; so the replacement text closes the quoted string, invokes the helper macros, then reopens the quoted string. In turn, that means the replacement text has unbalanced quotes, necessitating another round of `changequote'. In the fixed version below, (also shipped as `m4-1.4.14/examples/capitalize2.m4'), `capitalize' uses the alternate quotes of `<<[' and `]>>' (the longer strings are chosen so as to be less likely to appear in the text being converted). The helpers `_to_alt' and `_from_alt' merely reduce the number of characters required to perform a `changequote', since the definition changes twice. The outermost pair means that `patsubst' and `_capitalize_alt' are invoked with alternate quoting; the innermost pair is used so that the third argument to `patsubst' can contain an unbalanced `]>>'/`<<[' pair. Note that `upcase' and `downcase' must be redefined as `_upcase_alt' and `_downcase_alt', since they contain nested quotes but are invoked with the alternate quoting scheme in effect. $ m4 -I examples include(`capitalize2.m4')dnl define(`active', `act1, ive')dnl define(`Active', `Act2, Ive')dnl define(`ACTIVE', `ACT3, IVE')dnl define(`A', `OOPS')dnl capitalize(active; `active'; ``active''; ```actIVE''') =>Act1,Ive; Act2, Ive; Active; `Active' undivert(`capitalize2.m4')dnl =>divert(`-1') =># upcase(text) =># downcase(text) =># capitalize(text) =># change case of text, improved version =>define(`upcase', `translit(`$*', `a-z', `A-Z')') =>define(`downcase', `translit(`$*', `A-Z', `a-z')') =>define(`_arg1', `$1') =>define(`_to_alt', `changequote(`<<[', `]>>')') =>define(`_from_alt', `changequote(<<[`]>>, <<[']>>)') =>define(`_upcase_alt', `translit(<<[$*]>>, <<[a-z]>>, <<[A-Z]>>)') =>define(`_downcase_alt', `translit(<<[$*]>>, <<[A-Z]>>, <<[a-z]>>)') =>define(`_capitalize_alt', => `regexp(<<[$1]>>, <<[^\(\w\)\(\w*\)]>>, => <<[_upcase_alt(<<[<<[\1]>>]>>)_downcase_alt(<<[<<[\2]>>]>>)]>>)') =>define(`capitalize', => `_arg1(_to_alt()patsubst(<<[<<[$*]>>]>>, <<[\w+]>>, => _from_alt()`]>>_$0_alt(<<[\&]>>)<<['_to_alt())_from_alt())') =>divert`'dnl  File: m4.info, Node: Improved fatal_error, Prev: Improved capitalize, Up: Answers 17.8 Solution for `fatal_error' =============================== The `fatal_error' macro (*note M4exit::) is not robust to versions of GNU M4 earlier than 1.4.8, where invoking `__file__' (*note Location::) inside `m4wrap' would result in an empty string, and `__line__' resulted in `0' even though all files start at line 1. Furthermore, versions earlier than 1.4.6 did not support the `__program__' macro. If you want `fatal_error' to work across the entire 1.4.x release series, a better implementation would be: define(`fatal_error', `errprint(ifdef(`__program__', `__program__', ``m4'')'dnl `:ifelse(__line__, `0', `', `__file__:__line__:')` fatal error: $* ')m4exit(`1')') => m4wrap(`divnum(`demo of internal message') fatal_error(`inside wrapped text')') => ^D error-->m4:stdin:6: Warning: excess arguments to builtin `divnum' ignored =>0 error-->m4:stdin:6: fatal error: inside wrapped text  File: m4.info, Node: Copying This Package, Next: Copying This Manual, Prev: Answers, Up: Top Appendix A How to make copies of the overall M4 package ******************************************************* This appendix covers the license for copying the source code of the overall M4 package. This manual is under a different set of restrictions, covered later (*note Copying This Manual::). * Menu: * GNU General Public License:: License for copying the M4 package  File: m4.info, Node: GNU General Public License, Up: Copying This Package A.1 License for copying the M4 package ====================================== Version 3, 29 June 2007 Copyright (C) 2007 Free Software Foundation, Inc. `http://fsf.org/' Everyone is permitted to copy and distribute verbatim copies of this license document, but changing it is not allowed. Preamble ======== The GNU General Public License is a free, copyleft license for software and other kinds of works. The licenses for most software and other practical works are designed to take away your freedom to share and change the works. By contrast, the GNU General Public License is intended to guarantee your freedom to share and change all versions of a program--to make sure it remains free software for all its users. We, the Free Software Foundation, use the GNU General Public License for most of our software; it applies also to any other work released this way by its authors. You can apply it to your programs, too. When we speak of free software, we are referring to freedom, not price. Our General Public Licenses are designed to make sure that you have the freedom to distribute copies of free software (and charge for them if you wish), that you receive source code or can get it if you want it, that you can change the software or use pieces of it in new free programs, and that you know you can do these things. To protect your rights, we need to prevent others from denying you these rights or asking you to surrender the rights. Therefore, you have certain responsibilities if you distribute copies of the software, or if you modify it: responsibilities to respect the freedom of others. For example, if you distribute copies of such a program, whether gratis or for a fee, you must pass on to the recipients the same freedoms that you received. You must make sure that they, too, receive or can get the source code. And you must show them these terms so they know their rights. Developers that use the GNU GPL protect your rights with two steps: (1) assert copyright on the software, and (2) offer you this License giving you legal permission to copy, distribute and/or modify it. For the developers' and authors' protection, the GPL clearly explains that there is no warranty for this free software. For both users' and authors' sake, the GPL requires that modified versions be marked as changed, so that their problems will not be attributed erroneously to authors of previous versions. Some devices are designed to deny users access to install or run modified versions of the software inside them, although the manufacturer can do so. This is fundamentally incompatible with the aim of protecting users' freedom to change the software. The systematic pattern of such abuse occurs in the area of products for individuals to use, which is precisely where it is most unacceptable. Therefore, we have designed this version of the GPL to prohibit the practice for those products. If such problems arise substantially in other domains, we stand ready to extend this provision to those domains in future versions of the GPL, as needed to protect the freedom of users. Finally, every program is threatened constantly by software patents. States should not allow patents to restrict development and use of software on general-purpose computers, but in those that do, we wish to avoid the special danger that patents applied to a free program could make it effectively proprietary. To prevent this, the GPL assures that patents cannot be used to render the program non-free. The precise terms and conditions for copying, distribution and modification follow. TERMS AND CONDITIONS ==================== 0. Definitions. "This License" refers to version 3 of the GNU General Public License. "Copyright" also means copyright-like laws that apply to other kinds of works, such as semiconductor masks. "The Program" refers to any copyrightable work licensed under this License. Each licensee is addressed as "you". "Licensees" and "recipients" may be individuals or organizations. To "modify" a work means to copy from or adapt all or part of the work in a fashion requiring copyright permission, other than the making of an exact copy. The resulting work is called a "modified version" of the earlier work or a work "based on" the earlier work. A "covered work" means either the unmodified Program or a work based on the Program. To "propagate" a work means to do anything with it that, without permission, would make you directly or secondarily liable for infringement under applicable copyright law, except executing it on a computer or modifying a private copy. Propagation includes copying, distribution (with or without modification), making available to the public, and in some countries other activities as well. To "convey" a work means any kind of propagation that enables other parties to make or receive copies. Mere interaction with a user through a computer network, with no transfer of a copy, is not conveying. An interactive user interface displays "Appropriate Legal Notices" to the extent that it includes a convenient and prominently visible feature that (1) displays an appropriate copyright notice, and (2) tells the user that there is no warranty for the work (except to the extent that warranties are provided), that licensees may convey the work under this License, and how to view a copy of this License. If the interface presents a list of user commands or options, such as a menu, a prominent item in the list meets this criterion. 1. Source Code. The "source code" for a work means the preferred form of the work for making modifications to it. "Object code" means any non-source form of a work. A "Standard Interface" means an interface that either is an official standard defined by a recognized standards body, or, in the case of interfaces specified for a particular programming language, one that is widely used among developers working in that language. The "System Libraries" of an executable work include anything, other than the work as a whole, that (a) is included in the normal form of packaging a Major Component, but which is not part of that Major Component, and (b) serves only to enable use of the work with that Major Component, or to implement a Standard Interface for which an implementation is available to the public in source code form. A "Major Component", in this context, means a major essential component (kernel, window system, and so on) of the specific operating system (if any) on which the executable work runs, or a compiler used to produce the work, or an object code interpreter used to run it. The "Corresponding Source" for a work in object code form means all the source code needed to generate, install, and (for an executable work) run the object code and to modify the work, including scripts to control those activities. However, it does not include the work's System Libraries, or general-purpose tools or generally available free programs which are used unmodified in performing those activities but which are not part of the work. For example, Corresponding Source includes interface definition files associated with source files for the work, and the source code for shared libraries and dynamically linked subprograms that the work is specifically designed to require, such as by intimate data communication or control flow between those subprograms and other parts of the work. The Corresponding Source need not include anything that users can regenerate automatically from other parts of the Corresponding Source. The Corresponding Source for a work in source code form is that same work. 2. Basic Permissions. All rights granted under this License are granted for the term of copyright on the Program, and are irrevocable provided the stated conditions are met. This License explicitly affirms your unlimited permission to run the unmodified Program. The output from running a covered work is covered by this License only if the output, given its content, constitutes a covered work. This License acknowledges your rights of fair use or other equivalent, as provided by copyright law. You may make, run and propagate covered works that you do not convey, without conditions so long as your license otherwise remains in force. You may convey covered works to others for the sole purpose of having them make modifications exclusively for you, or provide you with facilities for running those works, provided that you comply with the terms of this License in conveying all material for which you do not control copyright. Those thus making or running the covered works for you must do so exclusively on your behalf, under your direction and control, on terms that prohibit them from making any copies of your copyrighted material outside their relationship with you. Conveying under any other circumstances is permitted solely under the conditions stated below. Sublicensing is not allowed; section 10 makes it unnecessary. 3. Protecting Users' Legal Rights From Anti-Circumvention Law. No covered work shall be deemed part of an effective technological measure under any applicable law fulfilling obligations under article 11 of the WIPO copyright treaty adopted on 20 December 1996, or similar laws prohibiting or restricting circumvention of such measures. When you convey a covered work, you waive any legal power to forbid circumvention of technological measures to the extent such circumvention is effected by exercising rights under this License with respect to the covered work, and you disclaim any intention to limit operation or modification of the work as a means of enforcing, against the work's users, your or third parties' legal rights to forbid circumvention of technological measures. 4. Conveying Verbatim Copies. You may convey verbatim copies of the Program's source code as you receive it, in any medium, provided that you conspicuously and appropriately publish on each copy an appropriate copyright notice; keep intact all notices stating that this License and any non-permissive terms added in accord with section 7 apply to the code; keep intact all notices of the absence of any warranty; and give all recipients a copy of this License along with the Program. You may charge any price or no price for each copy that you convey, and you may offer support or warranty protection for a fee. 5. Conveying Modified Source Versions. You may convey a work based on the Program, or the modifications to produce it from the Program, in the form of source code under the terms of section 4, provided that you also meet all of these conditions: a. The work must carry prominent notices stating that you modified it, and giving a relevant date. b. The work must carry prominent notices stating that it is released under this License and any conditions added under section 7. This requirement modifies the requirement in section 4 to "keep intact all notices". c. You must license the entire work, as a whole, under this License to anyone who comes into possession of a copy. This License will therefore apply, along with any applicable section 7 additional terms, to the whole of the work, and all its parts, regardless of how they are packaged. This License gives no permission to license the work in any other way, but it does not invalidate such permission if you have separately received it. d. If the work has interactive user interfaces, each must display Appropriate Legal Notices; however, if the Program has interactive interfaces that do not display Appropriate Legal Notices, your work need not make them do so. A compilation of a covered work with other separate and independent works, which are not by their nature extensions of the covered work, and which are not combined with it such as to form a larger program, in or on a volume of a storage or distribution medium, is called an "aggregate" if the compilation and its resulting copyright are not used to limit the access or legal rights of the compilation's users beyond what the individual works permit. Inclusion of a covered work in an aggregate does not cause this License to apply to the other parts of the aggregate. 6. Conveying Non-Source Forms. You may convey a covered work in object code form under the terms of sections 4 and 5, provided that you also convey the machine-readable Corresponding Source under the terms of this License, in one of these ways: a. Convey the object code in, or embodied in, a physical product (including a physical distribution medium), accompanied by the Corresponding Source fixed on a durable physical medium customarily used for software interchange. b. Convey the object code in, or embodied in, a physical product (including a physical distribution medium), accompanied by a written offer, valid for at least three years and valid for as long as you offer spare parts or customer support for that product model, to give anyone who possesses the object code either (1) a copy of the Corresponding Source for all the software in the product that is covered by this License, on a durable physical medium customarily used for software interchange, for a price no more than your reasonable cost of physically performing this conveying of source, or (2) access to copy the Corresponding Source from a network server at no charge. c. Convey individual copies of the object code with a copy of the written offer to provide the Corresponding Source. This alternative is allowed only occasionally and noncommercially, and only if you received the object code with such an offer, in accord with subsection 6b. d. Convey the object code by offering access from a designated place (gratis or for a charge), and offer equivalent access to the Corresponding Source in the same way through the same place at no further charge. You need not require recipients to copy the Corresponding Source along with the object code. If the place to copy the object code is a network server, the Corresponding Source may be on a different server (operated by you or a third party) that supports equivalent copying facilities, provided you maintain clear directions next to the object code saying where to find the Corresponding Source. Regardless of what server hosts the Corresponding Source, you remain obligated to ensure that it is available for as long as needed to satisfy these requirements. e. Convey the object code using peer-to-peer transmission, provided you inform other peers where the object code and Corresponding Source of the work are being offered to the general public at no charge under subsection 6d. A separable portion of the object code, whose source code is excluded from the Corresponding Source as a System Library, need not be included in conveying the object code work. A "User Product" is either (1) a "consumer product", which means any tangible personal property which is normally used for personal, family, or household purposes, or (2) anything designed or sold for incorporation into a dwelling. In determining whether a product is a consumer product, doubtful cases shall be resolved in favor of coverage. For a particular product received by a particular user, "normally used" refers to a typical or common use of that class of product, regardless of the status of the particular user or of the way in which the particular user actually uses, or expects or is expected to use, the product. A product is a consumer product regardless of whether the product has substantial commercial, industrial or non-consumer uses, unless such uses represent the only significant mode of use of the product. "Installation Information" for a User Product means any methods, procedures, authorization keys, or other information required to install and execute modified versions of a covered work in that User Product from a modified version of its Corresponding Source. The information must suffice to ensure that the continued functioning of the modified object code is in no case prevented or interfered with solely because modification has been made. If you convey an object code work under this section in, or with, or specifically for use in, a User Product, and the conveying occurs as part of a transaction in which the right of possession and use of the User Product is transferred to the recipient in perpetuity or for a fixed term (regardless of how the transaction is characterized), the Corresponding Source conveyed under this section must be accompanied by the Installation Information. But this requirement does not apply if neither you nor any third party retains the ability to install modified object code on the User Product (for example, the work has been installed in ROM). The requirement to provide Installation Information does not include a requirement to continue to provide support service, warranty, or updates for a work that has been modified or installed by the recipient, or for the User Product in which it has been modified or installed. Access to a network may be denied when the modification itself materially and adversely affects the operation of the network or violates the rules and protocols for communication across the network. Corresponding Source conveyed, and Installation Information provided, in accord with this section must be in a format that is publicly documented (and with an implementation available to the public in source code form), and must require no special password or key for unpacking, reading or copying. 7. Additional Terms. "Additional permissions" are terms that supplement the terms of this License by making exceptions from one or more of its conditions. Additional permissions that are applicable to the entire Program shall be treated as though they were included in this License, to the extent that they are valid under applicable law. If additional permissions apply only to part of the Program, that part may be used separately under those permissions, but the entire Program remains governed by this License without regard to the additional permissions. When you convey a copy of a covered work, you may at your option remove any additional permissions from that copy, or from any part of it. (Additional permissions may be written to require their own removal in certain cases when you modify the work.) You may place additional permissions on material, added by you to a covered work, for which you have or can give appropriate copyright permission. Notwithstanding any other provision of this License, for material you add to a covered work, you may (if authorized by the copyright holders of that material) supplement the terms of this License with terms: a. Disclaiming warranty or limiting liability differently from the terms of sections 15 and 16 of this License; or b. Requiring preservation of specified reasonable legal notices or author attributions in that material or in the Appropriate Legal Notices displayed by works containing it; or c. Prohibiting misrepresentation of the origin of that material, or requiring that modified versions of such material be marked in reasonable ways as different from the original version; or d. Limiting the use for publicity purposes of names of licensors or authors of the material; or e. Declining to grant rights under trademark law for use of some trade names, trademarks, or service marks; or f. Requiring indemnification of licensors and authors of that material by anyone who conveys the material (or modified versions of it) with contractual assumptions of liability to the recipient, for any liability that these contractual assumptions directly impose on those licensors and authors. All other non-permissive additional terms are considered "further restrictions" within the meaning of section 10. If the Program as you received it, or any part of it, contains a notice stating that it is governed by this License along with a term that is a further restriction, you may remove that term. If a license document contains a further restriction but permits relicensing or conveying under this License, you may add to a covered work material governed by the terms of that license document, provided that the further restriction does not survive such relicensing or conveying. If you add terms to a covered work in accord with this section, you must place, in the relevant source files, a statement of the additional terms that apply to those files, or a notice indicating where to find the applicable terms. Additional terms, permissive or non-permissive, may be stated in the form of a separately written license, or stated as exceptions; the above requirements apply either way. 8. Termination. You may not propagate or modify a covered work except as expressly provided under this License. Any attempt otherwise to propagate or modify it is void, and will automatically terminate your rights under this License (including any patent licenses granted under the third paragraph of section 11). However, if you cease all violation of this License, then your license from a particular copyright holder is reinstated (a) provisionally, unless and until the copyright holder explicitly and finally terminates your license, and (b) permanently, if the copyright holder fails to notify you of the violation by some reasonable means prior to 60 days after the cessation. Moreover, your license from a particular copyright holder is reinstated permanently if the copyright holder notifies you of the violation by some reasonable means, this is the first time you have received notice of violation of this License (for any work) from that copyright holder, and you cure the violation prior to 30 days after your receipt of the notice. Termination of your rights under this section does not terminate the licenses of parties who have received copies or rights from you under this License. If your rights have been terminated and not permanently reinstated, you do not qualify to receive new licenses for the same material under section 10. 9. Acceptance Not Required for Having Copies. You are not required to accept this License in order to receive or run a copy of the Program. Ancillary propagation of a covered work occurring solely as a consequence of using peer-to-peer transmission to receive a copy likewise does not require acceptance. However, nothing other than this License grants you permission to propagate or modify any covered work. These actions infringe copyright if you do not accept this License. Therefore, by modifying or propagating a covered work, you indicate your acceptance of this License to do so. 10. Automatic Licensing of Downstream Recipients. Each time you convey a covered work, the recipient automatically receives a license from the original licensors, to run, modify and propagate that work, subject to this License. You are not responsible for enforcing compliance by third parties with this License. An "entity transaction" is a transaction transferring control of an organization, or substantially all assets of one, or subdividing an organization, or merging organizations. If propagation of a covered work results from an entity transaction, each party to that transaction who receives a copy of the work also receives whatever licenses to the work the party's predecessor in interest had or could give under the previous paragraph, plus a right to possession of the Corresponding Source of the work from the predecessor in interest, if the predecessor has it or can get it with reasonable efforts. You may not impose any further restrictions on the exercise of the rights granted or affirmed under this License. For example, you may not impose a license fee, royalty, or other charge for exercise of rights granted under this License, and you may not initiate litigation (including a cross-claim or counterclaim in a lawsuit) alleging that any patent claim is infringed by making, using, selling, offering for sale, or importing the Program or any portion of it. 11. Patents. A "contributor" is a copyright holder who authorizes use under this License of the Program or a work on which the Program is based. The work thus licensed is called the contributor's "contributor version". A contributor's "essential patent claims" are all patent claims owned or controlled by the contributor, whether already acquired or hereafter acquired, that would be infringed by some manner, permitted by this License, of making, using, or selling its contributor version, but do not include claims that would be infringed only as a consequence of further modification of the contributor version. For purposes of this definition, "control" includes the right to grant patent sublicenses in a manner consistent with the requirements of this License. Each contributor grants you a non-exclusive, worldwide, royalty-free patent license under the contributor's essential patent claims, to make, use, sell, offer for sale, import and otherwise run, modify and propagate the contents of its contributor version. In the following three paragraphs, a "patent license" is any express agreement or commitment, however denominated, not to enforce a patent (such as an express permission to practice a patent or covenant not to sue for patent infringement). To "grant" such a patent license to a party means to make such an agreement or commitment not to enforce a patent against the party. If you convey a covered work, knowingly relying on a patent license, and the Corresponding Source of the work is not available for anyone to copy, free of charge and under the terms of this License, through a publicly available network server or other readily accessible means, then you must either (1) cause the Corresponding Source to be so available, or (2) arrange to deprive yourself of the benefit of the patent license for this particular work, or (3) arrange, in a manner consistent with the requirements of this License, to extend the patent license to downstream recipients. "Knowingly relying" means you have actual knowledge that, but for the patent license, your conveying the covered work in a country, or your recipient's use of the covered work in a country, would infringe one or more identifiable patents in that country that you have reason to believe are valid. If, pursuant to or in connection with a single transaction or arrangement, you convey, or propagate by procuring conveyance of, a covered work, and grant a patent license to some of the parties receiving the covered work authorizing them to use, propagate, modify or convey a specific copy of the covered work, then the patent license you grant is automatically extended to all recipients of the covered work and works based on it. A patent license is "discriminatory" if it does not include within the scope of its coverage, prohibits the exercise of, or is conditioned on the non-exercise of one or more of the rights that are specifically granted under this License. You may not convey a covered work if you are a party to an arrangement with a third party that is in the business of distributing software, under which you make payment to the third party based on the extent of your activity of conveying the work, and under which the third party grants, to any of the parties who would receive the covered work from you, a discriminatory patent license (a) in connection with copies of the covered work conveyed by you (or copies made from those copies), or (b) primarily for and in connection with specific products or compilations that contain the covered work, unless you entered into that arrangement, or that patent license was granted, prior to 28 March 2007. Nothing in this License shall be construed as excluding or limiting any implied license or other defenses to infringement that may otherwise be available to you under applicable patent law. 12. No Surrender of Others' Freedom. If conditions are imposed on you (whether by court order, agreement or otherwise) that contradict the conditions of this License, they do not excuse you from the conditions of this License. If you cannot convey a covered work so as to satisfy simultaneously your obligations under this License and any other pertinent obligations, then as a consequence you may not convey it at all. For example, if you agree to terms that obligate you to collect a royalty for further conveying from those to whom you convey the Program, the only way you could satisfy both those terms and this License would be to refrain entirely from conveying the Program. 13. Use with the GNU Affero General Public License. Notwithstanding any other provision of this License, you have permission to link or combine any covered work with a work licensed under version 3 of the GNU Affero General Public License into a single combined work, and to convey the resulting work. The terms of this License will continue to apply to the part which is the covered work, but the special requirements of the GNU Affero General Public License, section 13, concerning interaction through a network will apply to the combination as such. 14. Revised Versions of this License. The Free Software Foundation may publish revised and/or new versions of the GNU General Public License from time to time. Such new versions will be similar in spirit to the present version, but may differ in detail to address new problems or concerns. Each version is given a distinguishing version number. If the Program specifies that a certain numbered version of the GNU General Public License "or any later version" applies to it, you have the option of following the terms and conditions either of that numbered version or of any later version published by the Free Software Foundation. If the Program does not specify a version number of the GNU General Public License, you may choose any version ever published by the Free Software Foundation. If the Program specifies that a proxy can decide which future versions of the GNU General Public License can be used, that proxy's public statement of acceptance of a version permanently authorizes you to choose that version for the Program. Later license versions may give you additional or different permissions. However, no additional obligations are imposed on any author or copyright holder as a result of your choosing to follow a later version. 15. Disclaimer of Warranty. THERE IS NO WARRANTY FOR THE PROGRAM, TO THE EXTENT PERMITTED BY APPLICABLE LAW. EXCEPT WHEN OTHERWISE STATED IN WRITING THE COPYRIGHT HOLDERS AND/OR OTHER PARTIES PROVIDE THE PROGRAM "AS IS" WITHOUT WARRANTY OF ANY KIND, EITHER EXPRESSED OR IMPLIED, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. THE ENTIRE RISK AS TO THE QUALITY AND PERFORMANCE OF THE PROGRAM IS WITH YOU. SHOULD THE PROGRAM PROVE DEFECTIVE, YOU ASSUME THE COST OF ALL NECESSARY SERVICING, REPAIR OR CORRECTION. 16. Limitation of Liability. IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN WRITING WILL ANY COPYRIGHT HOLDER, OR ANY OTHER PARTY WHO MODIFIES AND/OR CONVEYS THE PROGRAM AS PERMITTED ABOVE, BE LIABLE TO YOU FOR DAMAGES, INCLUDING ANY GENERAL, SPECIAL, INCIDENTAL OR CONSEQUENTIAL DAMAGES ARISING OUT OF THE USE OR INABILITY TO USE THE PROGRAM (INCLUDING BUT NOT LIMITED TO LOSS OF DATA OR DATA BEING RENDERED INACCURATE OR LOSSES SUSTAINED BY YOU OR THIRD PARTIES OR A FAILURE OF THE PROGRAM TO OPERATE WITH ANY OTHER PROGRAMS), EVEN IF SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH DAMAGES. 17. Interpretation of Sections 15 and 16. If the disclaimer of warranty and limitation of liability provided above cannot be given local legal effect according to their terms, reviewing courts shall apply local law that most closely approximates an absolute waiver of all civil liability in connection with the Program, unless a warranty or assumption of liability accompanies a copy of the Program in return for a fee. END OF TERMS AND CONDITIONS =========================== How to Apply These Terms to Your New Programs ============================================= If you develop a new program, and you want it to be of the greatest possible use to the public, the best way to achieve this is to make it free software which everyone can redistribute and change under these terms. To do so, attach the following notices to the program. It is safest to attach them to the start of each source file to most effectively state the exclusion of warranty; and each file should have at least the "copyright" line and a pointer to where the full notice is found. ONE LINE TO GIVE THE PROGRAM'S NAME AND A BRIEF IDEA OF WHAT IT DOES. Copyright (C) YEAR NAME OF AUTHOR This program is free software: you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation, either version 3 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program. If not, see `http://www.gnu.org/licenses/'. Also add information on how to contact you by electronic and paper mail. If the program does terminal interaction, make it output a short notice like this when it starts in an interactive mode: PROGRAM Copyright (C) YEAR NAME OF AUTHOR This program comes with ABSOLUTELY NO WARRANTY; for details type `show w'. This is free software, and you are welcome to redistribute it under certain conditions; type `show c' for details. The hypothetical commands `show w' and `show c' should show the appropriate parts of the General Public License. Of course, your program's commands might be different; for a GUI interface, you would use an "about box". You should also get your employer (if you work as a programmer) or school, if any, to sign a "copyright disclaimer" for the program, if necessary. For more information on this, and how to apply and follow the GNU GPL, see `http://www.gnu.org/licenses/'. The GNU General Public License does not permit incorporating your program into proprietary programs. If your program is a subroutine library, you may consider it more useful to permit linking proprietary applications with the library. If this is what you want to do, use the GNU Lesser General Public License instead of this License. But first, please read `http://www.gnu.org/philosophy/why-not-lgpl.html'.  File: m4.info, Node: Copying This Manual, Next: Indices, Prev: Copying This Package, Up: Top Appendix B How to make copies of this manual ******************************************** This appendix covers the license for copying this manual. Note that some of the longer examples in this manual are also distributed in the directory `m4-1.4.14/examples/', where a more permissive license is in effect when copying just the examples. * Menu: * GNU Free Documentation License:: License for copying this manual 0707010002c895000081a40000000000000000000000014c5131010000d1040000010000010036ffffffffffffffff0000002400000000root/usr/local/share/info/m4.info-2This is m4.info, produced by makeinfo version 4.13 from m4.texinfo. This manual (24 February 2010) is for GNU M4 (version 1.4.14), a package containing an implementation of the m4 macro language. Copyright (C) 1989, 1990, 1991, 1992, 1993, 1994, 2004, 2005, 2006, 2007, 2008, 2009, 2010 Free Software Foundation, Inc. Permission is granted to copy, distribute and/or modify this document under the terms of the GNU Free Documentation License, Version 1.3 or any later version published by the Free Software Foundation; with no Invariant Sections, no Front-Cover Texts, and no Back-Cover Texts. A copy of the license is included in the section entitled "GNU Free Documentation License." INFO-DIR-SECTION Text creation and manipulation START-INFO-DIR-ENTRY * M4: (m4). A powerful macro processor. END-INFO-DIR-ENTRY  File: m4.info, Node: GNU Free Documentation License, Up: Copying This Manual B.1 License for copying this manual =================================== Version 1.3, 3 November 2008 Copyright (C) 2000, 2001, 2002, 2007, 2008 Free Software Foundation, Inc. `http://fsf.org/' Everyone is permitted to copy and distribute verbatim copies of this license document, but changing it is not allowed. 0. PREAMBLE The purpose of this License is to make a manual, textbook, or other functional and useful document "free" in the sense of freedom: to assure everyone the effective freedom to copy and redistribute it, with or without modifying it, either commercially or noncommercially. Secondarily, this License preserves for the author and publisher a way to get credit for their work, while not being considered responsible for modifications made by others. This License is a kind of "copyleft", which means that derivative works of the document must themselves be free in the same sense. It complements the GNU General Public License, which is a copyleft license designed for free software. We have designed this License in order to use it for manuals for free software, because free software needs free documentation: a free program should come with manuals providing the same freedoms that the software does. But this License is not limited to software manuals; it can be used for any textual work, regardless of subject matter or whether it is published as a printed book. We recommend this License principally for works whose purpose is instruction or reference. 1. APPLICABILITY AND DEFINITIONS This License applies to any manual or other work, in any medium, that contains a notice placed by the copyright holder saying it can be distributed under the terms of this License. Such a notice grants a world-wide, royalty-free license, unlimited in duration, to use that work under the conditions stated herein. The "Document", below, refers to any such manual or work. Any member of the public is a licensee, and is addressed as "you". You accept the license if you copy, modify or distribute the work in a way requiring permission under copyright law. A "Modified Version" of the Document means any work containing the Document or a portion of it, either copied verbatim, or with modifications and/or translated into another language. A "Secondary Section" is a named appendix or a front-matter section of the Document that deals exclusively with the relationship of the publishers or authors of the Document to the Document's overall subject (or to related matters) and contains nothing that could fall directly within that overall subject. (Thus, if the Document is in part a textbook of mathematics, a Secondary Section may not explain any mathematics.) The relationship could be a matter of historical connection with the subject or with related matters, or of legal, commercial, philosophical, ethical or political position regarding them. The "Invariant Sections" are certain Secondary Sections whose titles are designated, as being those of Invariant Sections, in the notice that says that the Document is released under this License. If a section does not fit the above definition of Secondary then it is not allowed to be designated as Invariant. The Document may contain zero Invariant Sections. If the Document does not identify any Invariant Sections then there are none. The "Cover Texts" are certain short passages of text that are listed, as Front-Cover Texts or Back-Cover Texts, in the notice that says that the Document is released under this License. A Front-Cover Text may be at most 5 words, and a Back-Cover Text may be at most 25 words. A "Transparent" copy of the Document means a machine-readable copy, represented in a format whose specification is available to the general public, that is suitable for revising the document straightforwardly with generic text editors or (for images composed of pixels) generic paint programs or (for drawings) some widely available drawing editor, and that is suitable for input to text formatters or for automatic translation to a variety of formats suitable for input to text formatters. A copy made in an otherwise Transparent file format whose markup, or absence of markup, has been arranged to thwart or discourage subsequent modification by readers is not Transparent. An image format is not Transparent if used for any substantial amount of text. A copy that is not "Transparent" is called "Opaque". Examples of suitable formats for Transparent copies include plain ASCII without markup, Texinfo input format, LaTeX input format, SGML or XML using a publicly available DTD, and standard-conforming simple HTML, PostScript or PDF designed for human modification. Examples of transparent image formats include PNG, XCF and JPG. Opaque formats include proprietary formats that can be read and edited only by proprietary word processors, SGML or XML for which the DTD and/or processing tools are not generally available, and the machine-generated HTML, PostScript or PDF produced by some word processors for output purposes only. The "Title Page" means, for a printed book, the title page itself, plus such following pages as are needed to hold, legibly, the material this License requires to appear in the title page. For works in formats which do not have any title page as such, "Title Page" means the text near the most prominent appearance of the work's title, preceding the beginning of the body of the text. The "publisher" means any person or entity that distributes copies of the Document to the public. A section "Entitled XYZ" means a named subunit of the Document whose title either is precisely XYZ or contains XYZ in parentheses following text that translates XYZ in another language. (Here XYZ stands for a specific section name mentioned below, such as "Acknowledgements", "Dedications", "Endorsements", or "History".) To "Preserve the Title" of such a section when you modify the Document means that it remains a section "Entitled XYZ" according to this definition. The Document may include Warranty Disclaimers next to the notice which states that this License applies to the Document. These Warranty Disclaimers are considered to be included by reference in this License, but only as regards disclaiming warranties: any other implication that these Warranty Disclaimers may have is void and has no effect on the meaning of this License. 2. VERBATIM COPYING You may copy and distribute the Document in any medium, either commercially or noncommercially, provided that this License, the copyright notices, and the license notice saying this License applies to the Document are reproduced in all copies, and that you add no other conditions whatsoever to those of this License. You may not use technical measures to obstruct or control the reading or further copying of the copies you make or distribute. However, you may accept compensation in exchange for copies. If you distribute a large enough number of copies you must also follow the conditions in section 3. You may also lend copies, under the same conditions stated above, and you may publicly display copies. 3. COPYING IN QUANTITY If you publish printed copies (or copies in media that commonly have printed covers) of the Document, numbering more than 100, and the Document's license notice requires Cover Texts, you must enclose the copies in covers that carry, clearly and legibly, all these Cover Texts: Front-Cover Texts on the front cover, and Back-Cover Texts on the back cover. Both covers must also clearly and legibly identify you as the publisher of these copies. The front cover must present the full title with all words of the title equally prominent and visible. You may add other material on the covers in addition. Copying with changes limited to the covers, as long as they preserve the title of the Document and satisfy these conditions, can be treated as verbatim copying in other respects. If the required texts for either cover are too voluminous to fit legibly, you should put the first ones listed (as many as fit reasonably) on the actual cover, and continue the rest onto adjacent pages. If you publish or distribute Opaque copies of the Document numbering more than 100, you must either include a machine-readable Transparent copy along with each Opaque copy, or state in or with each Opaque copy a computer-network location from which the general network-using public has access to download using public-standard network protocols a complete Transparent copy of the Document, free of added material. If you use the latter option, you must take reasonably prudent steps, when you begin distribution of Opaque copies in quantity, to ensure that this Transparent copy will remain thus accessible at the stated location until at least one year after the last time you distribute an Opaque copy (directly or through your agents or retailers) of that edition to the public. It is requested, but not required, that you contact the authors of the Document well before redistributing any large number of copies, to give them a chance to provide you with an updated version of the Document. 4. MODIFICATIONS You may copy and distribute a Modified Version of the Document under the conditions of sections 2 and 3 above, provided that you release the Modified Version under precisely this License, with the Modified Version filling the role of the Document, thus licensing distribution and modification of the Modified Version to whoever possesses a copy of it. In addition, you must do these things in the Modified Version: A. Use in the Title Page (and on the covers, if any) a title distinct from that of the Document, and from those of previous versions (which should, if there were any, be listed in the History section of the Document). You may use the same title as a previous version if the original publisher of that version gives permission. B. List on the Title Page, as authors, one or more persons or entities responsible for authorship of the modifications in the Modified Version, together with at least five of the principal authors of the Document (all of its principal authors, if it has fewer than five), unless they release you from this requirement. C. State on the Title page the name of the publisher of the Modified Version, as the publisher. D. Preserve all the copyright notices of the Document. E. Add an appropriate copyright notice for your modifications adjacent to the other copyright notices. F. Include, immediately after the copyright notices, a license notice giving the public permission to use the Modified Version under the terms of this License, in the form shown in the Addendum below. G. Preserve in that license notice the full lists of Invariant Sections and required Cover Texts given in the Document's license notice. H. Include an unaltered copy of this License. I. Preserve the section Entitled "History", Preserve its Title, and add to it an item stating at least the title, year, new authors, and publisher of the Modified Version as given on the Title Page. If there is no section Entitled "History" in the Document, create one stating the title, year, authors, and publisher of the Document as given on its Title Page, then add an item describing the Modified Version as stated in the previous sentence. J. Preserve the network location, if any, given in the Document for public access to a Transparent copy of the Document, and likewise the network locations given in the Document for previous versions it was based on. These may be placed in the "History" section. You may omit a network location for a work that was published at least four years before the Document itself, or if the original publisher of the version it refers to gives permission. K. For any section Entitled "Acknowledgements" or "Dedications", Preserve the Title of the section, and preserve in the section all the substance and tone of each of the contributor acknowledgements and/or dedications given therein. L. Preserve all the Invariant Sections of the Document, unaltered in their text and in their titles. Section numbers or the equivalent are not considered part of the section titles. M. Delete any section Entitled "Endorsements". Such a section may not be included in the Modified Version. N. Do not retitle any existing section to be Entitled "Endorsements" or to conflict in title with any Invariant Section. O. Preserve any Warranty Disclaimers. If the Modified Version includes new front-matter sections or appendices that qualify as Secondary Sections and contain no material copied from the Document, you may at your option designate some or all of these sections as invariant. To do this, add their titles to the list of Invariant Sections in the Modified Version's license notice. These titles must be distinct from any other section titles. You may add a section Entitled "Endorsements", provided it contains nothing but endorsements of your Modified Version by various parties--for example, statements of peer review or that the text has been approved by an organization as the authoritative definition of a standard. You may add a passage of up to five words as a Front-Cover Text, and a passage of up to 25 words as a Back-Cover Text, to the end of the list of Cover Texts in the Modified Version. Only one passage of Front-Cover Text and one of Back-Cover Text may be added by (or through arrangements made by) any one entity. If the Document already includes a cover text for the same cover, previously added by you or by arrangement made by the same entity you are acting on behalf of, you may not add another; but you may replace the old one, on explicit permission from the previous publisher that added the old one. The author(s) and publisher(s) of the Document do not by this License give permission to use their names for publicity for or to assert or imply endorsement of any Modified Version. 5. COMBINING DOCUMENTS You may combine the Document with other documents released under this License, under the terms defined in section 4 above for modified versions, provided that you include in the combination all of the Invariant Sections of all of the original documents, unmodified, and list them all as Invariant Sections of your combined work in its license notice, and that you preserve all their Warranty Disclaimers. The combined work need only contain one copy of this License, and multiple identical Invariant Sections may be replaced with a single copy. If there are multiple Invariant Sections with the same name but different contents, make the title of each such section unique by adding at the end of it, in parentheses, the name of the original author or publisher of that section if known, or else a unique number. Make the same adjustment to the section titles in the list of Invariant Sections in the license notice of the combined work. In the combination, you must combine any sections Entitled "History" in the various original documents, forming one section Entitled "History"; likewise combine any sections Entitled "Acknowledgements", and any sections Entitled "Dedications". You must delete all sections Entitled "Endorsements." 6. COLLECTIONS OF DOCUMENTS You may make a collection consisting of the Document and other documents released under this License, and replace the individual copies of this License in the various documents with a single copy that is included in the collection, provided that you follow the rules of this License for verbatim copying of each of the documents in all other respects. You may extract a single document from such a collection, and distribute it individually under this License, provided you insert a copy of this License into the extracted document, and follow this License in all other respects regarding verbatim copying of that document. 7. AGGREGATION WITH INDEPENDENT WORKS A compilation of the Document or its derivatives with other separate and independent documents or works, in or on a volume of a storage or distribution medium, is called an "aggregate" if the copyright resulting from the compilation is not used to limit the legal rights of the compilation's users beyond what the individual works permit. When the Document is included in an aggregate, this License does not apply to the other works in the aggregate which are not themselves derivative works of the Document. If the Cover Text requirement of section 3 is applicable to these copies of the Document, then if the Document is less than one half of the entire aggregate, the Document's Cover Texts may be placed on covers that bracket the Document within the aggregate, or the electronic equivalent of covers if the Document is in electronic form. Otherwise they must appear on printed covers that bracket the whole aggregate. 8. TRANSLATION Translation is considered a kind of modification, so you may distribute translations of the Document under the terms of section 4. Replacing Invariant Sections with translations requires special permission from their copyright holders, but you may include translations of some or all Invariant Sections in addition to the original versions of these Invariant Sections. You may include a translation of this License, and all the license notices in the Document, and any Warranty Disclaimers, provided that you also include the original English version of this License and the original versions of those notices and disclaimers. In case of a disagreement between the translation and the original version of this License or a notice or disclaimer, the original version will prevail. If a section in the Document is Entitled "Acknowledgements", "Dedications", or "History", the requirement (section 4) to Preserve its Title (section 1) will typically require changing the actual title. 9. TERMINATION You may not copy, modify, sublicense, or distribute the Document except as expressly provided under this License. Any attempt otherwise to copy, modify, sublicense, or distribute it is void, and will automatically terminate your rights under this License. However, if you cease all violation of this License, then your license from a particular copyright holder is reinstated (a) provisionally, unless and until the copyright holder explicitly and finally terminates your license, and (b) permanently, if the copyright holder fails to notify you of the violation by some reasonable means prior to 60 days after the cessation. Moreover, your license from a particular copyright holder is reinstated permanently if the copyright holder notifies you of the violation by some reasonable means, this is the first time you have received notice of violation of this License (for any work) from that copyright holder, and you cure the violation prior to 30 days after your receipt of the notice. Termination of your rights under this section does not terminate the licenses of parties who have received copies or rights from you under this License. If your rights have been terminated and not permanently reinstated, receipt of a copy of some or all of the same material does not give you any rights to use it. 10. FUTURE REVISIONS OF THIS LICENSE The Free Software Foundation may publish new, revised versions of the GNU Free Documentation License from time to time. Such new versions will be similar in spirit to the present version, but may differ in detail to address new problems or concerns. See `http://www.gnu.org/copyleft/'. Each version of the License is given a distinguishing version number. If the Document specifies that a particular numbered version of this License "or any later version" applies to it, you have the option of following the terms and conditions either of that specified version or of any later version that has been published (not as a draft) by the Free Software Foundation. If the Document does not specify a version number of this License, you may choose any version ever published (not as a draft) by the Free Software Foundation. If the Document specifies that a proxy can decide which future versions of this License can be used, that proxy's public statement of acceptance of a version permanently authorizes you to choose that version for the Document. 11. RELICENSING "Massive Multiauthor Collaboration Site" (or "MMC Site") means any World Wide Web server that publishes copyrightable works and also provides prominent facilities for anybody to edit those works. A public wiki that anybody can edit is an example of such a server. A "Massive Multiauthor Collaboration" (or "MMC") contained in the site means any set of copyrightable works thus published on the MMC site. "CC-BY-SA" means the Creative Commons Attribution-Share Alike 3.0 license published by Creative Commons Corporation, a not-for-profit corporation with a principal place of business in San Francisco, California, as well as future copyleft versions of that license published by that same organization. "Incorporate" means to publish or republish a Document, in whole or in part, as part of another Document. An MMC is "eligible for relicensing" if it is licensed under this License, and if all works that were first published under this License somewhere other than this MMC, and subsequently incorporated in whole or in part into the MMC, (1) had no cover texts or invariant sections, and (2) were thus incorporated prior to November 1, 2008. The operator of an MMC Site may republish an MMC contained in the site under CC-BY-SA on the same site at any time before August 1, 2009, provided the MMC is eligible for relicensing. ADDENDUM: How to use this License for your documents ==================================================== To use this License in a document you have written, include a copy of the License in the document and put the following copyright and license notices just after the title page: Copyright (C) YEAR YOUR NAME. Permission is granted to copy, distribute and/or modify this document under the terms of the GNU Free Documentation License, Version 1.3 or any later version published by the Free Software Foundation; with no Invariant Sections, no Front-Cover Texts, and no Back-Cover Texts. A copy of the license is included in the section entitled ``GNU Free Documentation License''. If you have Invariant Sections, Front-Cover Texts and Back-Cover Texts, replace the "with...Texts." line with this: with the Invariant Sections being LIST THEIR TITLES, with the Front-Cover Texts being LIST, and with the Back-Cover Texts being LIST. If you have Invariant Sections without Cover Texts, or some other combination of the three, merge those two alternatives to suit the situation. If your document contains nontrivial examples of program code, we recommend releasing these examples in parallel under your choice of free software license, such as the GNU General Public License, to permit their use in free software.  File: m4.info, Node: Indices, Prev: Copying This Manual, Up: Top Appendix C Indices of concepts and macros ***************************************** * Menu: * Macro index:: Index for all `m4' macros * Concept index:: Index for many concepts  File: m4.info, Node: Macro index, Next: Concept index, Up: Indices C.1 Index for all `m4' macros ============================= This index covers all `m4' builtins, as well as several useful composite macros. References are exclusively to the places where a macro is introduced the first time. [index] * Menu: * __file__: Location. (line 10) * __gnu__: Platform macros. (line 12) * __line__: Location. (line 11) * __os2__: Platform macros. (line 13) * __program__: Location. (line 12) * __unix__: Platform macros. (line 15) * __windows__: Platform macros. (line 17) * argn: Shift. (line 258) * array: Define. (line 56) * array_set: Define. (line 57) * builtin: Builtin. (line 9) * capitalize: Patsubst. (line 55) * changecom: Changecom. (line 10) * changequote: Changequote. (line 10) * changeword: Changeword. (line 23) * cleardivert: Cleardivert. (line 26) * cond: Shift. (line 53) * copy: Composition. (line 120) * curry: Composition. (line 68) * debugfile: Debug Output. (line 11) * debugmode: Debug Levels. (line 78) * decr: Incr. (line 11) * define: Define. (line 10) * define_blind: Composition. (line 11) * defn: Defn. (line 10) * divert: Divert. (line 9) * divnum: Divnum. (line 9) * dnl: Dnl. (line 9) * downcase: Patsubst. (line 54) * dquote: Shift. (line 196) * dquote_elt: Shift. (line 197) * dumpdef: Dumpdef. (line 10) * errprint: Errprint. (line 9) * esyscmd: Esyscmd. (line 9) * eval: Eval. (line 9) * example: Manual. (line 40) * exch: Arguments. (line 13) * fatal_error: M4exit. (line 25) * foreach: Foreach. (line 9) * foreachq: Foreach. (line 10) * forloop: Forloop. (line 9) * format: Format. (line 9) * ifdef: Ifdef. (line 10) * ifelse: Ifelse. (line 11) * include: Include. (line 9) * incr: Incr. (line 10) * index: Index macro. (line 9) * indir: Indir. (line 9) * join: Shift. (line 104) * joinall: Shift. (line 105) * len: Len. (line 9) * m4exit: M4exit. (line 10) * m4wrap: M4wrap. (line 14) * maketemp: Mkstemp. (line 12) * mkstemp: Mkstemp. (line 11) * nargs: Pseudo Arguments. (line 13) * os2: Platform macros. (line 14) * patsubst: Patsubst. (line 9) * popdef: Pushdef. (line 12) * pushdef: Pushdef. (line 11) * quote: Shift. (line 195) * regexp: Regexp. (line 9) * rename: Composition. (line 121) * reverse: Shift. (line 32) * shift: Shift. (line 17) * sinclude: Include. (line 10) * stack_foreach: Stacks. (line 12) * stack_foreach_lifo: Stacks. (line 13) * stack_foreach_sep: Improved copy. (line 16) * stack_foreach_sep_lifo: Improved copy. (line 17) * substr: Substr. (line 9) * syscmd: Syscmd. (line 9) * sysval: Sysval. (line 9) * traceoff: Trace. (line 11) * traceon: Trace. (line 10) * translit: Translit. (line 9) * undefine: Undefine. (line 9) * undivert: Undivert. (line 9) * unix: Platform macros. (line 16) * upcase: Patsubst. (line 53) * windows: Platform macros. (line 18)  File: m4.info, Node: Concept index, Prev: Macro index, Up: Indices C.2 Index for many concepts =========================== [index] * Menu: * argument currying: Composition. (line 63) * arguments to macros <1>: Arguments. (line 6) * arguments to macros: Macro Arguments. (line 6) * arguments to macros, special: Pseudo Arguments. (line 6) * arguments, joining: Shift. (line 100) * arguments, more than nine <1>: Improved foreach. (line 155) * arguments, more than nine <2>: Shift. (line 252) * arguments, more than nine: Arguments. (line 54) * arguments, quoted macro: Quoting Arguments. (line 6) * arguments, reversing: Shift. (line 31) * arithmetic: Arithmetic. (line 6) * arrays: Define. (line 52) * avoiding quadratic behavior: Improved foreach. (line 38) * basic regular expressions <1>: Patsubst. (line 6) * basic regular expressions: Regexp. (line 6) * blind macro <1>: Composition. (line 10) * blind macro <2>: Ifelse. (line 52) * blind macro: Inhibiting Invocation. (line 14) * bug reports: Bugs. (line 6) * builtins, indirect call of: Builtin. (line 6) * builtins, special tokens: Defn. (line 101) * call of builtins, indirect: Builtin. (line 6) * call of macros, indirect: Indir. (line 6) * case statement: Ifelse. (line 69) * changing comment delimiters: Changecom. (line 6) * changing quote delimiters: Changequote. (line 6) * changing syntax: Changeword. (line 6) * characters, translating: Translit. (line 6) * command line: Invoking m4. (line 6) * command line, file names on the: Command line files. (line 6) * command line, macro definitions on the: Preprocessor features. (line 6) * command line, options: Invoking m4. (line 10) * commands, exit status from shell: Sysval. (line 6) * commands, running shell: Shell commands. (line 6) * comment delimiters, changing: Changecom. (line 6) * comments: Comments. (line 6) * comments, copied to output: Changecom. (line 29) * comparing strings: Ifelse. (line 6) * compatibility: Compatibility. (line 6) * composing macros: Composition. (line 6) * concatenating arguments: Shift. (line 100) * conditional, short-circuiting: Shift. (line 51) * conditionals: Ifdef. (line 6) * controlling debugging output: Debug Levels. (line 6) * copying macros: Composition. (line 116) * counting loops: Forloop. (line 6) * currying arguments: Composition. (line 63) * debugging macros: Debugging. (line 6) * debugging output, controlling: Debug Levels. (line 6) * debugging output, saving: Debug Output. (line 6) * decrement operator: Incr. (line 6) * deferring expansion: M4wrap. (line 6) * deferring output: Diversions. (line 6) * defining new macros: Definitions. (line 6) * definition stack <1>: Stacks. (line 6) * definition stack: Pushdef. (line 6) * definitions, displaying macro <1>: Dumpdef. (line 6) * definitions, displaying macro: Defn. (line 6) * deleting macros: Undefine. (line 6) * deleting whitespace in input: Dnl. (line 6) * delimiters, changing <1>: Changecom. (line 6) * delimiters, changing: Changequote. (line 6) * discarding diverted text: Cleardivert. (line 6) * discarding input <1>: Divert. (line 42) * discarding input <2>: Dnl. (line 6) * discarding input: Ifelse. (line 6) * displaying macro definitions: Dumpdef. (line 6) * diversion numbers: Divnum. (line 6) * diverted text, discarding: Cleardivert. (line 6) * diverting output to files: Divert. (line 6) * dumping into frozen file: Using frozen files. (line 6) * error messages, printing: Errprint. (line 6) * errors, fatal: Operation modes. (line 20) * evaluation, of integer expressions: Eval. (line 6) * examples, understanding: Manual. (line 6) * executing shell commands: Shell commands. (line 6) * exit status from shell commands: Sysval. (line 6) * exiting from m4: M4exit. (line 6) * expansion of macros: Macro expansion. (line 6) * expansion, deferring: M4wrap. (line 6) * expansion, tracing macro: Trace. (line 6) * expressions, evaluation of integer: Eval. (line 6) * expressions, regular <1>: Patsubst. (line 6) * expressions, regular: Regexp. (line 6) * extracting substrings: Substr. (line 6) * fast loading of frozen files: Using frozen files. (line 6) * fatal errors: Operation modes. (line 20) * FDL, GNU Free Documentation License: GNU Free Documentation License. (line 6) * file format, frozen file: Frozen file format. (line 6) * file inclusion <1>: Undivert. (line 13) * file inclusion: File Inclusion. (line 6) * file names, on the command line: Command line files. (line 6) * files, diverting output to: Divert. (line 6) * files, names of temporary: Mkstemp. (line 6) * for each loops: Foreach. (line 6) * for loops: Forloop. (line 6) * formatted output: Format. (line 6) * Free Documentation License (FDL), GNU: GNU Free Documentation License. (line 6) * frozen file format: Frozen file format. (line 6) * frozen files for fast loading: Using frozen files. (line 6) * General Public License (GPL), GNU: GNU General Public License. (line 6) * GNU extensions <1>: Extensions. (line 6) * GNU extensions <2>: Using frozen files. (line 6) * GNU extensions <3>: Mkstemp. (line 59) * GNU extensions <4>: Esyscmd. (line 6) * GNU extensions <5>: Eval. (line 125) * GNU extensions <6>: Format. (line 6) * GNU extensions <7>: Patsubst. (line 6) * GNU extensions <8>: Regexp. (line 6) * GNU extensions <9>: Undivert. (line 13) * GNU extensions <10>: Divert. (line 54) * GNU extensions <11>: Search Path. (line 6) * GNU extensions <12>: Debug Output. (line 6) * GNU extensions <13>: Debug Levels. (line 74) * GNU extensions <14>: Builtin. (line 6) * GNU extensions <15>: Indir. (line 6) * GNU extensions <16>: Arguments. (line 54) * GNU extensions <17>: Define. (line 41) * GNU extensions: Inhibiting Invocation. (line 14) * GNU Free Documentation License: GNU Free Documentation License. (line 6) * GNU General Public License: GNU General Public License. (line 6) * GNU M4, history of: History. (line 6) * GPL, GNU General Public License: GNU General Public License. (line 6) * history of m4: History. (line 6) * included files, search path for: Search Path. (line 6) * inclusion, of files <1>: Undivert. (line 13) * inclusion, of files: File Inclusion. (line 6) * increment operator: Incr. (line 6) * indirect call of builtins: Builtin. (line 6) * indirect call of macros: Indir. (line 6) * initialization, frozen state: Using frozen files. (line 6) * input location <1>: Location. (line 6) * input location: Preprocessor features. (line 28) * input tokens: Syntax. (line 6) * input, discarding <1>: Divert. (line 42) * input, discarding <2>: Dnl. (line 6) * input, discarding: Ifelse. (line 6) * input, saving: M4wrap. (line 6) * integer arithmetic: Arithmetic. (line 6) * integer expression evaluation: Eval. (line 6) * invoking m4: Invoking m4. (line 6) * invoking macros: Invocation. (line 6) * iterating over lists: Foreach. (line 6) * joining arguments: Shift. (line 100) * length of strings: Len. (line 6) * lexical structure of words: Changeword. (line 6) * License, code: Copying This Package. (line 6) * License, manual: Copying This Manual. (line 6) * limit, nesting: Limits control. (line 43) * literal output: Pseudo Arguments. (line 106) * local variables: Pushdef. (line 79) * location, input <1>: Location. (line 6) * location, input: Preprocessor features. (line 28) * loops: Shift. (line 10) * loops, counting: Forloop. (line 6) * loops, list iteration: Foreach. (line 6) * M4PATH: Search Path. (line 9) * macro composition: Composition. (line 6) * macro definitions, on the command line: Preprocessor features. (line 6) * macro expansion, tracing: Trace. (line 6) * macro invocation: Invocation. (line 6) * macro, blind <1>: Composition. (line 10) * macro, blind <2>: Ifelse. (line 52) * macro, blind: Inhibiting Invocation. (line 14) * macros, arguments to <1>: Arguments. (line 6) * macros, arguments to: Macro Arguments. (line 6) * macros, copying: Composition. (line 116) * macros, debugging: Debugging. (line 6) * macros, displaying definitions <1>: Dumpdef. (line 6) * macros, displaying definitions: Defn. (line 6) * macros, expansion of: Macro expansion. (line 6) * macros, how to define new: Definitions. (line 6) * macros, how to delete: Undefine. (line 6) * macros, how to rename: Defn. (line 6) * macros, indirect call of: Indir. (line 6) * macros, quoted arguments to: Quoting Arguments. (line 6) * macros, recursive: Shift. (line 6) * macros, special arguments to: Pseudo Arguments. (line 6) * macros, temporary redefinition of: Pushdef. (line 6) * manipulating quotes: Shift. (line 191) * messages, printing error: Errprint. (line 6) * more than nine arguments <1>: Improved foreach. (line 155) * more than nine arguments <2>: Shift. (line 252) * more than nine arguments: Arguments. (line 54) * multibranches: Ifelse. (line 69) * names: Names. (line 6) * nesting limit: Limits control. (line 43) * nine arguments, more than <1>: Improved foreach. (line 155) * nine arguments, more than <2>: Shift. (line 252) * nine arguments, more than: Arguments. (line 54) * numbers: Manual. (line 57) * options, command line: Invoking m4. (line 10) * output, diverting to files: Divert. (line 6) * output, formatted: Format. (line 6) * output, literal: Pseudo Arguments. (line 106) * output, saving debugging: Debug Output. (line 6) * overview of m4: Intro. (line 6) * pattern substitution: Patsubst. (line 6) * platform macros: Platform macros. (line 6) * positional parameters, more than nine: Arguments. (line 54) * POSIX: Extensions. (line 6) * POSIXLY_CORRECT <1>: Incompatibilities. (line 146) * POSIXLY_CORRECT: Invoking m4. (line 10) * preprocessor features: Preprocessor features. (line 6) * printing error messages: Errprint. (line 6) * pushdef stack <1>: Stacks. (line 6) * pushdef stack: Pushdef. (line 6) * quadratic behavior, avoiding: Improved foreach. (line 38) * quote delimiters, changing: Changequote. (line 6) * quote manipulation: Shift. (line 191) * quoted macro arguments: Quoting Arguments. (line 6) * quoted string: Quoted strings. (line 6) * quoting rule of thumb: Quoting Arguments. (line 22) * recursive macros: Shift. (line 6) * redefinition of macros, temporary: Pushdef. (line 6) * regular expressions <1>: Patsubst. (line 6) * regular expressions <2>: Regexp. (line 6) * regular expressions: Changeword. (line 6) * reloading a frozen file: Using frozen files. (line 6) * renaming macros <1>: Composition. (line 116) * renaming macros: Defn. (line 6) * reporting bugs: Bugs. (line 6) * rescanning <1>: Other Incompatibilities. (line 52) * rescanning <2>: Defn. (line 61) * rescanning <3>: Pseudo Arguments. (line 106) * rescanning <4>: Inhibiting Invocation. (line 87) * rescanning: Limits control. (line 56) * reversing arguments: Shift. (line 31) * rule of thumb, quoting: Quoting Arguments. (line 22) * running shell commands: Shell commands. (line 6) * saving debugging output: Debug Output. (line 6) * saving input: M4wrap. (line 6) * search path for included files: Search Path. (line 6) * shell commands, exit status from: Sysval. (line 6) * shell commands, running: Shell commands. (line 6) * short-circuiting conditional: Shift. (line 51) * special arguments to macros: Pseudo Arguments. (line 6) * stack, macro definition <1>: Stacks. (line 6) * stack, macro definition: Pushdef. (line 6) * standard error, output to <1>: Errprint. (line 6) * standard error, output to <2>: Trace. (line 6) * standard error, output to: Dumpdef. (line 6) * status of shell commands: Sysval. (line 6) * status, setting m4 exit: M4exit. (line 6) * string, quoted: Quoted strings. (line 6) * strings, length of: Len. (line 6) * substitution by regular expression: Patsubst. (line 6) * substrings, extracting: Substr. (line 6) * substrings, locating: Index macro. (line 6) * suggestions, reporting: Bugs. (line 6) * suppressing warnings: Macro Arguments. (line 38) * switch statement: Ifelse. (line 69) * synchronization lines: Preprocessor features. (line 28) * syntax, changing: Changeword. (line 6) * temporary file names: Mkstemp. (line 6) * temporary redefinition of macros: Pushdef. (line 6) * TMPDIR: Diversions. (line 10) * tokens: Syntax. (line 6) * tokens, builtin macro: Defn. (line 101) * tokens, special: Other tokens. (line 6) * tracing macro expansion: Trace. (line 6) * translating characters: Translit. (line 6) * undefining macros: Undefine. (line 6) * UNIX commands, exit status from: Sysval. (line 6) * UNIX commands, running: Shell commands. (line 6) * variables, local: Pushdef. (line 79) * warnings, suppressing: Macro Arguments. (line 38) * words: Names. (line 6) * words, lexical structure of: Changeword. (line 6) 0707010002c861000041ed0000000000000000000000034c513104000000000000010000010036ffffffffffffffff0000001300000000root/usr/local/lib0707010002c862000081a40000000000000000000000014c5131000000028e0000010000010036ffffffffffffffff0000002100000000root/usr/local/lib/charset.alias# This file contains a table of character encoding aliases, # suitable for operating system 'solaris2.10'. # It was automatically generated from config.charset. # Packages using this file: m4 gettext-runtime gettext-tools 646 ASCII ISO8859-1 ISO-8859-1 ISO8859-2 ISO-8859-2 ISO8859-3 ISO-8859-3 ISO8859-4 ISO-8859-4 ISO8859-5 ISO-8859-5 ISO8859-6 ISO-8859-6 ISO8859-7 ISO-8859-7 ISO8859-8 ISO-8859-8 ISO8859-9 ISO-8859-9 ISO8859-15 ISO-8859-15 koi8-r KOI8-R ansi-1251 CP1251 BIG5 BIG5 Big5-HKSCS BIG5-HKSCS gb2312 GB2312 GBK GBK GB18030 GB18030 cns11643 EUC-TW 5601 EUC-KR ko_KR.johap92 JOHAB eucJP EUC-JP PCK SHIFT_JIS TIS620.2533 TIS-620 UTF-8 UTF-8 0707010002c863000041ed0000000000000000000000034c513104000000000000010000010036ffffffffffffffff0000001600000000root/usr/local/lib/m40707010002c864000041ed0000000000000000000000024c513104000000000000010000010036ffffffffffffffff0000001f00000000root/usr/local/lib/m4/examples0707010002c88a000081a40000000000000000000000014c513103000002010000010000010036ffffffffffffffff0000002800000000root/usr/local/lib/m4/examples/trace.m4divert(-1) # move(from, to) define(`move', `Move one disk from `$1' to `$2'. ') # _hanoi (cnt, from, to, aux) define(`_hanoi', `ifelse(eval(`$1'<=1), 1, `move($2, $3)', `$0(decr($1), $2, $4, $3)move($2, $3)$0(decr($1), $4, $3, $2)')') # hanoi (cnt) define(`hanoi', `_$0(`$1', source, destination, auxilliary)') divert`'dnl # Debugmode t debugmode(`t') hanoi(2) # Debugmode taeq debugmode(`taeq') hanoi(2) # Debugmode OFF debugmode hanoi(2) # Debugmode ae debugmode(`ae') traceon(`move', `_hanoi') hanoi(2) 0707010002c868000081a40000000000000000000000014c513103000000c00000010000010036ffffffffffffffff0000002800000000root/usr/local/lib/m4/examples/curry.m4divert(`-1') # curry(macro, args) # Expand to a macro call that takes one argument, then invoke # macro(args, extra). define(`curry', `$1(shift($@,)_$0') define(`_curry', ``$1')') divert`'dnl 0707010002c883000081a40000000000000000000000014c513103000001920000010000010036ffffffffffffffff0000002800000000root/usr/local/lib/m4/examples/quote.m4divert(`-1') # quote(args) - convert args to single-quoted string define(`quote', `ifelse(`$#', `0', `', ``$*'')') # dquote(args) - convert args to quoted list of quoted strings define(`dquote', ``$@'') # dquote_elt(args) - convert args to list of double-quoted strings define(`dquote_elt', `ifelse(`$#', `0', `', `$#', `1', ```$1''', ```$1'',$0(shift($@))')') divert`'dnl 0707010002c86f000081a40000000000000000000000014c513103000001680000010000010036ffffffffffffffff0000002b00000000root/usr/local/lib/m4/examples/foreach2.m4include(`quote.m4')dnl divert(`-1') # foreach(x, (item_1, item_2, ..., item_n), stmt) # parenthesized list, improved version define(`foreach', `pushdef(`$1')_$0(`$1', (dquote(dquote_elt$2)), `$3')popdef(`$1')') define(`_arg1', `$1') define(`_foreach', `ifelse(`$2', `(`')', `', `define(`$1', _arg1$2)$3`'$0(`$1', (dquote(shift$2)), `$3')')') divert`'dnl 0707010002c86d000081a40000000000000000000000014c513103000000a20000010000010036ffffffffffffffff0000002700000000root/usr/local/lib/m4/examples/file.m4changequote([[,]])dnl define([[quoteall]], [[patsubst([[[[$*]]]], [[,[ ]+]], [[,]])]])dnl define([[group]], quoteall(include([[/etc/group]])))dnl dnl group()dnl 0707010002c878000081a40000000000000000000000014c5131030000016b0000010000010036ffffffffffffffff0000002800000000root/usr/local/lib/m4/examples/hanoi.m4divert(-1) # move(from, to) define(`move', `Move one disk from `$1' to `$2'. ') # _hanoi (cnt, from, to, aux) define(`_hanoi', `ifelse(eval(`$1'<=1), 1, `move($2, $3)', `$0(decr($1), $2, $4, $3)move($2, $3)$0(decr($1), $4, $3, $2)')') # hanoi (cnt) define(`hanoi', `_$0(`$1', source, destination, auxilliary)') # traceon(`move', `_hanoi', `decr') divert`'dnl 0707010002c885000081a40000000000000000000000014c513103000000a50000010000010036ffffffffffffffff0000002a00000000root/usr/local/lib/m4/examples/reverse.m4define(`reverse', `ifelse(eval($# > 1), 1, `reverse(shift($@)), `$1'', ``$1'')') ``'' => reverse ``hej'' => reverse(hej) ``hej, med, dig'' => reverse(hej, med, dig) 0707010002c86c000081a40000000000000000000000014c513103000000510000010000010036ffffffffffffffff0000002600000000root/usr/local/lib/m4/examples/exp.m4define(`countdown', `$1 ifelse(eval($1 > 0), 1, `countdown(decr($1))', `Done')') 0707010002c881000081a40000000000000000000000014c513103000001310000010000010036ffffffffffffffff0000002b00000000root/usr/local/lib/m4/examples/patsubst.m4# traceon(`patsubst') patsubst(`GNUs not Unix', `^', `OBS: ') patsubst(`GNUs not Unix', `\<', `OBS: ') patsubst(`GNUs not Unix', `\<\w', `\0=') patsubst(`GNUs not Unix', `\w*', `(\0)') patsubst(`GNUs not Unix', `\w+', `(\0)') patsubst(`GNUs not Unix', `\w+') patsubst(`GNUs not '` Unix', `[ ]+', ` ') 0707010002c87a000081a40000000000000000000000014c513103000000280000010000010036ffffffffffffffff0000002700000000root/usr/local/lib/m4/examples/incl.m4Include file start foo Include file end 0707010002c867000081a40000000000000000000000014c513103000000a70000010000010036ffffffffffffffff0000002b00000000root/usr/local/lib/m4/examples/comments.m4# An ordinary comment define(`foo', # A comment in a macro `Macro `foo' expansion') foo define(`comment', `*** Macro `comment' expansion ***') changecom(`@', `@') foo 0707010002c877000081a40000000000000000000000014c513103000001320000010000010036ffffffffffffffff0000002800000000root/usr/local/lib/m4/examples/fstab.m4define(`concat', `translit(``$*'', ` ')') define(`fsent', `format(`%-25s %-16s nfs %-16s 0 0', `$1:$2', `$3', concat$4)') fsent(freja, /home/gevn, /home/gevn, (rw, soft, bg, grpid)) fsent(freja, /home/freja, /home/freja, (rw, soft, grpid)) fsent(rimfaxe, /home/rimfaxe, /home/rimfaxe, (rw, soft, bg)) 0707010002c87f000081a40000000000000000000000014c513103000000c00000010000010036ffffffffffffffff0000002700000000root/usr/local/lib/m4/examples/misc.m4divert(-1) define(`HOST', `vale') define(`TMP', maketemp(`/tmp/hejXXXXXX')) syscmd(`ypmatch' HOST `hosts | awk "{print \$1}"' > TMP) define(`IP', include(TMP)) syscmd(`rm -f' TMP) divert IP 0707010002c890000081a40000000000000000000000014c5131030000015f0000010000010036ffffffffffffffff0000002c00000000root/usr/local/lib/m4/examples/wraplifo2.m4dnl Redefine m4wrap to have LIFO semantics, improved example. include(`join.m4')dnl define(`_m4wrap', defn(`m4wrap'))dnl define(`_arg1', `$1')dnl define(`m4wrap', `ifdef(`_$0_text', `define(`_$0_text', joinall(` ', $@)defn(`_$0_text'))', `_$0(`_arg1(defn(`_$0_text')undefine(`_$0_text'))')dnl define(`_$0_text', joinall(` ', $@))')')dnl 0707010002c889000081a40000000000000000000000014c5131030000014c0000010000010036ffffffffffffffff0000002c00000000root/usr/local/lib/m4/examples/sysv-args.m4divert(-1) define(`nargs', `$#') define(`concat', `ifelse(1, $#, `$1', `$1` 'concat(shift($@))')') traceon(`concat', `nargs') divert nargs nargs() nargs(1,2,3,4,5,6) concat() concat(`hej', `med', `dig') concat(`hej', `med', `dig', `en gang igen') concat(an, awful, lot, of, argument, at, least, more, that, ten, silly, arguments) 0707010002c88f000081a40000000000000000000000014c5131030000017d0000010000010036ffffffffffffffff0000002b00000000root/usr/local/lib/m4/examples/wraplifo.m4dnl Redefine m4wrap to have LIFO semantics. define(`_m4wrap_level', `0')dnl define(`_m4wrap', defn(`m4wrap'))dnl define(`m4wrap', `ifdef(`m4wrap'_m4wrap_level, `define(`m4wrap'_m4wrap_level, `$1'defn(`m4wrap'_m4wrap_level))', `_m4wrap(`define(`_m4wrap_level', incr(_m4wrap_level))dnl m4wrap'_m4wrap_level)dnl define(`m4wrap'_m4wrap_level, `$1')')')dnl 0707010002c86b000081a40000000000000000000000014c513103000000cd0000010000010036ffffffffffffffff0000002a00000000root/usr/local/lib/m4/examples/esyscmd.m4define(`hostname', esyscmd(`hostname'))dnl `hostname = >>'hostname`<<' define(`hostname', pushdef(`_tmp', `$1')_tmp(translit(esyscmd(`hostname'), `.', `,'))`'popdef(`_tmp'))dnl `hostname = >>'hostname`<<' 0707010002c88b000081a40000000000000000000000014c513103000001090000010000010036ffffffffffffffff0000002b00000000root/usr/local/lib/m4/examples/translit.m4# traceon(`translit')dnl translit(`GNUs not Unix', `a-z') translit(`GNUs not Unix', `a-z', `A-Z') translit(`GNUs not Unix', `A-Z', `a-z') translit(`GNUs not Unix', `A-Z') translit(`a-z', `a-') translit(`A-Z', `A-Z-', `-A-Z') translit(`GNUs not Unix', `Z-A', `a-z') 0707010002c887000081a40000000000000000000000014c513103000002e90000010000010036ffffffffffffffff0000002c00000000root/usr/local/lib/m4/examples/stack_sep.m4divert(`-1') # stack_foreach_sep(macro, pre, post, sep) # Invoke PRE`'defn`'POST with a single argument of each definition # from the definition stack of MACRO, starting with the oldest, and # separated by SEP between definitions. define(`stack_foreach_sep', `_stack_reverse_sep(`$1', `tmp-$1')'dnl `_stack_reverse_sep(`tmp-$1', `$1', `$2`'defn(`$1')$3', `$4`'')') # stack_foreach_sep_lifo(macro, pre, post, sep) # Like stack_foreach_sep, but starting with the newest definition. define(`stack_foreach_sep_lifo', `_stack_reverse_sep(`$1', `tmp-$1', `$2`'defn(`$1')$3', `$4`'')'dnl `_stack_reverse_sep(`tmp-$1', `$1')') define(`_stack_reverse_sep', `ifdef(`$1', `pushdef(`$2', defn(`$1'))$3`'popdef(`$1')$0( `$1', `$2', `$4$3')')') divert`'dnl 0707010002c879000081a40000000000000000000000014c5131030000001e0000010000010036ffffffffffffffff0000002c00000000root/usr/local/lib/m4/examples/incl-test.m4`include test file.' define() 0707010002c873000081a40000000000000000000000014c513103000001870000010000010036ffffffffffffffff0000002c00000000root/usr/local/lib/m4/examples/foreachq4.m4include(`forloop2.m4')dnl divert(`-1') # foreachq(x, `item_1, item_2, ..., item_n', stmt) # quoted list, version based on forloop define(`foreachq', `ifelse(`$2', `', `', `_$0(`$1', `$3', $2)')') define(`_foreachq', `pushdef(`$1', forloop(`$1', `3', `$#', `$0_(`1', `2', indir(`$1'))')`popdef( `$1')')indir(`$1', $@)') define(`_foreachq_', ``define(`$$1', `$$3')$$2`''') divert`'dnl 0707010002c866000081a40000000000000000000000014c513103000002f00000010000010036ffffffffffffffff0000002e00000000root/usr/local/lib/m4/examples/capitalize2.m4divert(`-1') # upcase(text) # downcase(text) # capitalize(text) # change case of text, improved version define(`upcase', `translit(`$*', `a-z', `A-Z')') define(`downcase', `translit(`$*', `A-Z', `a-z')') define(`_arg1', `$1') define(`_to_alt', `changequote(`<<[', `]>>')') define(`_from_alt', `changequote(<<[`]>>, <<[']>>)') define(`_upcase_alt', `translit(<<[$*]>>, <<[a-z]>>, <<[A-Z]>>)') define(`_downcase_alt', `translit(<<[$*]>>, <<[A-Z]>>, <<[a-z]>>)') define(`_capitalize_alt', `regexp(<<[$1]>>, <<[^\(\w\)\(\w*\)]>>, <<[_upcase_alt(<<[<<[\1]>>]>>)_downcase_alt(<<[<<[\2]>>]>>)]>>)') define(`capitalize', `_arg1(_to_alt()patsubst(<<[<<[$*]>>]>>, <<[\w+]>>, _from_alt()`]>>_$0_alt(<<[\&]>>)<<['_to_alt())_from_alt())') divert`'dnl 0707010002c88d000081a40000000000000000000000014c513103000000860000010000010036ffffffffffffffff0000002700000000root/usr/local/lib/m4/examples/wrap.m4divert(-1) m4wrap(`Wrapper no. 1 ') m4wrap(`Wrapper no. 2 m4wrap(`Wrapper no. 3 m4wrap(`Wrapper no. 4 ')')') divert No. 33: The End. 0707010002c87d000081a40000000000000000000000014c513103000002470000010000010036ffffffffffffffff0000002700000000root/usr/local/lib/m4/examples/join.m4divert(`-1') # join(sep, args) - join each non-empty ARG into a single # string, with each element separated by SEP define(`join', `ifelse(`$#', `2', ``$2'', `ifelse(`$2', `', `', ``$2'_')$0(`$1', shift(shift($@)))')') define(`_join', `ifelse(`$#$2', `2', `', `ifelse(`$2', `', `', ``$1$2'')$0(`$1', shift(shift($@)))')') # joinall(sep, args) - join each ARG, including empty ones, # into a single string, with each element separated by SEP define(`joinall', ``$2'_$0(`$1', shift($@))') define(`_joinall', `ifelse(`$#', `2', `', ``$1$3'$0(`$1', shift(shift($@)))')') divert`'dnl 0707010002c87b000081a40000000000000000000000014c513103000000690000010000010036ffffffffffffffff0000002a00000000root/usr/local/lib/m4/examples/include.m4Beginning. include(`NOFILE') Intermidiate include(`test/incl-test.m4') After include(`NOFILE') very late 0707010002c874000081a40000000000000000000000014c513103000000e00000010000010036ffffffffffffffff0000002a00000000root/usr/local/lib/m4/examples/forloop.m4divert(`-1') # forloop(var, from, to, stmt) - simple version define(`forloop', `pushdef(`$1', `$2')_forloop($@)popdef(`$1')') define(`_forloop', `$4`'ifelse($1, `$3', `', `define(`$1', incr($1))$0($@)')') divert`'dnl 0707010002c88e000081a40000000000000000000000014c513103000001840000010000010036ffffffffffffffff0000002b00000000root/usr/local/lib/m4/examples/wrapfifo.m4dnl Redefine m4wrap to have FIFO semantics. define(`_m4wrap_level', `0')dnl define(`m4wrap', `ifdef(`m4wrap'_m4wrap_level, `define(`m4wrap'_m4wrap_level, defn(`m4wrap'_m4wrap_level)`$1')', `builtin(`m4wrap', `define(`_m4wrap_level', incr(_m4wrap_level))dnl m4wrap'_m4wrap_level)dnl define(`m4wrap'_m4wrap_level, `$1')')')dnl 0707010002c87c000081a40000000000000000000000014c5131030000011d0000010000010036ffffffffffffffff0000002800000000root/usr/local/lib/m4/examples/indir.m4define(`%%$$##', `>>>$0<<< cnt $#') # indir(`%%$$##', nonsens, nonsens) indir(`%%$$##', nonsens, nonsens) # indir(`indir', `%%$$##', nonsens) indir(`indir', `%%$$##', nonsens) # indir(`indir', `indir', `indir', `indir', `%%$$##') indir(`indir', `indir', `indir', `indir', `%%$$##') 0707010002c86a000081a40000000000000000000000014c513103000000880000010000010036ffffffffffffffff0000002800000000root/usr/local/lib/m4/examples/debug.m4define(`countdown', `$1 ifelse(eval($1 > 0), 1, `countdown(decr($1))', `Liftoff')') debugmode(`aeqc') traceon(`countdown') countdown(2) 0707010002c870000081a40000000000000000000000014c513103000001450000010000010036ffffffffffffffff0000002b00000000root/usr/local/lib/m4/examples/foreachq.m4include(`quote.m4')dnl divert(`-1') # foreachq(x, `item_1, item_2, ..., item_n', stmt) # quoted list, simple version define(`foreachq', `pushdef(`$1')_foreachq($@)popdef(`$1')') define(`_arg1', `$1') define(`_foreachq', `ifelse(quote($2), `', `', `define(`$1', `_arg1($2)')$3`'$0(`$1', `shift($2)', `$3')')') divert`'dnl 0707010002c865000081a40000000000000000000000014c513103000001810000010000010036ffffffffffffffff0000002d00000000root/usr/local/lib/m4/examples/capitalize.m4divert(`-1') # upcase(text) # downcase(text) # capitalize(text) # change case of text, simple version define(`upcase', `translit(`$*', `a-z', `A-Z')') define(`downcase', `translit(`$*', `A-Z', `a-z')') define(`_capitalize', `regexp(`$1', `^\(\w\)\(\w*\)', `upcase(`\1')`'downcase(`\2')')') define(`capitalize', `patsubst(`$1', `\w+', `_$0(`\&')')') divert`'dnl 0707010002c871000081a40000000000000000000000014c5131030000017a0000010000010036ffffffffffffffff0000002c00000000root/usr/local/lib/m4/examples/foreachq2.m4include(`quote.m4')dnl divert(`-1') # foreachq(x, `item_1, item_2, ..., item_n', stmt) # quoted list, improved version define(`foreachq', `pushdef(`$1')_$0($@)popdef(`$1')') define(`_arg1q', ``$1'') define(`_rest', `ifelse(`$#', `1', `', `dquote(shift($@))')') define(`_foreachq', `ifelse(`$2', `', `', `define(`$1', _arg1q($2))$3`'$0(`$1', _rest($2), `$3')')') divert`'dnl 0707010002c882000081a40000000000000000000000014c5131030000017b0000010000010036ffffffffffffffff0000002a00000000root/usr/local/lib/m4/examples/pushpop.m4divert(-1) pushdef(`hej', `def 1.') dumpdef(`hej') pushdef(`hej', `def 2.') dumpdef(`hej') pushdef(`hej', `def 3.') dumpdef(`hej') pushdef(`hej', `def 4.') dumpdef(`hej') popdef(`hej') dumpdef(`hej') popdef(`hej') dumpdef(`hej') popdef(`hej') dumpdef(`hej') popdef(`hej') dumpdef(`hej') popdef(`hej') dumpdef(`hej') popdef(`hej') dumpdef(`mac2') popdef(`mac2') dumpdef(`mac2') 0707010002c872000081a40000000000000000000000014c5131030000014d0000010000010036ffffffffffffffff0000002c00000000root/usr/local/lib/m4/examples/foreachq3.m4divert(`-1') # foreachq(x, `item_1, item_2, ..., item_n', stmt) # quoted list, alternate improved version define(`foreachq', `ifelse(`$2', `', `', `pushdef(`$1')_$0(`$1', `$3', `', $2)popdef(`$1')')') define(`_foreachq', `ifelse(`$#', `3', `', `define(`$1', `$4')$2`'$0(`$1', `$2', shift(shift(shift($@))))')') divert`'dnl 0707010002c886000081a40000000000000000000000014c513103000002900000010000010036ffffffffffffffff0000002800000000root/usr/local/lib/m4/examples/stack.m4divert(`-1') # stack_foreach(macro, action) # Invoke ACTION with a single argument of each definition # from the definition stack of MACRO, starting with the oldest. define(`stack_foreach', `_stack_reverse(`$1', `tmp-$1')'dnl `_stack_reverse(`tmp-$1', `$1', `$2(defn(`$1'))')') # stack_foreach_lifo(macro, action) # Invoke ACTION with a single argument of each definition # from the definition stack of MACRO, starting with the newest. define(`stack_foreach_lifo', `_stack_reverse(`$1', `tmp-$1', `$2(defn(`$1'))')'dnl `_stack_reverse(`tmp-$1', `$1')') define(`_stack_reverse', `ifdef(`$1', `pushdef(`$2', defn(`$1'))$3`'popdef(`$1')$0($@)')') divert`'dnl 0707010002c884000081a40000000000000000000000014c513103000001770000010000010036ffffffffffffffff0000002900000000root/usr/local/lib/m4/examples/regexp.m4traceon(`regexp')dnl regexp(`hej med dig', `.*', `>>\0<<') regexp(`hej med dig', `\w*', `>>\0<<') regexp(`hej med dig', `.+', `>>\0<<') regexp(`hej med dig', `m\w+', `>>\0<<') regexp(`hej med dig', `m\(.*\)', `>>\0<< >>\1<<') regexp(`hej med dig', `.*') regexp(`hej med dig', `\w*') regexp(`hej med dig', `.+') regexp(`hej med dig', `m\w+') regexp(`hej med dig', `m\(.*\)') 0707010002c87e000081a40000000000000000000000014c513103000003a20000010000010036ffffffffffffffff0000002700000000root/usr/local/lib/m4/examples/loop.m4dnl Stress test for recursion algorithms. Usage: dnl m4 -Ipath/to/examples [-Doptions] loop.m4 dnl Options include: dnl -Dalt[=] - test with foreachq instead of foreachq2, default 3 dnl -Dlimit= - set upper limit of sequence to , default 1000 dnl -Dverbose - print the sequence to the screen, rather than discarding dnl -Ddebug[=] - execute after forloop but before foreach dnl -Dsleep= - sleep for seconds before exit, to allow time dnl to examine peak process memory usage include(`forloop2.m4')dnl include(`quote.m4')dnl ifelse(alt, `alt', `define(`alt', `2')', alt, `', `define(`alt', `3')')dnl include(`foreachq'alt`.m4')dnl ifdef(`limit', `', `define(`limit', `1000')')dnl ifdef(`verbose', `', `divert(`-1')')dnl ifdef(`debug', `', `define(`debug')')dnl foreachq(`i', dquote(1forloop(`i', `2', limit, `,i'))debug, ` i') ifdef(`sleep',`syscmd(`echo done>/dev/tty;sleep 'sleep)')dnl 0707010002c869000081a40000000000000000000000014c5131030000007b0000010000010036ffffffffffffffff0000002a00000000root/usr/local/lib/m4/examples/ddivert.m4divert(1)Text diverted a first time. divert(0)undivert(1)dnl divert(1)Text diverted a second time. divert(0)undivert(1)dnl 0707010002c876000081a40000000000000000000000014c513103000002210000010000010036ffffffffffffffff0000002b00000000root/usr/local/lib/m4/examples/forloop3.m4divert(`-1') # forloop_arg(from, to, macro) - invoke MACRO(value) for # each value between FROM and TO, without define overhead define(`forloop_arg', `ifelse(eval(`($1) <= ($2)'), `1', `_forloop(`$1', eval(`$2'), `$3(', `)')')') # forloop(var, from, to, stmt) - refactored to share code define(`forloop', `ifelse(eval(`($2) <= ($3)'), `1', `pushdef(`$1')_forloop(eval(`$2'), eval(`$3'), `define(`$1',', `)$4')popdef(`$1')')') define(`_forloop', `$3`$1'$4`'ifelse(`$1', `$2', `', `$0(incr(`$1'), `$2', `$3', `$4')')') divert`'dnl 0707010002c888000081a40000000000000000000000014c5131030000011e0000010000010036ffffffffffffffff0000002d00000000root/usr/local/lib/m4/examples/sync-lines.m4# Several input lines, expanding to one define(`foo', ``foo' line one. `foo' line two. `foo' line three.') xyz foo # Several input lines, expanding to none define(`foo', ``foo' line one. `foo' line two. `foo' line three.')dnl # one input line, expanding to several output lines foo foo 0707010002c880000081a40000000000000000000000014c513103000001790000010000010036ffffffffffffffff0000002e00000000root/usr/local/lib/m4/examples/multiquotes.m4traceon changequote([,])dnl changequote([``], [''])dnl ````traceon'''' define(``foo'', ````FOO'''')dnl dumpdef(``foo'')dnl changequote(``!'', ``!'')dnl !foo! foo dumpdef(!foo!)dnl define(!bar!, !BAR!) bar changequote(!>*>*>*>*>!, !<*<*<*<**>*>*>*>foo bar<*<*<*<*< foo bar >*>*>*>*>*>*><*<*<*<*<*<*< dumpdef(>*>*>*>*>foo<*<*<*<*<, >*>*>*>*>bar<*<*<*<*<)dnl 0707010002c86e000081a40000000000000000000000014c513103000001280000010000010036ffffffffffffffff0000002a00000000root/usr/local/lib/m4/examples/foreach.m4divert(`-1') # foreach(x, (item_1, item_2, ..., item_n), stmt) # parenthesized list, simple version define(`foreach', `pushdef(`$1')_foreach($@)popdef(`$1')') define(`_arg1', `$1') define(`_foreach', `ifelse(`$2', `()', `', `define(`$1', _arg1$2)$3`'$0(`$1', (shift$2), `$3')')') divert`'dnl 0707010002c875000081a40000000000000000000000014c513103000001d90000010000010036ffffffffffffffff0000002b00000000root/usr/local/lib/m4/examples/forloop2.m4divert(`-1') # forloop(var, from, to, stmt) - improved version: # works even if VAR is not a strict macro name # performs sanity check that FROM is larger than TO # allows complex numerical expressions in TO and FROM define(`forloop', `ifelse(eval(`($2) <= ($3)'), `1', `pushdef(`$1')_$0(`$1', eval(`$2'), eval(`$3'), `$4')popdef(`$1')')') define(`_forloop', `define(`$1', `$2')$4`'ifelse(`$2', `$3', `', `$0(`$1', incr(`$2'), `$3', `$4')')') divert`'dnl 0707010002c88c000081a40000000000000000000000014c5131030000007a0000010000010036ffffffffffffffff0000002b00000000root/usr/local/lib/m4/examples/undivert.m4define(`undiverted', `UNDIVERTED') # undiverted file. undivert(`undivert.incl') # included file. include(`undivert.incl') 0707010002c85f000041ed0000000000000000000000024c513104000000000000010000010036ffffffffffffffff0000001300000000root/usr/local/bin0707010002c860000081ed0000000000000000000000014c5131010012f7f00000010000010036ffffffffffffffff0000001600000000root/usr/local/bin/m4ELF+i@@@8@! @@X2(Hp/usr/lib/sparcv9/ld.so.1  #%'),-./258;<=>?@ABDEGJLMNOPQRTVXZ[\]_`adefgijlnprtvwx{}~     !#%&)+,-.01345678:<=>@CEHIJKLMNOPQRSTUWXY[]_abefghjlnopqrtuvyz{} !"$&(*+0134679:CFHIKSUWY^bchkmoqsuyz| "$'(*/29;?ABDFGVZ\^`cdikmswx|~ `"' E 8Rq ֠  ` WH b4@ pX  p  \ 4& 9A IM Sdl0  ` W`( 0 @ox `$ @,/ 00,@qK X@_ X8g`l`P M [  %  8 q #EK 1x0` srP@@  p H\ lP8` d4 &t? PJ  P8] Tq @ D  r) /Q r 4=0  b8H ?H  i t? D"@+@2<PX X` mi {pdt |q  X , 8@@ r0o8HUth ` `@"`01  L! = mpW^ xj< d` Pq <߀]8 ڠ #  * 0 D  Rop mX  X  (8   `       |    OH X -]P Or, b w  v |       q0  q  `t   =  T O o `q g8 ۀ    `D       8 \ K܀ R 0P f h4%  t@    PT r   ?h$  ͸$  b8  ,x G `   Hh D `    D  t  S0`#  8>GڀN[ Tek x/ &HX  h k\ 8 ux \  0 TD`  L XXq^pu P}   P  Pq@M  TX yL o Zp ]p  'ߠ. h:HZ ոo {  ހ   f`>qdY|۠`݀@ P\  , oh &d hm@rry ,  0t  "<e@8r(!ޠ%,@M b s rfP y  q 8t ` 1 / DC(c j( ` pd x @ a  # @@/@O ېY ~q    QL .4 >P  @ X 8,  c7 U]e`sH HX  D@ 4qx  (% x1 >X> >goo8  AHhX h    P  X8`dq'q-`N `  mup  {px@l  Hh  ( xeP( 9\ o Bzq 8.@Hq 8`X-:A I [Xx pt` @d xpT 4ܠ@ - Pd9 p 0D@ d8`Lnhk Xs h ݠl  x4p =P`=& dA  T Ԩd i  ]0P j Hh  | 8Kr8  - i@4wq;  8+ I`O=v K`\P= p8& h   hL @2 @B Q= y(  X 8X `  P#+L6 PP; xrealloc_sysconf_sys_siglistpfopen__1cG__CrunMdo_exit_code6F_v_quotearg_mem$XAoAMiKaDTUMkQ1.actions_count$XAoAMiKxDTUMUP5.output_diversionobstack_free$XBoAMiKpDTUMEQ4.link_nfa_nodes.__func__xfprintfverrorversion_etc_vamkstemprpl_getoptrpl_re_searchquotearg_nexpand_user_macroquotearg_alloc_mem_Qp_negoutput_textbtowc__fsr_init_value_Qp_mul$XBoAMiKxDTUMUP5.m4_tmpname.tailiswlowermfile_name_concatverror_at_linexvprintffreadaheadqsort$XAoAMiKjDTUMUJ3.ignore_EPIPEhack_all_symbols$XBoAMiKrDTUM0e4.rpl_strsignal.oncexvasprintfdebug_set_outputrpl_optargbuiltin_initstrchrxstrduppipegl_avltree_oset_implementationposix_spawn_file_actions_destroy$XBoAMiKpDTUMEQ4.pop_fail_stack.__func__printf_frexpl$XAoAMiKuDTUME74.digitssigaltstackpeek_tokeninsert_diversion$XAoAMiKxDTUMUP5.tmp_file2_recentrmdirdebug_message_prefixfreeze_diversions$XAoAMiKuDTUME74.builtin_tabraise_Qp_fltproduce_frozen_statexvfprintf_obstack_memory_usedsuppress_warningsrpl_re_compile_fastmap$XAoAMiKoDTUMkK4.slotvecgl_avltree_oset_check_invariantsdebug_initcall_macroquotearg_colon_memcleanup_temp_subdir$XAoAMiKwDTUM0J5.wrapup_stackrpl_strstrunblock_fatal_signals$XAoAMiKxDTUMUP5.free_listdebug$XAoAMiKuDTUME74.sysval$XBoAMiKxDTUMUP5.make_diversion.__func__rquoteexpansion_level_finigl_linkedhash_list_implementation$XAoAMiKxDTUMUP5.output_temp_dir_obstack_begin_1$XAoAMiKZDTUMkF1.alternate_signal_stackprintf_fetchargstrace_pre$XAoAMiKtDTUMU44.program_error_messageprintf_parse$XAoAMiKrDTUMUl4.lettersquotearg_alloctowupperwctomb$XAoAMiKxDTUMES5.dir_list_end_Qp_addxprintfm4_errorxalloc_diembsinitstrerror_r_Qp_subcurrent_diversionset_custom_quotingexpand_input$XAoAMiKaDTUMkQ1.fatal_signalspush_macro$XAoAMiKbDTUMUf1.primesfcloseerror_print_progname$XAoAMiKoDTUMkK4.default_quoting_options__assert_c99$XAoAMiKxDTUMUP5.output_unusedsync_output$XAoAMiKxDTUMUP5.output_cursorsetbuf_Qp_itoqstrtodcleanup_temp_direxit_failure_get_exit_frame_monitor$XBoAMiKgDTUMEd2.register_slave_subprocess.cleanup_slaves_registeredrpl_regexecregister_slave_subprocessstrtolfree_symbol$XAoAMiKxDTUMES5.dir_listquotearg_n_memstrcmpcreate_pipe_in__xargvx2reallocerrno__environ_lock$XAoAMiKxDTUMUP5.tmp_file1_ownerstrrchr$XAoAMiKZDTUMEJ1.cleanup_listoutput_exit_etextcleanup_temp_dir_contentslookup_symbol$XAoAMiKjDTUMUJ3.file_nameprefix_all_builtinsset_commentclose_stdin_set_file_name$XAoAMiKxDTUMUP5.output_filepop_wrapupbase_lenferrorquotearg_n_style_memlstat__iobcreate_pipe_bidi$XAoAMiKwDTUMkM5.argv_stack$XAoAMiKaDTUMkQ1.saved_sigactionserror_one_per_linerpl_regerrorprintf_frexpfind_builtin_by_addr$XBoAMiKxDTUMUP5.m4_tmpname.__func__$XBoAMiKxDTUMUP5.insert_diversion_helper.__func__wait_subprocessiswalnum__xargc_getopt_long_r$XBoAMiKuDTUME74.m4_esyscmd.__func__quotearg_n_customm4_error_at_linelquote$XAoAMiKgDTUMEd2.slaves_allocatedrpl_regfreenl_langinfo$XBoAMiKxDTUMUP5.shipout_text.start_of_output_linefree_macro_sequence$XAoAMiKwDTUM0J5.current_inputfopen_temptowlower$XAoAMiKpDTUMEQ4.utf8_sb_mapset_macro_sequencestrcpyquotearg_custom_memmkstemp_safer$XAoAMiKtDTUMU44.long_options_GLOBAL_OFFSET_TABLE_$XAoAMiKwDTUM0J5.ispcleanup_temp_filerpl_re_syntax_optionsmemchr2_obstack_beginversion_etc_ar$XAoAMiKxDTUMUP5.tmp_file2_owner$XAoAMiKvDTUMkA5.last_text$XAoAMiKaDTUMkQ1.actions$XBoAMiKaDTUMkQ1.init_fatal_signal_set.fatal_signal_set_initializedrpl_re_matchnesting_limitdebug_levelset_program_namequotearg_customrpl_regcompm4_path_searchputc_unlocked_edataungetcclose_stdout_set_file_nameiswprintatexitposix_spawnpxasprintfmkdirversion_etc_copyrightdebug_decode$XAoAMiKwDTUM0J5.file_namesrpl_getopt_long_onlyrpl_re_set_syntaxfd_safermaingettimeofdayquotearg_freesigaddset$XBoAMiKpDTUMEQ4.parse_bracket_exp.__func__init_pattern_buffermemmovefclose_tempecomm$XAoAMiKoDTUMkK4.slot0mkdtemp$XBoAMiKrDTUMUl4.gen_tempname.__func__m4_placeholder$XAoAMiKpDTUMEQ4.__re_error_msgid_Qp_qtoievaluateadd_include_directoryversion_etc_arnrpl_mbrtowc$XAoAMiKwDTUM0J5.wspfopen_safer$XAoAMiKuDTUME74.predefined_tab_obstack_allocated_psymtab_init$XAoAMiKxDTUMUP5.diversion_tableposix_spawn_file_actions_addclose$XBoAMiKuDTUME74.m4_translit.__func__lseekfputc_PROCEDURE_LINKAGE_TABLE_quotearg_char_mem$XAoAMiKcDTUMku1.mmalloca_results$XAoAMiKrDTUM0e4.local_buf$XAoAMiKuDTUME74.substitute_warnedsigemptysetiswctypefread$XAoAMiKuDTUME74.macro_sequence_bufreload_frozen_statequotearg_colon$XAoAMiKwDTUM0J5.start_of_input_linetoupper$XAoAMiKjDTUMkG3.file_name$XBoAMiKaDTUMkQ1.init_fatal_signals.fatal_signals_initializedxcallocfputssymtab$XAoAMiKuDTUME74.macro_sequence_inusequoteargquotearg_n_styleclone_quoting_options$XBoAMiKpDTUMEQ4.re_search_stub.__func____xpg4__xpg6retcodegetpid_environfseekofwriteposix_spawn_file_actions_addopenrpl_re_set_registersset_cloexec_flagundivert_all$XAoAMiKaDTUMkQ1.fatal_signal_setexpand_formatexecute$XAoAMiKrDTUM0e4.static_bufset_quoting_flagsclose_stdoutposix_spawnattr_init$XBoAMiKpDTUMEQ4.re_copy_regs.__func__rpl_getopt_internal$XAoAMiKtDTUMU44.signal_message$XAoAMiKwDTUM0J5.input_changerpl_re_compile_patternset_quoting_styleunregister_temp_subdirrpl_wcrtombset_char_quotingsigprocmaskmake_diversion$XBoAMiKuDTUME74.m4_syscmd.__func__fstatoutput_init$XAoAMiKtDTUMU44.fatal_warningsskip_lineposix_spawn_file_actions_initoutput_current_linepush_wrapupdebug_flush_filesfreea$XAoAMiKaDTUMkQ1.actions_allocatedmemchrxmemdupstrcasecmppush_file$XAoAMiKxDTUMUP5.tmp_file1$XAoAMiKxDTUMUP5.tmp_file2vasnprintf$XAoAMiKgDTUMEd2.slaves_count_Qp_fgttolower__align_cpy_8quoting_style_args_obstack_newchunkquotearg_style_memwcscolldup_cloexecfflush$XBoAMiKrDTUMUl4.gen_tempname.valuestrlenfdopenrpl_fcntl$XBoAMiKxDTUMUP5.m4_tmpname.bufferclose_stdintrace_prepre$XBoAMiKpDTUMEQ4.check_matching.__func___Qp_feq$XAoAMiKmDTUMEu3.getopt_data$XAoAMiKwDTUMkM5.argc_stackgen_tempname$XBoAMiKwDTUM0J5.next_token.__func__rpl_re_match_2quotearg_stylemax_debug_argument_length$XAoAMiKrDTUM0e4.keybcommposix_spawn_file_actions_adddup2close_stream_temp_lib_version_Qp_fge$XAoAMiKoDTUMkK4.slotvec0waitpidquotearg_buffersigactionrpl_optind$XAoAMiKoDTUMkK4.nslotsdefine_builtinclose_streamunlinkinclude_env_init$XAoAMiKaDTUMkQ1.static_actionspush_string_init$XAoAMiKxDTUMUP5.total_buffer_size_getopt_internal_rtrace_postcurrent_fileposix_spawnattr_setflags__fpendingxzalloc$XBoAMiKuDTUME74.ntoa.strwarning_statusmemcmprpl_strsignalerror_message_countset_quotesobstack_alloc_failed_handler__ctype_maskrename___Argvdefine_user_macro$XAoAMiKwDTUM0J5.token_stack_getopt_long_only_rfileno_DYNAMICinclude_init__dtou$XAoAMiKxDTUMUP5.div0dup_saferposix_spawnattr_destroystrcat$XAoAMiKpDTUMEQ4.__re_error_msgid_idx$XAoAMiKwDTUM0J5.nextunregister_temp_fileversion_etc$XAoAMiKgDTUMEd2.static_slavesxmallocposix_spawnattr_setsigmaskrpl_getopt_longc_stack_action$XBoAMiKaDTUMkQ1.at_fatal_signal.cleanup_initialized$XAoAMiKvDTUMkA5.eval_textmmalloca$XAoAMiKxDTUMES5.dir_max_lengthemit_bug_reporting_addressquoting_style_valscreate_temp_dirkill$XAoAMiKuDTUME74.macro_sequence_regspush_string_finish$XAoAMiKZDTUMEJ1.descriptorshash_table_sizeinsert_fileget_quoting_stylepipe_safer$XAoAMiKwDTUMkM5.macro_call_idmemcpyrpl_re_search_2_startwcslenquotearg_charabort$XAoAMiKZDTUMkF1.program_error_messageshipout_textrpl_optopt$XAoAMiKZDTUMkF1.segv_actionstrncmpclose_stdout_set_ignore_EPIPEnext_tokeninput_initno_gnu_extensionsfind_builtin_by_name$XBoAMiKxDTUMUP5.insert_file.bufferat_fatal_signallast_component$XAoAMiKZDTUMkF1.stack_overflow_message$XAoAMiKgDTUMEd2.slavesquotearg_n_custom_mem$XAoAMiKuDTUM094.tracememset$XAoAMiKxDTUMUP5.diversion_storageldexp$XAoAMiKwDTUM0J5.token_bottomgetenvcreate_pipe_out__ctyperpl_opterrntoa_Qp_fnelibc.so.1SUNW_1.22SUNWprivate_1.1CyM NqWبx0p0 ڀڠP m@ `~ۀ۠oz p@'`܀ܠl Q@i`݀ݠN @`ހޠr` >@`H߀ߠ @7`/t3/ 7@`$|+ @`e3 @l`:}a_ x@`)_ @X`G@ @L`, @Y`aF[ @`qbiW @8`u [`+p ܒ@ "a`+p ܒ@ ra`+p @ rc , @`+p ' \ t+``+p ) -`-# `?-# =--%# ##0@`+p  @  `*p  Z#( `*p  Z#0@@q@@@0ww?_l@_h@__L@@_w_0www?_l@_h@___L@@_w_߰ www_\ w_h_׀h @_l@w_׀h H'Ӡ '_GӠ@wH#*b,p @_l@_׀h@ø_נ`40@w__t`___L@@_w_߰@w_@_qw_@/O/4 @'H@wH wwwA@cw''wwb]D Hc]\ HwwGG_b]D 4 __ߐ@@@5b] Hb]D H b]$`wA@aw''w'wߠwG뀠_@?,@wGG_G4 __ϐ@@@b] Hb]D H b]$`@A@`w'GHfa]\ a]\ @ @@: G`]  @: <`]\ `]\ @ @@: *G,0b]\@h!`]  @y: G,0b]\@b]\@@b @e: `]  @Z: @E @A@cw'G Ha@]!` ]a]\ @@H{`(]a]\ @@Ö`0]a@] @@$`8]a@] @@`@]`H]@@y`P]a@] @@`X]@ ``]a]D @@``h]@`p]a@] @@`x]a@] @@ߒ`]a@] @@Ւ`]a@] @@˒`]a@] @@@#G@0A@`ww_`]@@ Ha@]`]@@Mg H)_@@w_瀤ha]D `]_ @@* b]$`H __@@MA _@@f㾠A@c\wO'w / /www`]ww_\ @ b]$`c(]@@@+`]`]@@`]t @TD @]b]t X@T< @]b]t 0@T4 @]b]t @T, @]b]t @@T$ @]b]t P@) '`]wϠǐ @&ǐ @!ǐ @ǐ @ǐ @`]@{ H a]$`wwG_`]a]@@Խ'G?HH*r `]G  @@eHG NH`]Hwo`]wo`]_o  @@MHs @\wG_$``]\ _t`_t _h_wH__t`_wHUb] H  b],`H c]$`H@`]\ wH9 `H]$`H2`]\ @ `]t `]\ h!`]t`H`]\ @H`]\ @f a]$`H a0]$`H `@]$`H`]\ wH`]\ @*a]$ a]D H`]`]\   @@Ȩ a]$`H`]  @Ț /H `H]$`H`]\ @  cP]$`cP]D H cP]$`H`]\ wH`]\ wwHa@] a]a]a]a]@@@ HtN HpG`dH.`LH`DH `O`BOO%`D O, < #b_OD%`L O, < #b_OؠD`sH#`iH%`d O, < #b_OD`lH`iOeOOl`oOO`H `sO`tOO{%` Ow, < #b_ODG_`]a]@@'G?OW_w_h_@,X*08408Hc]D a]D a ]_@@Y"@pB@_w@@~c_h_@ExH@H   @a@] @_hHy_\ @[]w___@ =wW_Wh _W,`_W wW___W@@ __@ΐH}_\ @ Hv_\ @ wg_g %`,$`Hf `]$`H_ /_\ ސHW_\ @+ΐ*08408H_h_Hw_a(]w_c]D a]D a ]__@H0a0]  @H%_D  sH DH OOO| UOO H  sO tOOOO_\ wo_@K_ow_oZcp]D GH H `]jH$cp]D GH_cp]D ,0\@Wcp]D  cp]$`cp]D GO@R*08408H @cG@R*08408O@+*_h_@BH@w @{@oa@b]D @ 'G< ||| (| 0ww?_l@_h@__L@@Yw_0www?_l@_h@___L@@Yw_߰ www_\ w_h_׀h @_l@w_׀h H'Ӡ '_GӠ@wH#*b,p @_l@_׀h@R_נ`40@w__t`___L@@Y7w_߰@w_@Y w_@/O/4 0A@aԮww`8]w_\ h_\ _h_Hw_ w_\ o_b(]h_ Hww_0A@`ww`8]w_\ h_\ _@@ƒ H_H w_ w_\ o_ w_0ww'_G@@~ϒwߠ _$`_ߦ _ 4   , !,@$_ߦ _ 4   , !,@$_\ _t` @ww_@t_\ @t_\ @p0A@cww_ha8]wH_L H  b],`H:_@ @bp]@@w_h a@]__  @Șbp]`]`]\ `]\ `]\ @@@#l b],`@A@awbp]`]@A@a,www'_h_HwaH]w_@XQw_G@@}w_D  H_\ @ː _$`__t` b] H_h}w_@wbp]___Ǥ$@`]@@@w_ǀ hQ`]\ \ `]\ \ h_Ǡ wH)`]\ \ w__L@/ __,@c]D aP]__`]\ \ @ @O__,@bp]___Ǥ$@`]@@@w_ǀ o_ǀ?hc]D aX]_@ ז0A@b<w`8]w_\ hE`H]D H _ 4  H/a0]D H"_\ @ @Vߐw_a`]@@C__\ @@E__@G _@H_\`@< _ w_\ ob@]w_\ h+`H]D H_\ h _\`\`ؔ H_\ h _\`\`ʔ _ w_\ o0A@` ww''' /G H GGH`@]D Hc]D ah]_\ @  /H G뀤 HGG뀤H`@]D Hc]D ap]_\ @ / A@bwwww_L H_$ c]D ax]_\ @ ̖HY a]$`_א@@? _$`_L Hc]D a]_\ @  H8/_L *084084`]  @ Hc]D a]_\ @ Ha]D "Hc]D a]_\ @ s / A@`w''c]!w_ߠ$ wߠ _,`G H  /G4 'H /G'_ߠ$ wG4 t@L$@4`(]L@_,`G4 t@'瀤 OH_ߠ$ wߠ -_,`_w_0w'G w_@A_t (_\`\`(\` h _\`(< @@  'ߠ H' '_\`_\`(@_] \(@u A@bTww'ww/_@wϠ 'נ GHG׀ H(__t`(_\`\`(\` h _\`(< @@Ò 'Ǡ H'ˠ '_\`_\`(@R_] \(@u ހH.ax]\ _t`(_\`\`(\` h _\`(< @@Ζ 'Ǡ H'ˠ '_\`ax]\ \`(@"_] \(@u _Gס,0\@\ @_t (_\`\`(\` h _\`(< @@g 'Ǡ H'ˠ '_\_Gס,0\@\ \(@@_] \(@u ހH.`x]\ _t`(_\`\`(\` h _\`(< @@6 ' H'à '_\``x]\ \`(@”_] \(@u Gנ 'GGO@A@bԮw'w'_\ G@  *08408HH_\ D HG H_\ \ Hwa]wc]D a]_א@ HG HG H_\ \ Hwa]w_a]G@HiHVG H_\ \ Hwa]wG H_\ \ Hwa]w__G@HD_\ \ w_߀hH8G H_\ \ Hwa]w__G@H"c]D a]@ L@H_\ D O, < #c_Dp\0w'wG_@0  A@clww'w_\ G@ ɖ?*08408HH% ' GHGG〤H _G,0\@\ Hwa]w_א@yu G 'GGO0w'wG_@ڔ  A@bww'w_\ G@ s?*08408HH% ' GHGG〤H _G,0\@\ Hwa]w_א@y G 'GGOA@aww'w_\ G@ / *08408HHpG H_\ \ Hwa]w_ϐ@x w_߀h_D  HG H_\ \ Hwa]w_wHG HG H_\ \ Hwa]w_wHw_׀h*_@__t (_\`\`(\` h _\`(< @@) 'Ǡ H'ˠ '_\`_\`(@_] \(@u A@b̮ww'w_\ wG HH_G@ ?*08408HH_G <``.! L $@? _ wG$ 'w_߀hfG H_\ \ Hwb]wG H_\ \ Hwb]w__ǐ@@ HG H_\ \ Hwb]w_wH/HHWG H_\ \ Hwb]w_wHG$ '_ wHG$  O, < #c4_D_߀o_@_t (_\`\`(\` h _\`(< @@X 'Ϡ H'Ӡ '_\`_\`(@_] \(@u ww_w_ 4  HA_D  H< _\ t`(_\ \` \`$\`(h_\ \`(< @@ 'ߠ H' '_\  w_\_\ \ (@t_\`\ t`_ w_D 'Gˠ _$`__\ G˧,0t@0ww_\ \ _\ \ @@'G< A@a̮ww'w_w_\ wǠ 'G H b ]@@xH; '۠ GH4_Gۡ,0\@\ @w w_߀h_D  H _ߠ@[Hc]D b0]_Gۡ,0\@\  dG۠ 'GGO_\`\`h_ P%`,$` ' H' '_\`t`(_]`D0<@< u`_\`\`$\` $h _\ w__t`_Hww_\`t`_Gb(]@ @ܖGπ H``]\ h``]\ b8]_\ \ @@H}a]D H#``]\ h``]\ b@]ax]\ _\ \ `x]\ @@@H``]\ h``]\ bH]_\ \ @@ДHO_\ \  w_hc]D bP]@ @K``]\ h``]\ bX]_\ @@H"c]D b`]@ @(H_\ D  O, < #a4_DGϠ$ '_w_Ǡ wGπ OSpA@`|ww'w_\ G@  ?*08408HH_\ D HG H_\ \ Hwbh]wc]D a]_ϐ@ &HdG H_\ \ Hwbp]w_w_w_\ b(]hc]D bx]_א@ H:_ 4  H' 'ˠ GH _Gˡ,0\@D H _Gˡ,0\@$`b]_Gˡ,0\@t`Gˠ 'GGO_\ _G$ _ @A@aww'w_\ G@ i?*08408HH_\ D HG H_\ \ Hwb]wc]D a]_ϐ@ HeG H_\ \ Hwb]w_w_א@t w_߀h_D  Hc]D b0]_א@ VH9_ 4  H' 'ˠ GH _Gˡ,0\@D H _Gˡ,0\@$`b]_Gˡ,0\@t`Gˠ 'GGO_G$ _ _@@[yA@cTww'w_\ G@ Ö?*08408HH$ 'Ӡ GHGGӀH _Gӡ,0\@\ Hwb]w_ǐ@to w_߀hHHax]\ _t`(_\`\`(\` h _\`(< @@ޒ ' H'à '_\`ax]\ \`(@j_] \(@u _\ @_t (_\`\`(\` h _\`(< @@Dz ' H' '_\`_\ \`(@@_] \(@u `x]\ _t`(_\`\`(\` h _\`(< @@Lj ' H' '_\``x]\ \`(@_] \(@u Ht_\ w_b(]h!GGӀH _Gӡ,0\@\ Hwb]wc]D b]_@ -H(G H!GGӀH _Gӡ,0\@\ Hwb]wc]D b]_@  H_@?wH#H!c]D b]@ @H_D  O, < #`_DGӠ 'GGO@A@b<ww'wG H_\ \ Hwb]w_wb] `\@Ot_\ G@ e *08408H_L H  `h]$`Hs@_w a]$`G H_\ \ Hwb]w_b]ϐ@    s s s@^s'GπH#GӀ Hb]b]b]@#@H H' 'Gϡ, `h]$`H#GӀ Ha]D Hc]D a]D c]_ߐ@(G`h]$`㾠A@clw_w'wG H_\ \ Hwc]w_wc] `\@Ot_\ G@  *08408H_L H  `h]$`H5@_wǠ a]$`G H_\ \ Hwc]w_b]@   s@Bs'G?Hc]D a]D c]_ߐ@줖 `h]$`HGc ]@@fw_hc]D a]D c]_ߐ@쀖 `h]$`G@PH_\` \`$< 4w_h-_@H'G?HH;_\` \` h _@p  '{ H' '_ wo_o\ wg_g _ot`G_g,`O_\ __@ @w_ hH _ \_@tO_@H_@H a]D c(] @ a]$`G H_\ \ Hwc0]wG_@    @s'GH#G Hb]b]ap]@$@H H' 'G, `h]$`H#G Ha]D Hc]D a]D c]_ߐ@벖G`h]$`0A@aww'w_`h]D @A@a,ww'w ' 'ߠ '_\ G@ 3 *08408HH$G H_\ \ Hwc8]w_L HG H_\ \ Hwc@]w_\ _ߐ@]*08408HHG߀ H G`(]@t: H G H_\ \ HwcP]wc]D cH]G_ǐ@ HG HG H_\ \ HwcX]w_\ _Ǡې@*08408HHGۀ HG H_\ \ Hwch]wc]D c`]_ǐ@ ԖHG H_\ \ Hwcp]w_L HG H_\ \ Hwcx]wc]D ax]_@ ꦖHG H_\ \ Hwc]w_@@$>*08408HHCG߀ HG〤 H$_\` \` h _@Ò  'Ǡ H'ˠ '_ w_\ w_ _t` -_,`G 'GG$@'G۠$ 'G'Gǀ H._\` \` h _@c  ' H'à '_ w_\ w_ _t` 0_,`GG$@'G۠$ 'G'G OG'G$ 'G'Gǀ H,_\` \` h _@,  ' H'à '_ w_\ w_ _t` 1_,`G'G$ 'G'G O_\` \` h _@  'Ǡ H'ˠ '_ w_\ w_ _t` _,`HGGߐ@iw_L -H$_\` \` h _@֒  'Ǡ H'ˠ '_ w_\ w_ _t` -_,`_Ϡ wG_@$@'G۠$ 'Gۀ H(_\` \` h _@§  'Ǡ H'ˠ '_ w_\ w_ _t` 0_,`G۠$ 'Gۀ O_@_t (_\`\`(\` h _\`(< @@y 'Ǡ H'ˠ '_\`_\`(@_] \(@u  A@` ww'w_\ G@  *08408HH$G H_\ \ Hwc]w_\ _נ@-*08408HH_G @ A@~cww'w_\ G@  *08408HH$G H_\ \ Hwc]w_\ _נ@*08408HH_G$ @ A@~aww'w '_\ G@ k *08408HH%G HG H_\ \ Hwc]w_\ _נ@*08408HHG@e0A@~`ww'w_\ G@ ' *08408HH _`]D @NA@~`Dww'wG H@iMH ' GHGG〤H _G,0\@\ Hwc]w_Ǡϐ@@ '_L H'GG〤H _G,0\@\ Hwc]w_L F*084084`]  @ HG@hɐH`H]D HG H_\ \ Hwc]wc]D a]_@ ֖HhGG〤H _G,0\@\ Hwc]w_@knw_׀h._@f_@?H#GG〤H _G,0\@\ Hwc]wc]D a]D c]_@瑖H#GG〤H _G,0\@\ Hwc]wc]D a]D c]_@nG 'GGO00w'w_\ G@  *08408HH@B0A@}`ww'w_\ G@ ?*08408HH_G$ _ c]@H  w'w_\ G@ Ɩ *08408HHG H_\ \ HwwG H_\ \ Hww__א@@E w'w_\ G@  *08408HHG H_\ \ HwwG H_\ \ Hww__א@@EA@|aw'w/_\ G@ Y *08408HHKG H_\ \ Hwc]w_Ϡא@@j.w_߀h+H%G H_\ \ Hwc]wc]D a]D c]_ǐ@Y b]$`H __א@@5j _@0w'wG_@ 0w'wG_@| 㾰A@{ctw_wwwwax]\ _t`(_\`\`(\` h _\`(< @@ ' H'à '_\`ax]\ \`(@_] \(@u __t`(_\`\`(\` h _\`(< @@ ' H' '_\`_\`(@~_] \(@u w_߀ h_π h___Ϡ$@$ L XHH _Ϡ w_߀ h_π  o_Ϡ  _t`(_\`\`( \` h_\`( < @@ ' H' '_\``]\`(@3_] \(@u _ w_\ w_ _t` _,`_\ ax]\ @wǠ a]$`_@:'Gۀ Hwa]D `]__ @D_\`\`h_ P%`,$` ' H' '_\`t`(_]`D0<@< u`_\`\`$\` $h _\ w__t`_Hww_\`t`_\ (w__\`$t`(_\ ( h_\`(\` \`$h_\`\`(wo_o_t`_o_t`_oH '{_\`\`(@@ 'k '{HOG@?_t`(_\` \`$\`(h _\`(< @@ ' H' '_] \(@u `x]\ _t`(_\`\`(\` h _\`(< @@Ò ' H' '_\``x]\ \`(@O_] \(@u A@za$ww'w_\ G@ 7 *08408HH[`H]D H!G H_\ \ Hw`]w_w_@'c]D `]@ KG'Gπ H_GϠ$ < L@ XHH GϠ$ 'Gπ OG_t`(_\`\`(\` h _\`(< @@= 'à H'Ǡ '_\`_\`(@̔_] \(@u @  w_@E'GGGϢ$@HCGGϠ$@< _t`(_\`\`( \` h_\`( < @@ ' H' '_\_Gˤ@GGϠ$@< $\(@@_] \(@u _ w_\ w_ _t` _,`HrG'GϠ 'G'GGGˢ$@H/_\` \` h _@  ' H' '_ w_\ w_ _t` 0_,`G'GϠ 'G'GGGˢ$@OG_t`(_\`\`( \` h_\`( < @@ ' H' '_\`_\`(@_] \(@u _ w_\ w_ _t` _,`H5G H_\ \ Hw` ]wG H_\ \ Hw`(]wG H_\ \ Hw`0]w____@~]@A@xc<ww'w_\ G@ 뽖 *08408HH5G H_\ \ Hw`8]wG H_\ \ Hw`@]wG H_\ \ Hw`H]w____@~ @A@xaww'w_\ G@ i?*08408HHz_G_`P]@Ę _\` \` h _@  'ߠ H' '_ w_\ w_Ϡ _t` _,`@_\`\`h_ P%`,$` 'Ǡ H'ˠ '_\`t`(_]`D0<@< u`_\`\`$\` $h _\ w__t`_Hww_\`t`_\ (wa@]!`X]_@@<a@]!@~2A@wcww'w_\ G@ і *08408HHax]\ _t`(_\`\`(\` h _\`(< @@ 'ߠ H' '_\`ax]\ \`(@}_] \(@u c]\ @}_t (_\`\`(\` h _\`(< @@ 'נ H'۠ '_\`c]\ \`(@}n_] \(@u `x]\ _t`(_\`\`(\` h _\`(< @@ 'Ϡ H'Ӡ '_\``x]\ \`(@}B_] \(@u 0A@w`ww'w_\ G@ + *08408HH _b]D @RA@w`Tww'w_\ G@  *08408HHax]\ _t`(_\`\`(\` h _\`(< @@B 'ߠ H' '_\`ax]\ \`(@|Δ_] \(@u a]\ @|J_t (_\`\`(\` h _\`(< @@ 'נ H'۠ '_\`a]\ \`(@|_] \(@u `x]\ _t`(_\`\`(\` h _\`(< @@ 'Ϡ H'Ӡ '_\``x]\ \`(@|t_] \(@u  A@vaww'w '_\ G@ [ G HG H_\ \ Hw``]w_\ _נ@隔*08408H 'G〤 HG〤 Hc]D `h]G@ f '@@G〤 Hb]D Hb]D 'G〤 HG`]$`G@{tA@ucww'w_\ G@ ?*08408HH`H]D HFG H_\ \ Hw`p]w_@{M_t (_\`\`(\` h _\`(< @@ 'נ H'۠ 'G H_\ \ Hw`x]w_\`_\`(@{_] \(@u H_G_`P]@ _\` \` h _@ܒ  'ߠ H' '_ w_\ w_Ϡ _t` _,`_\`\`h_ P%`,$` 'Ǡ H'ˠ '_\`t`(_]`D0<@< u`_\`\`$\` $h _\ w__t`_Hww_\`t`_\ (w_@4@ww_ _ 2h  , !<,@$_D  H _h_\ @dؒ A@u` ww'wG H `]_@@fHD '۠ GH=GGۀH _Gۡ,0\@\ Hw`]w_ϐ@d w_߀hGGۀH _Gۡ,0\@\ Hw`]w_ǐ@d w__@G۠ 'GGO A@tbww'wG H `]@f/H" '۠ GH_Gۡ,0\@\ @dL w_߀h_ߐMG۠ 'GGOA@taww'w_\ G@ S *08408HHG H  a]$`HG H_\ \ Hw`]w_L +HG H_\ \ Hw`]w_L -H&G H_\ \ Hw`]w_L 'G H_\ \ Hw`]w_ @ j'H 'G H_\ \ Hw`]w_@ U'G〤 HG H_\ \ Hw`]wc]D `]_א@ HCH1Ga]$`H:a]D G@a]$`H.a]D G< @a]$`H!c]D `]@ ٔ@ywHG߀ +H OOO -OO A@saww'w_\ G@ k *08408HH=G H@2H5G H_\ \ Hw`]w_@ *08408H G H_\ \ Hw`]wc]D a]D `]_א@i A@s`ww'w_\ G@  *08408HHG H_\ \ Hw`]w__@xw: @)A@rcww'w_\ G@ ٖ *08408H G H_ H6G H_\ \ Hw`]w_wG H_\ \ Hwa]w__@@95w_׀h__ߠ$@Hw?w_'_GӐ@̒A@rb<ww'w '_\ G@ { *08408HJG HDG H_\ \ Hwa]w_@w_t (_\`\`(\` h _\`(< @@ 'Ǡ H'ˠ 'G H_\ \ Hwa]w_\`_\`(@x._] \(@u HG H_\ \ Hwa]w_@w'G'G H_\ \ Hwa ]w_\ _Ǡ@^*08408HHqG HG H_\ \ Hwa(]w_\ _Ǡߐ@>*08408HHQG〤 H G߀ HGGۀHHBGGߠ@GۀHGG$@'G_t`(_\`\`(\` h _\`(< @@ 'Ǡ H'ˠ 'G H_\ \ Hwa0]w_\_G@\(@@w_] \(@u ww /_L H_L -H怤 H_ w_L /値 H#_\` \` h _@  '۠ H'ߠ '_ w_\ w_Ǡ _t` -_,`H値H;' /G'G値H-_\` \` h _@  'Ӡ H'נ '_ w_\ w_ _t`_,`' /G'G値OH1$ /値H)_\` \` h _@Q  '۠ H'ߠ '_ w_\ w_Ǡ _t`_,`$ /値OH"_\` \` h _@(  '۠ H'ߠ '_ w_\ w_Ǡ _t`_L _,`_L /_ wO/O,/_L O,_\` \` h _@  '۠ H'ߠ '_ w_\ w_Ǡ _t` _,`_\`\`h_ P%`,$` ' H'à '_\`t`(_]`D0<@< u`_\`\`$\` $h _\ w__t`_Hww_\`t`_\ (w_w_A@pawww'wG H_\ \ Hwa8]w_wG H_\ \ Hwa@]w_w_\ G@  *08408H _L H_L H0G H*_@u_t (_\`\`(\` h _\`(< @@I ' H' '_\`_\`(@uؔ_] \(@u HG H_\ \ HwaH]w_w_@u -h&__@7w_h_L HaP]b]bP]@'I@uH H' '_L H_L H_@uw__L`L`_@@(w_h__ߠ$@_t`(_\`\`(\` h _\`(< @@Ȓ ' H' '_\`_\`(@uW_] \(@u ___ߠ$@$w_hHk_ w_$ w_L _L H)_L H$_\` \` h _@  ' H' '_ w_\ w_ _t`_L _,`H3_L _L H,_L H'_L H"_\` \` h _@W  ' H' '_ w_\ w_ _t`_L _,`__L`L`_@@w_oZ__t`(_\`\`(\` h _\`(< @@" ' H' '_\`_\`(@t_] \(@u H_ϐ@t -h&__@w_πh_L HaX]b]bP]@'g@tH H' ' !@t !@t_L / H#L@H  ,@_L ,@_L H_ w_Ϡ w_L / OG H_\ \ Hwa`]w_w_L / HZL@H#_\` \` h _@  ' H' '_ w_\ w_ _t`_,`H)L@H#_\` \` h _@^  ' H' '_ w_\ w_ _t`L@_,`_ߠ w_L / O0w'w_\ G@ Ж?*08408HH _G$ _ @@A@mbwwwww_@s \w_ǀh,_@s"_t (_\`\`(\` h _\`(< @@ ' H'à '_\`_\`(@s{_] \(@u H(__$@_t`(_\`\`(\` h _\`(< @@’ ' H'à '_\`_\`(@sQ_] \(@u _w_ w_L 'Hbh]D Hc]D ah]@ w bh]$`_\`\ \`\ $_t`(_\`\`(\` h _\`(< @@v ' H' '_\__\ \ @\(@@s_] \(@u _ wHG۠$ 0'Gw_\ $ _πhc]D ap]Gې@ %H=_\ Gۡ,0\@ h5_\G۩,0\@\\$@_t`(_\`\`(\` h _\`(< @@ ' H' '_] __\ Gۡ,0\@] (@@@r_] \(@u _ wHNc]D ax]@ ؔHC_\` \` h _@  ' H' '_ w_\ w_ _t`G_,`_ wHGۀ 0H  O &O8O$ 0 O, < #a_ؠDO@ww_t (_t _t _t _h_t _t 㾠A@l`wWw'w_\ G@  *08408H G H_> H~_\ \ w_\ \ wעw@_@qv@@@^wo_ohc]D a]__o@ w@HM_@qR'gG$ w@?,@w__Gg__@@'kGk?Hc]D a]_א@ HG H _Gk@ؒHGk H_\ \ w___Ϡw@ٖw@ܶ㾀A@kb w/w'w_\ G@ q *08408HJG HDG H_\ \ Hw_a]w___@pؐ_t (_\`\`(\` h _\`(< @@ 'W H'[ '[G H_\ \ HwOa]wO_\`_O\`(@q$_] \(@u H7_\ \ wע@ے_@p@@@Ԁww_whc]D a]__w@ >_@pH _\ \ w_@pr'k 'o 'sGoGkH_GkGo%@< @@@Ԛ'sGs HGGs?Hc]D a]_א@ H2GoGkH-GkGo$@< _t`(_\`\`(\` h _\`(< @@ 'c H'g 'g_\_Go@\(@@p_] \(@u HGsGoH-GsGo$@< _t`(_\`\`(\` h _\`(< @@ђ 'c H'g 'g_\_Go@\(@@p^_] \(@u G H_\ \ Hw_a]w_____@_\ 'o_\ _\ h*_\` \` h _@  'S H'W 'W_ wG_G\ w?_? _Gt`_GoL@/>O>_?,`O>/^Go 'oGoGkO-_\` \` h _@b  'c H'g 'g_ wW_W\ wO_O _Wt` _O,`@ A@icww'wG H_\ \ Hwa]wc]D b]_ߐ@ A@ibwww'w_\ w_א@o $w_ǀh,_@o!_t (_\`\`(\` h _\`(< @@ ' H'à '_\`_\`(@oz_] \(@u H __נ$@_t`(_\`\`(\` h _\`(< @@ ' H'à '_\`_\`(@oP_] \(@u _wH`H]D H _L $ 0'_נ wH/ '_L ٶ*084084`]  @ HGӥ,`,`_L $ 0@'_נ w_L ٛ*084084`]  @ OGG뀤H2_Gӡ,0\@\ @n_t (_\`\`(\` h _\`(< @@O ' H' '_\_Gӡ,0\@\ \(@@nڔ_] \(@u Hk_G$ @ _נ wH`_G_c]_L @ "H @@+_נ wHI_\` \` h _@  ' H' '_ w_\ w_ _t` $_,`H(_נ w_L 0H  #O *OO @H$ 0 O, < #aX_ؠDOOO0ww?_l@_h@__L@@1ǐw_0www?_l@_h@___L@@1Ēw_߰ www_\ w_h_׀h @_l@w_׀h H'Ӡ '_GӠ@wH#*b,p @_l@_׀h@_נ`40@w__t`___L@@1{w_߰@w_@1Ow_@/O/4 @A@gbwa@]!@v`h]c]a]@  @ӘA@gbTww_h_L H 'H '_L HH<G 'HrG 'HmG 'HhG 'HcG 'H^G 'HYG @'HTG 'HOG!'HJG"'HEG#'H@?H'_L `iH`cH `VO`aOO%`c O, < #aT_D`tH`pH `iO`lOOO`qOOO`xOO_ w_L O`h]\ `h]\ h`h]%`P,$`P ' H' '`h]\ `h]t`(`h]\ `h]D 0@`h]D 0<< @`h]t``h]\ `h]\ $@`h]\ `h]\ $@h`h]\ w_`h]t`_Hww`h]\ `h]t``h]\ (w_`h]\ $@`h]t`(`h]\ ( h)`h]\ (`h]\ `h]\ $@h`h]\ `h]\ (@w_`h]t`_`h]t`_H'`h]`h]\ `h]\ (@@ ' 'G'G< L@A@f`ww``]\ h5``]\ a@]!h*``]\ a@] h``]\ @ Hc]D a]D a]@< b]$`_``]t```]\ hb``]\ a@] hWw @l4 HHN``]\ @l1@l& HH@__h;_w_h6_ h2``]\ a@]!h``]\ @| Hc]D a]D a]@ؔ b]$`a@] ``]t`@A@eb wa@] @ka@]!@k``]\ h``]\ a@] h``]\ a@]!h``]\ @k @k  ha@]@k H a@]@k 0A@e`ww_h a@]!H4_L HސH+_a]@@w_瀤h H/_@k`@  Hc]D a]D a]@,_ /@A@dctw``]\ a]@@b]D H.a]D H``]\ a]c]\ @@a]D H``]\ a]b]D @@``]\  @k wwwwwA@dbwww_L /O'_ wG'Gǀ HAO怤 %H=`h]\  `h]\ h `h]@  ' H' '`h]\ w_ `h]t`O_,`O/_L /O'_ wG'G HO怤 %OO怤 HHI 'HQcP]D '_ (p  @w_ wHba]D Hax]\ Hwa]w_wHMa]D H`x]\ Hwa]w_wH8_ w_w_D?'Gߐ׻ wH)a]wH#_w_ w_L lH  SO dOO rH lOOO sOO_@i2'Gπ HGGӀHBG`h]t`(`h]\ `h]\ (@`h]\ h`h]\`(< @@ 'Ǡ H'ˠ '`h]\ _`h]\ (@@io`h]\ `h]\ (@`h]t`HG`h]t`(`h]\ `h]\ (@`h]\ h`h]`h]\ (< @@ 'Ǡ H'ˠ '`h]\ _`h]\ (@@i,`h]\ `h]\ (@`h]t` `h]t`(`h]\ `h]\ (@`h]\ h`h]`h]\ (< @@a ' H'à '`h]\ b]`h]\ (@@h`h]\ `h]\ (@`h]t`OhH@A@bcdw'b]Db]D H$a]D H a]c]\ @,a]D H a]b]D @b]`]D @a]D "H b]G@A@bb w`h]\  `h]\ h `h]@Ē  ' H' '`h]\ w_ߠ `h]t` _,` /`h]\ `h]\ h`h]%`P,$`P 'נ H'۠ '`h]\ `h]t`(`h]\ `h]D 0@`h]D 0<< @`h]t``h]\ `h]\ $@`h]\ `h]\ $@h`h]\ w_`h]t`_Hww`h]\ `h]t``h]\ (w_w``]\ h``]\ b ]_@@$_`h]\ $@`h]t`(`h]\ ( h)`h]\ (`h]\ `h]\ $@h`h]\ `h]\ (@w_`h]t`_`h]t`_H'`h]`h]\ `h]\ (@@ ' '0A@abww'Gb(]_@ A@aaww''wGb0]_@̒G Ha]D Hxb8] ' GHgG〤 Hb@]HAbH]_G,0\@\ HG_G,0\@\ Ѭw_׀hc]D bP]@ N@fbX]_\ @|H$c]D b`]@ 7@fH_G,0\@D O, < #b_ϠDG 'GGObh]Ka]D H bp]?E A@`bww''wa]D HGАG Hb]Hwb]wbx]__ߐ@_瀤ha]D H b]_@0ww?_l@_h@ __L@@)ߐw_0www?_l@_h@___L@@)ܒw_߰ www_\ w_h_׀h @_l@w_׀h H'Ӡ '_GӠ@wH#*b,p @_l@_׀h@_נ`40@w__t`___L@@)w_߰@w_@)gw_@/O/4 @A@_cDww_c]t`a]t @A@_bwa]\ c]t` A@_bwwc]\ L *084084`]  @ Hc]\  c]t`c]\ L *084084`]  @ Oc]\ a]t`c]\ L H H3'c]\ L u*084084`]  @ Hbc]\ L 0Hc]\  c]t`H 'c]\  c]t`H 'c]\  c]t`H 'c]\  c]t`c]\ L +*084084`]  @ H0G $H,c]\ w_ߠ c]t`G,`,`_L @$ 0'c]\ L *084084`]  @ HG $OG HG $H c]\ L :H H'c]\  c]t`H, 'H(c]\ L bH RH BOzOO XOfO rH bOkOOt xOWOH '_$ c]\ L Hc]\ L *084084`]  @ H c]\ L $ 0'H:c]\ L z*084084`]  @ H c]\ L $ W'Hc]\ L _*084084`]  @ H c]\ L $ 7'HH>G HG뀤 H_D` $`HG뀤 H _D HHH#HGGHH_DGL@G@$c]\  c]t`c]\ L Os H'Hbc]\ L +H c]\ L =H H' H'c]\ L -H c]\ L =H H' H'c]\ L *Hc]\  c]t` H'c]\ L =H Ht' Hq'c]\ L =H Hf' Hc'c]\ L =H HX' HU'c]\ L =Hc]\  c]t` HA' H>'c]\ L =Hc]\  c]t` H*' H''c]\ L =Hc]\  c]t` H'c]\ L >Hc]\  w_c]t`_L =H H' H' H'c]\ L =Hc]\  c]t` H'c]\ L <Hc]\  w_c]t`_L =H H' H' H'c]\ L =H H' H' H'c]\ L &Hc]\  c]t` H'c]\ L =H H' H'c]\ L |Hc]\  c]t` Hv'c]\ L =H Hk' Hh' He' Hb' H_'c]\ w_ c]t`_L `-H#`(H`%H`!O OO`&OO%`( O, < #b_נD`^H`<H `-O~`/OO%`< O, < #b_נD`|H`^OPOO`~OWOG<  H T  L A@\`\www_=_h'G_@@Ԓ'G〤 Hc]\ L H_R H 'H 'HHc]D b]_@ Hc]D b]_@  Hc]D b]_@ Hpc]D b]_@ Hac]D b]_@ ܖ b]$`HMc]D b]_@ ȖH>c]D b]_@ ŹH/c]D b]_@ ŪH c]D b]@ ŝ@a;HG〤 O, < #cx_נܠDG〤  2H /<x8t0'wG_@@j'G〤 HGHV'}'G HCu'G H HC'G@@J'G〤 H_D HG瀤H H'ߠ 'G_$`H_D H G〤 H _$`HGH'<'G OG H H' 'G< 0'wG_@@f'G〤 HGHS' 'G H@'G H H@'G@@F'G〤 H_D H G瀤H H'ߠ 'G_$`H_D HG〤 HHGH'ϐ'G OG H H' 'G< 0'wG_@@N'G〤 HGH:''G H''G H H''G@@.'G〤 HGH'_DG@$|'G OG H H'X 'G< 0'wG_@@N'G〤 HGH:'M'G H'E'G H H''G@@.'G〤 HGH'_DG@$('G OG H H' 'G< 0'wG_@@N'G〤 HGH:''G H''G H H''G@@.'G〤 HGH'_DG @$Ԑ'G OG H H' 'G<  A@Yadw'wG_@@{'G߀ HGHg''G瀤 H G瀤 HG瀤 HL'G H HL'G@@S'G߀ HGH?'G瀤 Hc]D b]@ L 'G瀤  "H _E G〤@ "H  "H % V'G瀤 OG瀤 OG瀤 OG瀤 H H'* 'G<  A@XcLw'wG_@@'G߀ HGH''G瀤 HG瀤 H G瀤 HG瀤 Hw'G H Hw'G@@'G߀ HGHj'H9_DG〤@ 4H $H?_DG〤@ 6H $H5_DG〤@ &H $H+_DG〤@ $H $H!c]D b]@ œ@^:HG$ O, < #b_נD'G瀤 OG瀤 OG瀤 OG瀤 OG瀤 H H'u 'G< 0XA@X`lw'wG_@@'Gۀ HGH'b'G瀤 HG瀤 HwV'G H Hw'G@@}'Gۀ HGHj'HH_D 'G 4 < ,@'ߡ< _$`HA_D H_D <H'_D 'G'G 4 < 4@'_D Hߠ<H''ӡ< _$`Hc]D b]@ ݔ@]{H G瀤 O OO'G瀤 OG瀤 OG瀤 H H' 'G< 0'wG_@@d'G߀ HGHQ''G瀤 HG瀤 H:'G H H:'G@@@'G߀ HGH-'G瀤 H _D4 G4 @$H _D4 G4 $@$'G瀤 OG瀤 OG瀤 H H'[ 'G<  A@W`w'wG_@@Œ'G߀ HGH'L'G瀤 H G瀤 HG瀤 H<'G H H'G@@'G߀ HGH'HY_D4 G4 L@$H`G〤 H Ht'G〤?H _D`4 $`H_DG<`@.! $H@G〤 H HT'G〤?H_$ H_DG<`@.! L$@$H!c]D b]@ @\PHG$  O, < #c _נD'G瀤 OyG瀤 OuG瀤 OqG瀤 H H' 'G<  'wG_@@~'G߀ HGHj''G HWy'G H HW'G@ڒ'G߀ HGHJ' 'G〤 H HA'_D H G〤 H H5'G'G$ 'G'G׀ H_D 4 L@'G'G$ 'G'Gπ O< _$`,'G OG H H' 'G< 0'wG'G HG H G HG H=_'G瀤 H HA'G_@ݒ'G〤 HGH4'G H _D`4 $`HG H_D`<$`HG H _D `?'G_$`HG_@@'G〤 HGH' 'G< 0'wH6_'G H H='G_@'G〤 HGH0''G H H%'G H H'HH H' H'G H OOO OO 'G< 0ww?_l@_h@__L@@[w_0www?_l@_h@k___L@@Xw_߰ www_\ w_h_׀h @_l@w_׀h H'Ӡ '_GӠ@wH#*b,p @_l@_׀h@*_נ`40@w__t`___L@@w_߰@w_@w_@/O/4  A@Ta4ww_@Yw_׀hc]D c]@ r H[' a]$`_@@Y w__$@_נ$@hc]D c]_@ NH6_L *084084`]  @ Hc]D c]@ 2Ha]D "H_ߡ<`< h c]D c]@ _'G<  A@Sc,ww_@Y@w_׀hc]D c]@ HUw a]$`_@@Yc w__$@_נ$@hc]D c]_@ ͖H0_L -*084084`]  @ Hc]D c]@ Ha]D "H c]D c]@ _w_ A@SaDww_@XƐw_׀hc]D c]@ vc ] HT? a]$`_@@Y?__$@_נ$@hc]D c]_@ PH0_L *084084`]  @ Hc]D c]@ 4Ha]D "H c]D c]@  ?HСA@RcTww'wc(]ɂ ` @O,G Hc0]HwG$ '_w_ w_\?\ w_w_w_wߠ2  @X_א@Xu %w_h,_@X_t (_\`\`(\` h _\`(< @@ߒ ' H' '_\`_\`(@Xn_] \(@u H__נ$@_t`(_\`\`(\` h _\`(< @@ ' H' '_\`_\`(@XD_] \(@u _ w_L %H&_\` \` h _@  ' H' '_ w_\ w_ߠ _t` %_,`_נ wO{w / / / / / / / /y / /x / /w / / / /s / /H] / / / / /w / / /s /O /Hi / / / / / /O /HX / / / / / /O /HG / /O /H> / / / / /O /H/O /H*O @/H%_L +H #H OOO 'OO -H +OOO 0OOO @H _w_נ w_w_orO H '_,`_ wO H +_,`_ wO H -_,`_ wO H _,`_ wO H 0_,`_ wO H #_,`_ w ' *_,`_ w_L *H G H H'G$ '_w_ w_\?\ 'G'G'_נ wH-_L *084084`]  @ HG,`,`_L @$ 0'_נ w_L *084084`]  @ O?' ._,`_ w *_,`_ w_L .HW /_נ w_L *H G H H'G$ '_w_ w_\?\ W'G'G'_נ wH/ '_L 7*084084`]  @ HG,`,`_L @$ 0'_נ w_L *084084`]  @ O_L lH l_,`_ w /_נ wנ / /H2_L hH- h_,`_ w_נ w_L hH  h_,`_ w_נ wנ / /y / /x / /w / / /s /_L /_נ w h2L@Hc]D c8]_ߐ@ G H_נ$ wO_H '#_$ wHh '#HdO@  'G'#H[ '#HW@UHS`cH#`XH`EH`AOO%`E O, < #a(_DO`aOO`iH%`c O, < #a<_D`sH `iO`oOO`uH`sOOO`xOO_,`_ w _,`HG H H'G$ '_w_ w_\?\ &'G'GG@@Дw'HG H H'G$ '_w_ w_\?\ 'G'ߢGGGߐ@@w'HG HHwG$ '_w_ w_\?\ ew_wǢGG_ǐ@@w'H_G Hc ] H?G$ '_w_ w_\?\ ??GG@;@d[w'H8G Hc@]HwG$ '_w_ w_\?\ w_wGG_@@Aw'H@THG# O, < #aP_D_'hO_'@T8_t (_\`\`(\` h _\`(< @@ ' H' '_\`_'\`(@T_] \(@u _'@T8O \ < Lp0ww?_l@_h@|__L@@w_0www?_l@_h@{___L@@w_߰ www_\ w_h_׀h @_l@w_׀h H'Ӡ '_GӠ@wH#*b,p @_l@_׀h@{_נ`40@w__t`___L@@w_߰@w_@kw_@/O/4 0ww_h_\ w__t`_w_w_o_w_ A@Mb̮ww_cH]@@w_ha]D cP]_ @ҖHz_cX]c`]@@|є_ch]@@|ʒax]\ cp]@@SH`x]\ cx]@@SH)_c]ax]\ < `x]\ < @@|ax]\ _@@Rْ`x]\ _@@Rђ_ @SŒc`]\ c]@@RӒHb]\ c]@@RƒH)_c]c`]\ < b]\ < @@|\c`]\ _@@Rb]\ _@@R_ @Sw`]\ hb]\ _,0\@b]\ _,0t@b]\ _,0\@w_߀hHs_c]_\ @RN: _\ @RI: @@|_\ _@@RM_\ _@@RG_ @S;H^_\ ;w_׀hc]D c]@ ݔ@R{_c]_\ @R: _\ @R: @@{Ԗ_\ _@@R_\ _@@R _ @SH#H!c]D c]@ @RGH_D  O, < #bx_ϠD_\ w_߀oxb]\ _,0\@sb]\ _,0t@_ w_`]\  oA_@7c]_@@Q_@} H a]D c] @Xl@A@L`4w'G H c]  :H c]G  @/A@Kcww /_@9ǒw_ha]D c]_ @_c]t` d'Gːwנ d'GŐwH b]D  b]$` /_@QĐ'G뀤 H /G뀤 #H1G뀤?H'G뀤 H#H b]D  b]$` /_@Q'G뀤 H /G뀤?HG뀤 OG뀤 H` G뀤 OG뀤 VHV VH b]D  b]$` /_@Qn'G뀤 H / 'G`]  @ H9#33`̀H3,`,`G4 @$ 0'H b]D  b]$` /_@Q;'G뀤 H /G`]  @ H#33`̀O#cH G`]  @ H c]  /'Gǀ H c]Gǐ ? @ H Gǀ H c]  G뀤 HÐ H b]D  b]$` /_@Pې'G뀤 H /G뀤 #H1G뀤?H'G뀤 H#H b]D  b]$` /_@P'G뀤 H /G뀤?HG뀤 OG뀤 Hw G뀤 OG뀤?H H`]  G'H b]D  b]$` /_@P|'G뀤 H /G瀤 DH~G뀤 -HzH b]D  b]$` /_@P['G뀤 H / 'G`]  @ H9#33`̀H3,`,`G4 @$ 0'H b]D  b]$` /_@P('G뀤 H /G`]  @ H#33`̀O#|H G`]  @ H c]  'GǠ 'H\ 'G`]  @ H9#33`̀H3,`,`G4 @$ 0'H b]D  b]$` /_@Oɐ'G뀤 H /G`]  @ H#33`̀O#cH G`]  @ H c]  'G뀤 ,Hk ,H b]D  b]$` /_@O'G뀤 H / 'G`]  @ H9#33`̀H3,`,`G4 @$ 0'H b]D  b]$` /_@OP'G뀤 H /G`]  @ H#33`̀O#cH G`]  @ H c]  D'G뀤 H G瀤 DHVGǠ GπH _@NGǠ 'GwGǀ H_G_@ @Oh `]   _G,@_w_G_נ$@$@ @OSw_hb]D  b]$`_ w_G_נ$@$@ @O9w_oGˠ GӀH _@NCGˠ 'GwGˀ H_G_@ @Nh `]   _G,@_w_G_ߠ$@$@ @Nw_hb]D  b]$`_ w_G_ߠ$@$@ @Nw_oH b]D  b]$` /_@N^'G뀤 H /G뀤 H' H4__ߐ@@HHG@/kGˀ H_Gː@@)JH:_ݐw__@ H.__ߐ@ H&__ߐ@@HHG瀤 FH  CO DOO QH FOOO TOOHG뀤 FH  COk DOhO_ QH FO`OWO\ TOYOPH b]D  b]$` /_@MӐ'G뀤 H /G뀤 #H1G뀤?H'G뀤 H#H b]D  b]$` /_@M'G뀤 H /G뀤?HG뀤 OG뀤 Ho G뀤 OG뀤?O_@M_@M_@y: H a]D `] @c]t  b]$`0ww?_l@_h@t__L@@w_0www?_l@_h@t___L@@w_߰ www_\ w_h_׀h @_l@w_׀h H'Ӡ '_GӠ@wH#*b,p @_l@_׀h@t_נ`40@w__t`___L@@gw_߰@w_@;w_@/O/4 㾰A@Fbwgww/c]\ hac]\ a]\ \ $@a]\ t`(a]\ \ ( h0a]\ \ (a]\ \ a]\ \ $@ha]\ \ a]\ \ (@w_a]\ t`_a]\ t`_H'a]\ a]\ \ a]\ \ (@@ 'ˠ 'c]t a]D !H``]\ hK``]\ `]_@@ue``]\  @L 0a]\ t`(a]\ \ a]\ \ $@a]\ \ (ha]\ a]\ \ (< @@F 'נ H'۠ 'a]\ \ a]\ \ (@a]\ t`a]\ \ a]\ \ ha]\  P%`,$` 'Ǡ H'ˠ 'a]\ \ a]\ t`(a]\ \ a]\ D 0@a]\ D 0<< @a]\ t`a]\ \ a]\ \ $@a]\ \ a]\ \ $@ha]\ \ w_a]\ t`_Hwwa]\ \ a]\ t`a]\ \ (w_w_wߠ _$`_@JҐb]t (b]\ b]\ (@ b]\ hb]b]\ ( < @@ ' H' 'b]\ _b]\ (@@Kb]\ b]\ (@b]t`b]\ w_ b]t` _,` /b]\ b]\ hb]%`P,$`P ' H' 'b]\ b]t`(b]\ b]D 0@b]D 0<< @b]t`b]\ b]\ $@b]\ b]\ $@hb]\ ww_wb]t`_wHwwb]\ b]t`b]\ (wo_ow__t` _$` b],`__t` _ߠ  !<,@ $_ߠ   , !,@$_ߠ  bx] , !,@$?`(]$`a]\ _t`_a]t`A@DaDwwc]\ hac]\ a]\ \ $@a]\ t`(a]\ \ ( h0a]\ \ (a]\ \ a]\ \ $@ha]\ \ a]\ \ (@w_a]\ t`_a]\ t`_H'a]\ a]\ \ a]\ \ (@@[ '۠ 'c]t  0a]\ t`(a]\ \ a]\ \ $@a]\ \ (ha]\ a]\ \ (< @@ ' H' 'a]\ \ a]\ \ (@a]\ t`a]\ \ a]\ \ ha]\  P%`,$` 'נ H'۠ 'a]\ \ a]\ t`(a]\ \ a]\ D 0@a]\ D 0<< @a]\ t`a]\ \ a]\ \ $@a]\ \ a]\ \ $@ha]\ \ w_a]\ t`_Hwwa]\ \ a]\ t`a]\ \ (w_w_w _$`c]\ _t`b]D _$` b],`__t` a]\ _t`_a]t`A@Bcwc]\ hc]D ` ]@ &@H 0a]\ t`(a]\ \ a]\ \ $@a]\ \ (ha]\ a]\ \ (< @@ ' H' 'a]\ \ a]\ \ (@a]\ t`a]\ \ a]\ \ ha]\  P%`,$` 'ߠ H' 'a]\ \ a]\ t`(a]\ \ a]\ D 0@a]\ D 0<< @a]\ t`a]\ \ a]\ \ $@a]\ \ a]\ \ $@ha]\ \ w_a]\ t`_Hwwa]\ \ a]\ t`a]\ \ (w_w_c]t`c]\ $ c]\ c]\ t`b]D c]\ $`a]\ w_A@B`wwc]\ hHVwa]\ \ a]\ \ $@< Ha]\ \ a]\ \ $@< 4wa]\ \  a]\ \ ha]\ @  'ߠ H' 'a]\  w_\ w_Ϡ _t` _,`a]\ \ a]\ \ ha]\  P%`,$` 'Ǡ H'ˠ 'a]\ \ a]\ t`(a]\ \ a]\ D 0@a]\ D 0<< @a]\ t`a]\ \ a]\ \ $@a]\ \ a]\ \ $@ha]\ \ w_a]\ t`_Hwwa]\ \ a]\ t`a]\ \ (w_c]\ t` c]\ \ _@c]\  t`a]\ c]\ t`c]\ a]t`a]\ \ w b],`H]c]\ a]\ \ $@a]\ t`(a]\ \ ( h0a]\ \ (a]\ \ a]\ \ $@ha]\ \ a]\ \ (@w_a]\ t`_a]\ t`_H'a]\ a]\ \ a]\ \ (@@ '۠ 'c]t _w_A@@bLwow_@Fw 0`P]\ t`(`P]\ \ `P]\ \ $@`P]\ \ (h`P]\ `P]\ \ (< @@ 'ߠ H' '`P]\ \ `P]\ \ (@`P]\ t``P]\ \ `P]\ \ h`P]\  P%`,$` 'Ϡ H'Ӡ '`P]\ \ `P]\ t`(`P]\ \ `P]\ D 0@`P]\ D 0<< @`P]\ t``P]\ \ `P]\ \ $@`P]\ \ `P]\ \ $@h`P]\ \ w_`P]\ t`_Hww`P]\ \ `P]\ t``P]\ \ (w_w_wb8]\ _t`_$ c]\ _t`b]D _$`_`P]\ t`(`P]\ \ `P]\ \ (@ `P]\ \ h`P]\ `P]\ \ ( < @@ ' H' '`P]\ \ _`P]\ \ (@@Es`P]\ \ `P]\ \ (@`P]\ t``P]\  w_\ w_ _t` _,``P]\ \ `P]\ \ h`P]\  P%`,$` ' H' '`P]\ \ `P]\ t`(`P]\ \ `P]\ D 0@`P]\ D 0<< @`P]\ t``P]\ \ `P]\ \ $@`P]\ \ `P]\ \ $@h`P]\ \ w_`P]\ t`_Hww`P]\ \ `P]\ t``P]\ \ (ww_ww__t` _ \_@t_b8]t` A@>c,wa]\ \ wHHa]D !HA_h#``]\ h``]\ `(]_\`D`@@m``]\  @EH``]\ h٫``]\ `0]@@mǒ``]\  @Da]\ \ @DH%c]D `8]@ a]\   4  H a]\ \ @D b]$`H*a]\   4  H a]\ \ @Dn?Hc]D a]D `@]@d b]$`a]\   4  @ bx],`?`(]$`H$c]D `H]@ ?@CHa]\ D  O, < #a<_נDa]\ a]\ \ $@a]\ t`(a]\ \ ( h0a]\ \ (a]\ \ a]\ \ $@ha]\ \ a]\ \ (@w_a]\ t`_a]\ t`_H'a]\ a]\ \ a]\ \ (@@ ' 'c]t _a]t` b],`4<4A@=aԮwc]t a]\ \  a]\ t`(a]\ \ ( h0a]\ \ (a]\ \ a]\ \ $@ha]\ \ a]\ \ (@w_a]\ t`_a]\ t`_H'a]\ a]\ \ a]\ \ (@@ ' 'a]\ @Bb8]\ hc]\  c]t`(c]\ ( h)c]\ (c]\ c]\ $@hc]\ c]\ (@w_c]t`_c]t`_H'c]c]\ c]\ (@@0 '۠ 'b]\  b]t`(b]\ ( h)b]\ (b]\ b]\ $@hb]\ b]\ (@w_b]t`_b]t`_H'b]b]\ b]\ (@@ 'ˠ '`P]\ \  `P]\ t`(`P]\ \ ( h0`P]\ \ (`P]\ \ `P]\ \ $@h`P]\ \ `P]\ \ (@w_`P]\ t`_`P]\ t`_H'`P]\ `P]\ \ `P]\ \ (@@ ' '`P]\ @A H4/`P]\ a]t` X@`P]t `P]\ c]a]@  @~)b8]\ a]t`b8]t  b],` /@A@;c\wwa]\ D  Hc]D `P]@ @A _$`a]\ \ _t`0A@;bwa]\ w_h!HY'HB_\ L ݐ*08408'G HGHH'HA_\ @A'G?H G_\ @@B GH4'_  %`,$`H$!H&'c]D `X]@ @A6H_D  O, < #a_D_\ wOG< L A@;`Įwa]\ h``]c]t` b]$`!H'b] Ha]\ \ c]t`a]\ D b]$` b],`Hza]\  w_\ w_ _t`_L 1*08408'G HGHv'Hpbx] H bx],`a]\ D  'Ga]\ $`Gb]$`a]\   4  H?H 'a]\ \ @@Ő'G'G?HG H bx],`GH/'H)!H('c]D `h]@ @@^Ha]\ D  O, < #cH_נDO=G< `|A@:a\wc]\ wb]D 'a]\ h/a]\ D  H'a]\ \ L Hb] Ha]\  w_\ w_נ _t`_L d*08408H''G'G!HGG HCa]\ h/a]\ D  H'a]\ \ L Hb] Ha]\  w_\ w_ _t`_L #*08408H''G'G!HG OG!Hc]D _G`p]@ 9_c]\ h Gb]D H b],`A@9bTww/ /'G_L А*08408< H H$/_L  H@H9a]\ h/a]\ D  H'a]\ \ L Hb] Ha]\  w_\ w_Ǡ _t`_L *08408H' 'נ H/a]\ h/a]\ D  H'a]\ \ L Hb] Ha]\  w_\ w_Ǡ _t`_L T*08408H''נ '_w_w_ w_L /_ wOG/'GO6*08408< H`a]\ h/a]\ D  H'a]\ \ L Hb] Ha]\  w_\ w_ _t`_L *08408H'~'G '_L H H HG/ /H_L /_ wO/'GOؐ*08408< OwG_t`(_\`\`(\` h _\`(< @@{ʒ ' H' '_\`_\`(@>Y_] \(@u [/ A@8a4w`x]c]t` b]$` X@a]t a]\ c]a]@  @zY X@`P]t `P]\ c]a]@  @zBb]c]a]@  @z3c]c]a]@  @z$ c]t`(c]\ c]\ $@c]\ (hc]c]\ (< @@{( ' H' 'c]\ c]\ (@c]t`c]\ c]\ hc]%`P,$`P ' H' 'c]\ c]t`(c]\ c]D 0@c]D 0<< @c]t`c]\ c]\ $@c]\ c]\ $@hc]\ w_c]t`_Hwwc]\ c]t`c]\ `x]t`a]t b8]t c]t  bx],``]@Yax]t ax]\ @<ax]t `]@F`x]t `x]\ @<`x]t `]@3c`]t c`]\ @<c`]t `]@ b]t b]\ @___L@@Ғw_߰ www_\ w_h_׀h @_l@w_׀h H'Ӡ '_GӠ@wH#*b,p @_l@_׀h@>_נ`40@w__t`___L@@ډw_߰@w_@]w_@/O/4 0A@cw`]\  Pw_b]t`_ww`]\ h__,0t@_ w_`]\  oww_w_L /O'_ߠ wG'GӀ H_,p4p9Oޠ@w_L /O'_ߠ wG'Gˀ O_w_@w_D H _ %`,$`H_\ @_D  H_\ @_@A@`Ԯww' '_wb]\ _`]\ l@L$@,0]ww_πh_\ _@@'Gۀ HH _w_\ w_πoG H Gۀ_Ϡ@? @w_Hw_ǀh_Hwb]\ _`]\ l@L$@,0w_wHVGۀ HW_πhS_D HK_w_ %`,$` (@8w_$ _Ϧ _ 4   , !<,@$_@Ɛ_t _Ϥ !,@ $_Ϥ !,@ $_Ϥ !,@ $_Ϥ !,@ $_$ _\ _t`_t __t`_H w (@w_$ _Ϥ !<,@ $_@ى_t _Ϥ !,@ $_Ϥ !,@ $_Ϥ !,@ $_Ϥ !,@ $_$ _\ _t`__t`G HGۀ H_\  %`,$`_Ϧ`\` 4   , !<,@$_HwGۀ H_πhHw /_\ h%_\  4  HG H_\  !,@ $_\` `4   , !<,@$H _ 4  @ /_\ _t`__\ w_\ h _\  4  HG OH: (@Cw_$ _Ϣ %`,$`_@א_t _Ϥ !,@ $_Ϥ !,@ $_Ϥ !,@ $_Ϥ !,@ $_$ _\ _t`__t`H wc]D a]@ xŔ@cHG O, < #c(_D_x@@ A@awwww`]\ h)b]\ _,0\@w_߀h_\ w___@_w_߀o_ w_`]\  o0www_\`__@w_߰@w_\`\ @w_0ww_\`\ _@/ wwww_\`\ ___ߐ@@/ް0ww_\`\ _@'G< 0ww_\`\ (_@/@w_\`\ 0@ww_\\ 8Hw__@@ 80ww_\`\ @_@/@w_\`\ H@ww'w_w_w_D '_\ h_\ h__\ hGH'G 'G'HGӠ '_ DGϠ@$GGӀHZ_\ h_ wH_\`\ h_\ wH_\`\ h_\  wH@_\ w_\ wGπ H_\ w_D  H3__t`__t`_\ _t`__t`_h__t`_Ǣ D` $`_D  _$`__t`G뀤 H_D $ H'_D 'G'HZ_\ w__t`_w_\ w__t`_w__t`__t`_\ _t`_h__t`_h__t`__t`__t`_D  H?H' 'G_$`_D  H H' 'G_$`_$ __t`G뀤 H?H' 'G'H_\ w_D  H5__t`__t`_\ _t`__t`_h__t`_ D`$ $`_D  _$`__t`G뀤 H_D  $ H'_D  'G'HZ_\ w__t`_w_\ w__t`_w__t`__t`_\ _t`_h__t`_h__t`__t`__t`_D  H?H' 'G_$`_D  H H' 'G_$`_$ __t`G뀤 H?H' 'G'_\ wHG뀤 H GӀ`??'G'H _D @ 'G'G뀤 HH _\ w_߀hHOV ww (@Tw_߀hHKw_t _t _$ __t` _\ h __t`_t H/_\ w_\ h _\ w_\ o__t`__t`_ע D`$ $`_\ h_\ h __\`@ _ \` t`_w_ www (@w_׀hH[w_t _t _$ __t` _\ h__t`_ D`$ $`_\  "h /H!_\ w_\ h _\ w_\ o__t`_ D` $`_\  "h /__t`րH_\ h __\`@ _ \` t`_w_߰ www (@w_׀hH[w_t _t _$ __t` _\ h__t`_ D` $`_\  "h /H!_\ w_\ h _\ w_\ o__t`_ D`$ $`_\  "h /__t`րH_\ h __\`@ _ \` t`_w_߰ww_\ w_\ h-_\ w_׀h__t`_߀h__t`H_\ _h__t`H__t`___ߐ@?ЖH_\ h)_\ w__t`_߀h__t`H_\ _h__t`H__t`___ߐ@?Hj_\ w_\ h _\ w_\ o_\ w_\ w__h _ǀh__t`__t`__h _\ _t`_\ t`_\ _t`_\ t`_D _$`__t`_߀h__t`H_\ _h__t`H__t`__h_Hw_w___@?:_ \`$ t`_\ h _\ _\ @_@ / www (@%w_׀hHw__t`__t`__t`_t _t _w_߰@w_\ w_ww_\ w_\ w_׀hD_߀h __\ _@'H_\ _h H'_\ _h?H'Ǡ 'G'G'G'GӀ H_\ wHGӀ H_\ wH H/_׀o /wwww_\ w_πhC__\ _@*08408H_\ wH-_w_\ w_πh__\ _@*08408H_\ wH_w_\ w_πo_\ _t` H/_πo /ްww_\ w_\ w_׀hD_߀h __\ _@'H_\ _h H'_\ _h?H'Ǡ 'G'G'G'GӀ H_\ wHGӀ H_\ wH_Hw_׀ow_ww_\ w_׀h__@}h?Hr' Ho'_\ w_߀h __\ _@'H_\ _h H'_\ _h?H'Ǡ 'G'G'G'GӀ H_\ h___@ h?H-' H*'_\ wH#GӀ H_\ h___@zh?H' H '_\ wH H'OG< 0ww__@w_߀h __ߐ@.H/ H/w_\ ww_hH__t` _,`_\ w_ wO_hH+_$ w_\ w_ HH_\ h _\ _\ @_@ ̐O _,`_\ w_ wO_@ ww_\ w_w_\ w_h_\ h _\ w_\ o_wwנHw__@@  80ww_\`\` hB_\ w_\ _t`_\ h_\ w_\ h _\ w_\ oH_\ h_\`\ h_\ w_\ h_\`\ o_\ w__t` H/ H/@wwww_\ h _\_@H'۠ ''_\ h _\_@H'Ӡ ''ף< ߡ< $@'_\ _h@ &Gπ?HGπ H@ _D GπH@ _\` t`׀HH''ˠ '4 @ww_\ h _\ @_\ _h@ www'_w_w_w__h_Hw_Hw_װwwwww'_׀ h_w_Hw_w_w_w_w_w__h__߀h_׀ h_Hw_w_Hw_Hw_ǰwww'_@  w_@  w__Ǡ@$hHw__Ǡ@@ Mw_w_h.___Ϡ$ @@ f __Ϥ$ ,@__Ϣ@__ǐ@@ X_w_w_w_h_@ __h_Hw_w_װwwwww'_@  w_@  w__@$hHw__@@ w_w_h@___$ @@  __$ ,@__@__@@ _׀ h_w_Hw_ww_ww_w_w_w_h_@ __h __߀h_H w_׀ h_Hw_w_w_ǰ@'H@wH0A@bw'`@]\ G@GH`0]\ Hw`X]\ w_wa]\ a]\ @  @@ : b]  @ : _@ @ @@ : b]  @ : GH`]D @ ǐG@ $@ *@'0w_hH'_h H'?'G'G'G< 'ww_D  H&_w_\ w_\ (w_\ w__נ$@w@ ڐ w H__@w___@h 'G:A@ctww '`]w!wߠא@ 'G HGH/'_h_Hwb]w_`@]t`b ]`0]t`b(]`X]t`@ P 'b]w @ M'G< 0ww?_l@_h@1 __L@@w_0www?_l@_h@1___L@@w_߰ www_\ w_h_׀h @_l@w_׀h H'Ӡ '_GӠ@wH#*b,p @_l@_׀h@0_נ`40@w__t`___L@@̧w_߰@w_@{w_ wwww/_\`___ސ@@ŀw_ϰwwww/w_w_\`_____ǐ@@s@w_@w_\`\ @w_0ww_\`\ _@w_0www_\`\ __@'G< 0ww_\`\ (_@w_0ww_\`\ 0_@w_0ww_\`\ 8_@w_0www_\`\ @__@w_߰0ww_\`\ @w_\`\ H__@w_ www_\`\ @w_\`\ H___@@w_߰ wwww_\`\ H___ߐ@@w_װ0ww_\`\ @w_\`\ P__@w_ www_\`\ @w_\`\ P___@@w_߰ wwww_\`\ P___ߐ@@w_װ0ww_\`\ X_@w_0ww_\`\ `_@w_0www_\`\ h__@w_߰0www_\`\ p__@w_߰0www_\`\ x__@w_߰0ww_\`\ _@/0ww_\`\ _@/0ww_\`\ _@/@w_\`\ @ww_\\ Hw__@@ 8wwww_\\ __@ŀHw__@@ 80www_\`\ __@/@w_\`\ @0www_\`\ __@w_߰ wwwww_\`\ ____א@@ŀw_ϰ0www_\`\ __@w_߰ wwwww_\`\ ____א@@ŀw_ϰ0www_\`\ __@w_߰0www_\`\ __@/wwww/____ސ@@uw_ǀh@-_w_ϰwwww/w_w______ǐ@@hsw_h@,_w_0www___@'G〤 H@, www___@۔w_׀h@,_w_߰0ww__@w_߀h@,_w_0ww__@w_߀h@,i_w_ www___@w_׀h@,J_w_߰ www___@w_׀h@,,_w_߰ www___@w_׀h@,_w_߰ www___@w_׀h@+_w_߰www'_w_w_w__h_Hw_Hw_װwwwww'_׀ h_w_Hw_w_w_w_w_w__h__߀h_׀ h_Hw_w_Hw_Hw_ǰwww'_@Z w_@U w__Ǡ@$hHw__Ǡ@@w_w_h.___Ϡ$ @@ __Ϥ$ ,@__Ϣ@__ǐ@@_w_w_w_h_@B__h_Hw_w_װwwwww'_@ w_@ w__@$hHw__@@7w_w_h@___$ @@P __$ ,@__@__@@B_׀ h_w_Hw_ww_ww_w_w_w_h_@א__h __߀h_H w_׀ h_Hw_w_w_ǰ ww_w_w__א@@  "H /0w_ww_L H_L _ߥ,p 4p7w_ w_L O_w_㾰A@c,wg`]\ w_h,_o@/ 8`\@Ot@a*08408H_'G@@Q*08408Ocwa ]\ hsa ]\ _,0\@w_h\_\ o@ 8`\@Ot@"*08408H_w_@N@*08408O$_\ o@ 8`\@Ot@*08408H_w_@+@*08408O_\ @_ w_a ]\  oСA@`Dwww/wwa ]\ h!a ]\ _ǡ,0\@h a ]\ _ǡ,0@wH _Ǡ w_a ]\  o_׀hia ]\ a ]\ hHa ]\ wa ]\ wa ]\ ,0 w_ 4w_ h b@]@Hw_h__,0\@_t@_ w__ o_a ]t`_a ]t`_h_@2a ]\ a ]\ ,0@w_t a ]\  a ]t` @w_t _,``]b0]b8]@ _t `]b0]b8]@՘ _t $  ?# w___@ "h $@@Ha]D bH] @@1aH2@_@=(w_h__t`__t`@_ha]D bP]_ @@1<H _@_t _@T_Hw_@Nw_߰0ww_w_\ _@͒h _\ _@@ ww_w_\ w__@w_׀h__א@w__א@ђ_@N0ww_w_\ _@h _\ _@ĩ@ ww_w_\ w__@cw_׀h__א@͒w__א@_@0A@a\www_@; H_ Ha]D Ha]D bX]_ @@0i?H' 'G< 0A@`|www_@  H_ Ha]D Ha]D b`]_ @@01?H' 'G< 0ww__@'__@G'G< 0ww__@'__@@G'G< 㾠w_w '_\ w_עO@ 8`\@Ot@J*08408H _wG__@.'__@_@ @,*08408O>_\ w_עO@ 8`\@Ot@*08408H _wG__@*'__@g_@@*08408OG'G<  A@`ww_w 'G_g@'G__\ @'wa ]\ hZa ]\ _ס,0\@_瀤hD_צ a ]\ h*_׀ ha ]\ _נ$ ,0\@h_נ$ w_׀ h a ]\ _נ$ ,0\@o_a ]t`H a ]\ _ס,0t@_\ @a_@^GH'_נ w_a ]\  o@G< @A@blw'`]\ h`]  `]t `]\ G@0A@aw'`]\ w_h@<_G@Iw_瀤h@0__@s A@a ww''@_G@@0'a]D 'G瀤 HG@Ga]$`G'G<  A@`<www@__@@0wa]D '_߀h_@R'G׀ H@GP@Ga]$`_w_0A@cTw'G HG@ސ'a]D 'GQGa]$`GH'G@ʐH'G< 0A@bww_@'_@ΐ'a]D 'G!Ga]$`G'G< 0A@aww_@А'_@)>'a]D 'GGa]$`G'G< www'_w_w_w__h_Hw_Hw_װwwwww'_׀ h_w_Hw_w_w_w_w_w__h__߀h_׀ h_Hw_w_Hw_Hw_ǰwww'_@j w_@e w__Ǡ@$hHw__Ǡ@@w_w_h.___Ϡ$ @@ __Ϥ$ ,@__Ϣ@__ǐ@@_w_w_w_h_@R__h_Hw_w_װwwwww'_@  w_@ w__@$hHw__@@Gw_w_h@___$ @@` __$ ,@__@__@@R_׀ h_w_Hw_ww_ww_w_w_w_h_@__h __߀h_H w_׀ h_Hw_w_w_ǰ0A@`tw'G@*'G H a]D OG'G< 0A@cww''_G@@'G瀤 H a]D OG'G< A@c<wwww//////_w․H Ð @@C / /@'G Hy /値Hbh]@  @ 'G Hd䀤Hbh]@  @ 'G HQ〤Hbh]@  @ 'G H>․H@'G H2 /Ð@@}'G H&@| 'G H@?,@w___b]\ @@@i'G H6H@eH@f․H@_׀h_$ ဤH〤Hဠ@ 'GGbp]_@@+5 H%'Ӡ@5H@6․HG@ @G__א@@@s'Gӡ< @w_D H_\ Hw_\ w_0ww?_l@_h@"J__L@@w_0www?_l@_h@"-___L@@w_߰ www_\ w_h_׀h @_l@w_׀h H'Ӡ '_GӠ@wH#*b,p @_l@_׀h@!_נ`40@w__t`___L@@ђw_߰@w_@w_ A@`|wb] H*w_,0`]D@א@@ H7 h ?_,0`]$@_ w_  o b],`0A@cww_,0`]D@ H$_,0`]D@'G,0aP] \@ h G,0aP] t@G,aP]@@f_ w_  o0A@b|w'c]D w_瀤 hH_$ w_c]$`a]\ _,0\@w_OG@JA@awbx]wߠ 'נ@ w_,0`]D@ H_,0`]D@'GӀ @ h@$GӦף,aP]@@_ w_  oA@`wwc] H  c],`c]D b]\ hAa]\ wb]\ wb]\ ,0w_ߐ Cww_瀠h__ϧ,0@_צ\`t_Ϡ w__瀤 o_a]t`_b]t`_c]h_@q_a]\ c]D ,0t@c]D  c]$`@A@bwa] H+b]@Hw_,0`]D@ Hb]_,0`]D@@Ғ_ w_  o a],`@A@awb] @g@A@a\wb] @O wwww/_\`___ސ@@ŀw_ϰwwww/w_w_\`_____ǐ@@s@w_@w_\`\ @w_0ww_\`\ _@w_0www_\`\ __@'G< 0ww_\`\ (_@w_0ww_\`\ 0_@w_0ww_\`\ 8_@w_0www_\`\ @__@w_߰0ww_\`\ @w_\`\ H__@w_ www_\`\ @w_\`\ H___@@w_߰ wwww_\`\ H___ߐ@@w_װ0ww_\`\ @w_\`\ P__@w_ www_\`\ @w_\`\ P___@@w_߰ wwww_\`\ P___ߐ@@w_װ0ww_\`\ X_@w_0ww_\`\ `_@w_0www_\`\ h__@w_߰0www_\`\ p__@w_߰0www_\`\ x__@w_߰0ww_\`\ _@/0ww_\`\ _@/0ww_\`\ _@/@w_\`\ @ww_\\ Hw__@@_ 8wwww_\\ __@ŀHw__@@= 80www_\`\ __@/@w_\`\ @0www_\`\ __@w_߰ wwwww_\`\ ____א@@ŀw_ϰ0www_\`\ __@w_߰ wwwww_\`\ ____א@@ŀw_ϰ0www_\`\ __@w_߰0www_\`\ __@/ ww__@w__ h_Hwנ?w_w_0www__@ے_ؒw_߰ wwww__@’__w_װ0ww__ h_Hw_w_w_0A@a\www_,0`]\@_ h _,0`]\@H w_ w_瀤 o?w_ww_ΐw__\ 0h`_\ (w_#|,p h_,0HwǠ?w_ǀ?hHK_ @Ww_׀hH?_\ 0w_π h-_Ϡ$ w__ϡ,0\@w_ǀh_\ w_\ _l@L$@w__,0\@_t`___,0t@_w_ǀo_π o__t`(__t`0_@eHH0w_\ `w_4p@w__\ 0h__@t0ww_\ _\ 0l@L$@w_\ (_,0\@_t`__\ (_,0t@0ww_\ _\ 0l@L$@w_\ (_,0@w_\ _h_\ _t`H_\ h@._\ wOwwww/ސ h@w_ǀhH2w__t`__t`__t`__t`_,`  _t`0_\ 0 @p_t (_\ (hH _Ǡ`8t`H_Ǡ`8t`P_t `_Hw_@w_ϰwwww/w_wǐ h@w_hHw__t`__t`__t`__t`_,` _ϡ4p@w_ h w_q_t 0_\ 0#|,p h_\ 0,0Hw?w_?hH_\ 0 @_t (_\ (hHq__t``_ 8w_π hC (@aw_hHC_\ _t` _\ h _\ _\ @wH_\ w__t`__@ܒ H'H __t`__t`_w_Ǡ w_w_Ϡ$ w_π o_ 8_t`__t`P_H w_w__ 8h_\ w_@_w__ 8o_\ (@א_@Ԑw_@w_\ `w_0ww_\ w_www__\ hF_\ h _\ _@wH_w_w__\ h+__@i__t` __t`__@> H'_\ w__t`__t`_ `\`$ t`_@b?H 'H__t`  'G< 0ww_\ _ 8h_\ Hww_w_0ww_\ _ 8h_\ Hww_w_ ww_\ `w__߀ h@?__ߠ$ 40h_\ Hw_ h _\ w_$ w_ oH_ߢ$ _$@w_\ Pw_ h _\ w_$ w_ o_\ w_www_\ `w__׀ h@__נ$ 40h_\ Hw_ h _\ w_$ w_ oH_ע$ _$@w_\ Pw_ h _\ w_$ w_ o__\ hE_\ h _\ _@wH_w_w__\ h*__ϐ@Q__t` __t`__ϐ@& H'_\ w__t`__t`_ `\`$ t`_@JH wH__t` _w_߰wwww_\ `w__瀤h__πh@Z_\ h _\ _ߐ@wH_w_w__\ 0l@L$@w_\ w_ Hxw_\ (_,0\@w_h-_\ _ǀh _h___\ @*08408< H H __\ h_wH _\ w_o_ h_\ Hw__hHw_$ w_ hH_\ wO__πh__$@w_\ Pw__hHw_$ w_瀤 hH_\ wO_Hwנ /w_\ (_,0\@w_h5_\ _ǀh(_h___\ @*08408< H H__\ h_h_wH /H _\ w_oHL__$@w_\ Hw_ h _\ w_$ w_ o_瀤 h1_\ _ǀh_h___\ @*08408< H H __\ h_H\w_\ w_w_$ w_瀤 oHNw_ h$_\ Hw__ 8h__hH:w_$ w_ hH _\ w__ 8o__\ `h_\ `_$@w_\ Pw__hHw_$ w_瀤 hH_\ wO_Hw_װwwww_\ `w__瀤h__πh@_\ h _\ _ߐ@wH_w_w__\ 0l@L$@w_\ w_ H7_\ (_,0\@w_h+_\ _ǀh_h___\ @*08408< H H __\ hH _\ w_oH /w_\ (_,0\@w_h5_\ _ǀh(_h___\ @*08408< H H__\ h_h_wH /H _\ w_oHM_w_\ Hw_ h _\ w_$ w_ o__瀤h2_\ _ǀh_h___\ @*08408< H H __\ h_H@w_\ w_w_ w__瀤 o?H0w_w_h?H'ww_\ _ 8h_ w_\ w_\ _ 8o__ h __瀤h_Hwנ?Hw_װ ww (@w_߀hH̀H@;'wGw H2 /~@@7'wGw H&@6 'wGw H~@?,@wgs__g_b]\ @@@#'wGw HDH@~H@ ̀H~̀H΀H̀@ 'cGcGwb]_@@値HGZGW怤HGPGM?H3'@~H@̀HGs@=怤HG0値HG)値HG_$`怤HG_$`Gs'G< www///_w____א@  s=`s=s> s=s'G'Gӡ< wwww///_w____ܴÐ@  @s=s> s>`s s'G?HG_$`G'Gˡ< wwww///_w____ܴÐ@  s=s> s>`ss'G?HG_$`G'Gˡ<  A@܂c,ww_hb]a@]!@@E@_@W /w_h_ Hw_w_w__$@ h _$ b]@ @ H_w_b]@ @ H_ w_a]t`㾰w_o@@ H !< @#H H'k 'kGk@ /A@܂a4wwwww/_߀h_L H b]wߠ wH _@᭐w_ h wހH'b]@w_πh_*08408H_wH_瀤h _*08408HHw_瀤h6b]*08408Hb]wH&b]b]@@ဒ Hb]j*08408Hb]wH  a]$`?HB'_@Bw_ǀ  h__Ǡ$ L@ /H_Ǡ$ w_ǀ  h __Ǡ$ L@ /O___@ h  a]$`?H'_b]_ǩ< __< _ߐ@@@7 'Gס< 0''wwGG__@ @ A@ۂaw''w'ww__א@@ iw_πh$_hGG_b]_ϐ@@@H GGb]_ϐ@@fHa]D b] @@Y@_@www'_w_w_w__h_Hw_Hw_װwwwww'_׀ h_w_Hw_w_w_w_w_w__h__߀h_׀ h_Hw_w_Hw_Hw_ǰwww'_@, w_@' w__Ǡ@$hHw__Ǡ@@gw_w_h.___Ϡ$ @@ __Ϥ$ ,@__Ϣ@__ǐ@@r_w_w_w_h_@__h_Hw_w_װwwwww'_@ΐ w_@ɐ w__@$hHw__@@ w_w_h@___$ @@" __$ ,@__@__@@_׀ h_w_Hw_ww_ww_w_w_w_h_@ߩ__h __߀h_H w_׀ h_Hw_w_w_ǰA@قc|wwwwwww_h_b]___ߐ@@@AH _b]__ߐ@@4_a]b]@@('c]_@@1H@}_c]_\ @@H_c]_\`\`@@H_c]_\`\`\`@@H_c ]_\`\`\`\`@@H_c(]_\`\`\`\`\` @@@sH_c0]_\`\`\`\`\` \`(@@s@sHz_c8]_\`\`\`\`\` \`(\`0@@ss@sHb_c@]_\`\`\`\`\` \`(\`0\`8@@sss@sHH_cH]_\`\`\`\`\` \`(\`0\`8\`@@@ssss@ksH,_cP]_\`\`\`\`\` \`(\`0\`8\`@@@ssss@OsH_π o,0#`_ǠؠD0h@` wwwwww_\ h _Ϡ w__ϡ,0\@o______ϐ@@㾠wwwwww_π h5_ (p  @wo_o_ϧ,0t@_oww_נ w_wwg_gh_Ϡ w_π h_ (p  @wW_W_ϧ,0t@_Ww__נ w__wO_Oo____߬_ϐ@@Y wwwwwwߠw_____ϐ@@H@A@؂`<wcX]c`]@@߇ch]cp]cx]@@zc]a@] @@x0ww?_l@_h@x__L@@Kw_0www?_l@_h@[___L@@Hw_߰ www_\ w_h_׀h @_l@w_׀h H'Ӡ '_GӠ@wH#*b,p @_l@_׀h@_נ`40@w__t`___L@@w_߰@w_@Ӑw_www'_w_w_w__h_Hw_Hw_װwwwww'_׀ h_w_Hw_w_w_w_w_w__h__߀h_׀ h_Hw_w_Hw_Hw_ǰwww'_@f w_@a w__Ǡ@$hHw__Ǡ@@ݡw_w_h.___Ϡ$ @@ܺ __Ϥ$ ,@__Ϣ@__ǐ@@ܬ_w_w_w_h_@N__h_Hw_w_װwwwww'_@ w_@ w__@$hHw__@@Cw_w_h@___$ @@\ __$ ,@__@__@@N_׀ h_w_Hw_ww_ww_w_w_w_h_@__h __߀h_H w_׀ h_Hw_w_w_ǰ0A@ւ`dwc]D w_ hH#_$ w_c]$```]\ _,0D@H``]\ _,0@D 'G@x O A@Ղc|w'a] Hc]@3c]➐ a],```]\ w_c]D ,0@w__瀤h_D H G_$` _$`Hn_ w__瀤 oc]D a]\ h;``]\ wa]\ ,0w_,0@Pw_߀hG@ @__a]\ ,0@@b_``]t`_a]t`_c]h_@G``]\ c]D ,0@$` ``]\ c]D ,0$@c]D  c]$`0A@Ղ`w'``]\ w_c]D ,0@w__瀤h_D H _D GH_$ _ w__瀤 oA@Ԃcw'w////_w_߀h_$  'Gא@@t 'GGH(a]D HO뀤H퀤H뀠@ 'Ga]D c]_@@  H'Gנ H G!?# @ HHO쀤HGmGנ H=G!?# @ H6_߀hGנ _$`Gנ  H H HK'뀤H 퀤H_߀h뀠@ 'Gc]_Gנ @ @  H+'Gנ H@4Gס<  H뀤H퀤H뀠@ 'Gc]_@ @ r H'Gס<  'Gۡ< 0ww?_l@_h@__L@@w_0www?_l@_h@___L@@w_߰ www_\ w_h_׀h @_l@w_׀h H'Ӡ '_GӠ@wH#*b,p @_l@_׀h@`_נ`40@w__t`___L@@Ew_߰@w_@w_www'_w_w_w__h_Hw_Hw_װwwwww'_׀ h_w_Hw_w_w_w_w_w__h__߀h_׀ h_Hw_w_Hw_Hw_ǰwww'_@ج w_@ا w__Ǡ@$hHw__Ǡ@@w_w_h.___Ϡ$ @@ __Ϥ$ ,@__Ϣ@__ǐ@@_w_w_w_h_@ؔ__h_Hw_w_װwwwww'_@N w_@I w__@$hHw__@@ىw_w_h@___$ @@آ __$ ,@__@__@@ؔ_׀ h_w_Hw_ww_ww_w_w_w_h_@)__h __߀h_H w_׀ h_Hw_w_w_ǰ@A@҂a|w`]D c]c]@ @@'www'_w_w_w__h_Hw_Hw_װwwwww'_׀ h_w_Hw_w_w_w_w_w__h__߀h_׀ h_Hw_w_Hw_Hw_ǰwww'_@X w_@S w__Ǡ@$hHw__Ǡ@@ؓw_w_h.___Ϡ$ @@׬ __Ϥ$ ,@__Ϣ@__ǐ@@מ_w_w_w_h_@@__h_Hw_w_װwwwww'_@ w_@ w__@$hHw__@@5w_w_h@___$ @@N __$ ,@__@__@@@_׀ h_w_Hw_ww_ww_w_w_w_h_@Ր__h __߀h_H w_׀ h_Hw_w_w_ǰ wwwwwww__ߐ@@'G'G< 0A@Ђcwww__@@؁'G瀤 Ha@] @H`]D a]D c]@@G'G<  wwwwwww___א@@'G'G<  A@Ђbdwwww___@@0'G߀ H_@ְH`]D a]D c]@@G'G< 0ww?_l@_h__L@@ːw_0www?_l@_h___L@@Ȓw_߰ www_\ w_h_׀h @_l@w_׀h H'Ӡ '_GӠ@wH#*b,p @_l@_׀h_נ`40@w__t`___L@@w_߰@w_@Sw_ ww__@w__ h_Hwנ?w_w_0www__@ے_ؒw_߰ wwww__@’__w_װ0ww__ h_Hw_w_w_A@ςawwww_w_w_ǀ h_ (p  @w_נ w__@@tw_Ǡ$ w_ǀ o_π?h_#ch  Oa]$`H3w_Ϡ @w_w_w_ǀ h!_ (p  @w_ w_@Ԍw___@@__@w_Ǡ$ w_ǀ o _,`_w_A@΂cwwww_w_L H __@wH2w_L %HH_Ϡ w_L sHH _Ϡ w_נ wO__@@ H a]D HKHw_w_ wwwwwww__ߐ@w_w_0'/G @t 'G HG@?,@ @'G'GG뀤H GG@ @X?H H'?'G< @'G@= 'G< 0A@΂`Įww_@֐  2h /_@N  2H /_@N  2H /HHH a]D HH a]$`?H' 'G< www'_w_w_w__h_Hw_Hw_װwwwww'_׀ h_w_Hw_w_w_w_w_w__h__߀h_׀ h_Hw_w_Hw_Hw_ǰwww'_@ w_@ w__Ǡ@$hHw__Ǡ@@9w_w_h.___Ϡ$ @@R __Ϥ$ ,@__Ϣ@__ǐ@@D_w_w_w_h_@__h_Hw_w_װwwwww'_@Ҡ w_@қ w__@$hHw__@@ېw_w_h@___$ @@ __$ ,@__@__@@_׀ h_w_Hw_ww_ww_w_w_w_h_@{__h __߀h_H w_׀ h_Hw_w_w_ǰ@A@̂bĮww_b]t`0A@̂btw /a@]@ ha@]@  H a@]@Ő H /a@]E H /H1c]wb]\ ha]D c]b]\ @_ @@Ha]D c]_ @@u@qH`]D @ѧwww'_w_w_w__h_Hw_Hw_װwwwww'_׀ h_w_Hw_w_w_w_w_w__h__߀h_׀ h_Hw_w_Hw_Hw_ǰwww'_@@ w_@; w__Ǡ@$hHw__Ǡ@@{w_w_h.___Ϡ$ @@є __Ϥ$ ,@__Ϣ@__ǐ@@ц_w_w_w_h_@(__h_Hw_w_װwwwww'_@ w_@ݐ w__@$hHw__@@w_w_h@___$ @@6 __$ ,@__@__@@(_׀ h_w_Hw_ww_ww_w_w_w_h_@н__h __߀h_H w_׀ h_Hw_w_w_ǰ@A@ʂc̮ww_a(]t`@A@ʂc|w/`],`@A@ʂc,wa@]  HE`] H a]D H7c]wa(]\ ha]D c]a(]\ @__ @@ǘHa]D c]_ @@`]D @a@]!D H`]D @@A@ʂawa@] @д'G HG@K  Ha@] @Њ0A@ʂ`w'G@$@ HwHw_hc]wa@]!c]_@@ѐ0A@ʂ`$w''wwa@]!__@@ќc]  c]$`GHGa@]! @ѝa@]!@GHG@@ wwwA@ɂcw''w\`]\ h `]\ Ha@]!`]a]\ @@wGG__ߐ@wA@ɂb w''w'waX]D H)`] 뀤H_`]\ h `]\ _@@ HHP_`]t``]$``]\ h `]\ Ha@]!`]a]\ @@Ю_h` ]Hw`(]wa@]!__@@ЕwGG__ϐ@wwwwA@Ȃcw''?'۠wH_ߠ w_w_D?'`0]D H0GGGא@@Т'Gۀ H a]D H  `0]$`HGGא@ 'Gۀ HHY?`0]$`H GGא@ 'Gۀ H+`0]D ?H$Gې@e 'Gˀ H GGˠ @ @Y?Ha]D 'G@ΞGa]$`?'H_ (p  @w_ߠ wGG_ϐ@@5'H G#OwOG'G< 0ww?_l@_h__L@@w_0www?_l@_h___L@@w_߰ www_\ w_h_׀h @_l@w_׀h H'Ӡ '_GӠ@wH#*b,p @_l@_׀h_נ`40@w__t`___L@@uw_߰@w_@Iw_ www___@@3w_׀hT_w_߰@w_L /H H_ w_L /O_w_www_@ǐw_@w__$@_Ϡ@w_πh __Ϡ$ L@ /H H' 'Gw_w_@ېw__@_@ @"w_hH7w___ǐ@@<_Ǡw /_,`__@w_瀤h_L /HH H' '_G$@_t`___@@_w _,`_w_߰A@ǂ`4www__@@ϒw_߀hD_@W'Gۀ H<Gۀ H8G@'G׀ Ha]D '_@Ga]$`H#w_@  H G_@@ܒw_߀ha]D 'G@אGa]$`Hw_w_www'_w_w_w__h_Hw_Hw_װwwwww'_׀ h_w_Hw_w_w_w_w_w__h__߀h_׀ h_Hw_w_Hw_Hw_ǰwww'_@Ɛ w_@ w__Ǡ@$hHw__Ǡ@@w_w_h.___Ϡ$ @@ __Ϥ$ ,@__Ϣ@__ǐ@@ _w_w_w_h_@ˮ__h_Hw_w_װwwwww'_@h w_@c w__@$hHw__@@̣w_w_h@___$ @@˼ __$ ,@__@__@@ˮ_׀ h_w_Hw_ww_ww_w_w_w_h_@C__h __߀h_H w_׀ h_Hw_w_w_ǰ ww_D 0'_D 4'_D 'GG瀤HGG뀤HGG$@G$H=GG$@'Ӡ 'GӀH-_GGϠ@< ,0\w_GGG$@$GϠ@< ,0]@< ,0u@__GGG$@$GϠ@< ,0uGϠ 'GGӀOGGӠ$@'H4GG$@'Ӡ 'GӀH&_GGϠ@< ,0\w_GGϠ@< ,0]G< ,0u__GGϠ@< ,0uGϠ 'GGӀOGGӠ@'GG瀤HGG뀤O_0E DD4$@% _D`$`4A@ĂcDw'www'_D 'G_$`4G_$`0_t GۀH `8]@yh H'Ǡ 'G_$`,_L -H  _$`(_ wH_L +H _$ (_ wH_D ,H_$ (H _$`(_w_ϰ㾰A@ĂaԮw_'wwww'_wG'_D '_L :H 'G H?HT'_t _D H_D H_D H _$`G___GÐ@@fw _$`_\ h_\ L H_D`4D`H_D`$`4_D`0D`H_D`$`0_D ( HU_D`0D`4H_D`4D`H __ǐ@H _D`4D`H_D`$`0_D GH0__D ,0\@L -H __D ,0\@L  H_D` $`_D GH__D ,0\@L -O__D ,0\@L  O_D`$`4_D GH6__D ,0\@`@]@@JH(_D` $`_D`0D`4H_D`4D`H __ǐ@H _D`0D`4H_D`$`0G_$`4G_$`_D GH_D`0D`4H_D`0$`?Hp'__D ,0\@L -H __D ,0\@L  H_D ( H?HV'_w_D 'G _$`_G,0\@_t` HD'_߀h__D ,0\@L  -H H' '__E ,0\G@ u _߀h__D ,0\@L  -HGӀH__D ,0\@L H___D ,0\@L @ܒhw ' '?'_\ w_L H_L =H_ w_L H_L =O_w '_\ hV_\ _\ _$@@=H<__\ $@< _\ @A: H _wG' 'H4_h_wG'HGӀH_D _D H_\ _\ h _D _D H '_ wG'G '_\ oGH,GH(GHa@]!`H]_\`_D ,0\@@@_\ @_t` _D` $`_$  ?HV'_hG'_D` $`_L HV_D H_ _t`HIGH7__D $ < ,0\@L  -Ha@]!`P]_\ _\ @@ɜHa@]!`X]_\`_D $ < ,0\@L _\ @@@ɂ_\ @~_t` _D _$` ?H'HM_D  HH_D GH_w_D 'G _$`_G,0\@_t`H1GHa@]!``]_\`_D $ < ,0\@@@>_\ @:_t` _D _$`_L $ :@??  ?'GH'_\ @#_t` _׀hG_$`_\ h _D`\`$` H'_D H'GӀH__D ,0\@L  -H __\ L @@MhDGH2__D ,0\@L  -Ha@]!`h]_\ _\ @@ՖHa@]!`p]_\_D`,0\L \` @@Ⱦ`x]_t` _D` $`_$  ?H1'_Ǡ w_\ w_ _t`_L /_O@@w_\ L H_D` $`_hO :HGHa@]!`]_\ O@@xO_$` ?H'_L WH_L  ;H~w ' ' '{_\ L H _\` t`_D` $`H;_D GH&GHa@]!`]_\ O@@9O_$`_L :H :/H ?/OH'_wo_oD 'kGk _o$`_Gk,0\@_t`_\ w__t` _L H_L =H_ w_L H_L =O_w 'w_\ h=_\ _\ _$@@ٔH#__\ $@< 4_\ @ܐ@h _wGw'{ 'H_h_wGw'{H '_ wGw'sGw 'w_\ oGH*GH&GHa@]!`]_\`_D ,0\@@@ǚ_\ @Ŗ_t` _D` $` ?H '_hG{'w_L H-_D H_ _t`H GHa@]!`]_\ _\ @@b_\ @^_t`  ?H'HI_D  HD_D GH_wo_oD 'kGk _o$`_Gk,0\@_t`H-GHa@]!``]_\`_D $ < ,0\@@@"_\ @_t` _L $ :@??  ?'sGsH'_\ @ _t` _׀hGw_$`_\ h _D`\`$` Hv'_D Hr'_t  WHm'_L  :He_L  :H_\ L H _\` t`_D` $`H_t _t HK_\ L H _\` t`_D` $`H:_D GH%GHa@]!`]_\ O@@ƥO_$`_L :H :/H ?/H_w_D 'G _$`_G,0\@_t`_t OH'G< A@cܮw'wwww'G'cp]D c8]$``]D c8]$`G____Gc8]Gϐ@@sSs'c8]D cp]$`c8]\ `]t`c8]D `8]$`G'Gˡ<  'wwG__@  s'G< 'wwwwG____א@@  zs'Gӡ< 'wwwwwG_____ϐ@@ s s'Gˡ< 'wwwwG____א@@  6s'Gӡ< 'wwwwwG_____ϐ@@ s s'Gˡ< @w_  @ HHw_Hw_@w_@ų@'G< A@c4ww''wwG H 'G H 'Gˠ $0'__t`8__t`@G_t`G$ _$`0_ P!<,@ $_ P4  H _\`8\`H\`wH _\`8\`w__t`_w_πhc]\ _Ϥ G$ <`<@< w__t`__t`__\ @w__t`__t` _t _ P!,@ $_ P!,@ $ 'Gۡ< A@`ww''wwwG H 'G H 'Gà $0'__t`8__t`@G_t`G$ _$`0__t`H_ P%`,$`_ P4  H _\`8\`H\`wH _\`8\`w__t`_w_ǀhc]\ _Ǥ G$ <`<@< w__t`__t`__\ @w__t`__t` _t _ P!,@ $_ P!,@ $ 'Gӡ< A@bww'_\ w_\`\`$w_G@__h_\ _h3_\ w_ P4  H _\`@\`H_@H_\ @_@_w_ P%`,$`_瀤h __o_\ _ o_瀤h_w__t`__t`_\ _t` __t`H_h@0w '_\ w_瀤hG_\$< @'_\ w_瀤oG'G< www'_w_w_w__h_Hw_Hw_װwwwww'_׀ h_w_Hw_w_w_w_w_w__h__߀h_׀ h_Hw_w_Hw_Hw_ǰwww'_@ w_@ w__Ǡ@$hHw__Ǡ@@Ww_w_h.___Ϡ$ @@p __Ϥ$ ,@__Ϣ@__ǐ@@b_w_w_w_h_@__h_Hw_w_װwwwww'_@ w_@ w__@$hHw__@@w_w_h@___$ @@ __$ ,@__@__@@_׀ h_w_Hw_ww_ww_w_w_w_h_@__h __߀h_H w_׀ h_Hw_w_w_ǰ@A@c<wa@]!`]`]@@:`]D @$0A@bww_@ H5 '_G,0D@@m_G,0$@_G,0D@ Ha]D '_G  < ,0D@@Ga]$`?H'G 'G O H'?'G< 0ww?_l@_h__L@@ɐw_0www?_l@_h___L@@ƒw_߰ www_\ w_h_׀h @_l@w_׀h H'Ӡ '_GӠ@wH#*b,p @_l@_׀h_נ`40@w__t`___L@@}w_߰@w_@Qw_www'_w_w_w__h_Hw_Hw_װwwwww'_׀ h_w_Hw_w_w_w_w_w__h__߀h_׀ h_Hw_w_Hw_Hw_ǰwww'_@ w_@ߐ w__Ǡ@$hHw__Ǡ@@w_w_h.___Ϡ$ @@8 __Ϥ$ ,@__Ϣ@__ǐ@@*_w_w_w_h_@̐__h_Hw_w_װwwwww'_@ w_@ w__@$hHw__@@w_w_h@___$ @@ڔ __$ ,@__@__@@̔_׀ h_w_Hw_ww_ww_w_w_w_h_@a__h __߀h_H w_׀ h_Hw_w_w_ǰ A@b\wwa]D '_h_Hw`]w_א 8@wGa]$`_w_0A@aww_h_Hw`]w_D 'G< 0A@a$ww'_h_Hw`]wG_$`A@`ww/'O/_h_Hw`]w_40,0@ w '_ Gӡ4@ '_G GϢ@Gӡ,@4 $G'G< 0A@cww'_h`]w_D 'G_$`G'G< 0A@c$wwww_h`]w _$`_h_瀤h@__t`(__t`0w'G' '  @Hw__@@& 8 A@aww'_w__h G H`]w_w_pA@alw?wwww''_w_w_wwww /`] "  "H /Gנ   2H /H '۠ /H__h "__,@_ w /`]w wHy / /HsGۀ H`]Gې@w`]Gې@~wH_w_L H__h_L __,@_ w_ w_L O /_w_@RwH5 '۠ /H__h '__,@_ w`]w wH /H@HGۀ O, < #a_?ܠDw_߀?h __L@ HSH__߀hL /H!_h__@_߀h__@__@@X H HHe /__L@/HHDHHS__h \__,@_ w_ _߀h(__ L@ 0H!__ L@ 9H__h 0__,@_ w__h 0__,@_ w 0/HGנ HHHHHHHGנ H_ _߀h__ L@ ?H~HDHH__ L@/_ w__h ?__,@_ w__h "__,@_ w__h "__,@_ w__h ?__,@_ wH<H:__ L@`-H`'H`!OO%`' O, < #a_?D`<H `-O`/OO%`< O, < #a_?DH H Gۀ Oe OjOH aH./ bH+/ fH(/ nH/ rH/ tH/ vH//H H_hHGۀ HHH:H/HH_߀?h _L  H H_߀ hH_ hHGۀ HHHHGۀ H,HH__h '__,@_ w__h \__,@_ w__h '__,@_ wHOHMH w`]  @ W  2H /H_  @w /_߀?h_@9wߪ[___@_ߤ$_@@@~wO_O hH_O?h /H{_O?h' /__@_߀h___@LH_ w__@_߀h ___@LOHRH<Gۀ H8 wG _Oh1HH]H#___@_G@L ^H  [O \OO `H ^OOO |OO_G wG_G_O oG[@!H /__O@w_@Ol_ h HxHt__@wwH;H7HH__h \__,@_ w__h<  0__,@_ w__h <   0__,@_ w  0/HH__h \__,@_ w /_w_ hH__h__,@_ w_ w__L@/OHFH< ~O, < #c_?~DHH_πh_4p,0  `< ,4 HHHHHj__h \__,@_ w__h__,@_ w_ w_߀?h __L@ H O__߀o_ h Gۀ HHH0_h H_L H__h_L __,@_ w_ w_L O__h __,@_Hw____GGװ ?__@@sssw_(8000    (     A@adwwwwww_׀h_Hw`]w_wa]D '_____D`D``\`(\`0@@ssswGa]$`_w_ϰ0www___@@w_߰СA@cwwwww_߀h_Hw`]w_wa]D '_瀤h H' '_D G@'___D`G`\`(\`0@sshs w_w_____D`G`\`(\`0@@ssNsGa]$`_瀤h_$ _t`_w_װ0A@b4w`H]\ w 'cx] H_,0@\ @ 'cx]  O_\ b]h_\ @!ch]t`b]ch]t`_ch]h _@ch]`H]t` cx]$`СA@`w'wwwa]D 'G'`H]\ wG H@cx] πHNϠ 4w_ch]@ "h /!<,0 ?_hݗ_Ǡ@? @w__,0@@yw_`H]t`H ch]_\t`\t`_cx] ,0@_cx] $@,0 @_cx]$`_G,0\@w_G,0@\ w_D  '_____D`G`\`(\`0@@ssCsw__h2_ w__G,0t@_b]h_@+_w__G,0@t`_____D`G`\`(\`0@@ss sGa]$`_Hw_װ0A@aLw'wG_`]@?w_ A@`Ԯw'wwG__`]@w_߰@w_ w_0ww__ @ǔw_''wGw@J 8`\@OtG_@?w_''wwGo@% 8`\@OtG__@w_߰0'wG_ @w_0'wwG__ @w_߰A@awww/`] 8`\@OtO@8 __ @,w_߰0w/_O@?͔w_@w_ :w_0ww__@ :w_ 'wwwG___ߐ@?@w_װA@cܮw'wwww`] 8`\@Ot__@G__נ@w_ϰ0www___ @w_߰ wwww____ߐ @w_װ0ww__40,0@w_]  _ ?,Pu 0ww__40,0@w_]  _ ?,P< u 0ww__4p,0\ `?4   2h /@w_  @@w_? @~H_t @ww__@ @0w '_G,0@\`<t`G 'G OHw_t 0ww '_G,0@w_] _G,0\@u G 'G뀤 O0ww '_G,0@w_] _G,0\@ u G 'G뀤 O0ww_D H H$' '_ _\ Hh_\ _G@,0D?HH G '_G@_\ H oG'G< 0ww_D H_\ _ @H'_\ _,0D@'G< 0ww 'G< wwwww/_w__D h_D w_ _߀h_ Hw_w_w_____ǐ@@@K__@@'G HGH1'_Ǡ _t`_ 4  < _,`_ H_\ Hw_w__t`_ H_D HHw_w__t`H_\`Ht`P 'Gá< wwww/w_  @_____ϐ@@@_瀤 h__ @@|'Gǀ HGHi'_ H_\ Hw_w__t`ހH<_D H2_@ܐ'Gǀ HGHG'_\ P_瀤 hH_\`X\`H_D @hH_\`X,0@@9'Gǀ HGH&'OH_@H_D H_@ʐH_߀h_@eH_\`Xt`H_\`Xt`P 'Gˡ<  ww_D H7 wע?_נl@_h HF'_\ _,0@@w_߀h H7'__t`_\ h_\ _,0@@w_πh H '__t`_ H_\ _@@w_߀h H '__t`__t`X 'G< wwww/w__t`__t`p__t`h__t`_,`_߀hހH H'ˠ 'G_,`_D _$`_ 4  < _,`_ 4  < _,`_\`pt`_\`t`x㾠w_\`X\`ph_\ pHwo_\ Xwo_ow_\ Hw__h__$@w_  `\@Ot_\ h9 '[_D H.G[_h)_\`\`@_@G[@ 'W_\ GW @/VV_\ _G[@,VG[,@G[ '[G[_D HG[_ ow_H _\`\`@_@w_k____ @@uww_w?h _  `\@OtHK_w?h_w h ww_\`\`@_@ 'k_\ h_\ Gk @'k_  `\@OtGk_\ _,0$@_ w__w@$ w__h?_\ _,0$@_ w__ o__ oQ__t`H__t`P㾀w_\ Hw_\`X\`ph_\ pHw__\ Xw___w_ H_\ h_ H__h_\`\`@_@  ?H!_ @rH_\`\`@_@ @w_\ _,@_\_ @\-0$@_ wH__$@w_ ς `\@Ot[_] ] @_@_ @@@tKw_?h]G['WG[@KH%G[@M'WgGWϐ@@qӔwO__Oh_\ _@g_@@H_wHH_\_@\\@@_@@@GW_\ _,0$@_ w__@$ w__h?_\ _,0$@_ w__ oH7_?h_ h%_\`\`@_@ 'WGW_\ _,@GW_\ _,0$@_ w_?h _  `\@OtH _  `\@OtH__ o%__t`H__t`P H'_\ Pw__h__$@w_ ς `\@Ot_\ h0 'K_D H%GK_h _\`\`@_Ǣ@GK@ 'G_\ GG @gGK,@GK 'KGK_D HGK_ ogwOH _\`\`@_Ǡ@wO[_O__ @@sPw_?h4G['KG[@PHG[@R'KgGKϐ@@pؔw?__?h_\ _@g_@@H_??h__?@_\ Xh _  `\@OtHK_\ h_\ X,0@А_t _\ h H?'_ Hw7_h_7_\ ,pu_7 w7_7_ o _,`_\ _@g_?@@ʔGK_\ _,0$@__\ _,0t@ w7 _?h'_7_h_7Hw/_$ w/__/@_\ __7@,0u?_\ __7@,0$_7 w7_7_? o_ p] _?_$@u _\ x_ǀh _ ] _?_$@u _\`X\`ph_\ pHw/_\ Xw/_/w__?@w__@wH_\ _@_O_@@YH _\ _@_O_@@M_ Hw?_h__?@_\ _,0t@_? w?_?_ o__@wGK_\ _,0$@_ w__@$ w__h?_\ _,0$@_ w__ oHO_?h_ h=_\`\`@_Ǡ@ 'K_\ h_\ GK @'KGK_\ _,@_ H__\ _,0t@_Ǡ wGK_\ _,0$@_ w_?h _  `\@OtH _  `\@OtH__ o)__t`H__t`P 'G< www?'_\`@\`Pw__hP_\ p_$@w_  `\@Ot_\_@_ @@@qw_?h _?h_ h_ h_ h 'H_\ _ @' w_  `\@OtHG'__@w__ oG_$`_w_߰ A@aww_\`X\`ph_\ pHw_\ Xw_w_\ Hw__瀤h2_\`\`@_@ '_\ h_\ G @'G`]  @ H G@ _\ _,@HG_\ _,@_ w__瀤 o__t`H__t`P w_\`X\`ph_\ pHw_\ Xw_w_\ Hw__瀤h_\`\`@_@ '_\G @\_,@_ w__瀤 o__t`H__t`P㾰ww'_\ @_h __\ @$@wH3_D H _   @_\`ht`p_\`xt`_t H_t @_t P _,`G @?  ` 'Gۡ4 _$`_ H_\`t`_w_߀ h__\ PhR_ Hw_\ Hw__נ@40w_\ _ǡ,0\@_߀h_wH_\ _ǡ,0\@_߀h_Ǡ wHH__π o_\ _ǡ,0\@_߀h_Ǡ w__Ǥ$ G@@ؔ_$ _\ H_߀hM__߀hH_\ _ǡ,0\@_߀h?_\_ߡ-0@\H$,0@@@_\_ߪ@\H$@@@ _ H\_ߠ$@t_ P\_ߠ$@tw_\ Hh_\ __ߠ,0\@$-0t@_נ w__\ H oH_\h_$@_ߠ@tp_\x_$@_ߠ@t _,`_ǀ h_\ _Ǡ$ ,0\@_߀h_Ǡ$ w_ǀ h _\ _Ǡ$ ,0\@_߀o__\ Hh_\ _ǡ,0D@?HH _Ǡ w__\ H o__\ Hh_t HH+_\_ǡ,0\@_ߠ$@tH_\ Hhw_\ Hh?_\ _ץ,0$@_נ w__\ H o_\`\`H @_\`Ht`PH8__ߤ$ G@@_$ _D H_\_ߡ-0@\H$,0@@@G_ H _\_ߪ@\H$@@@8_ H\_ߠ$@t_ P\_ߠ$@tHZ_\ Hw_ H_\h_$@_ߠ@tp_\x_$@_ߠ@t _,`_t H_D H?'_ H_\`\`@w___D $@w__\ h_\ w__ߠ@$ w__ hn_ H`__\ p@_$@w_\ h#_ h_Hw_ w___'kGk$ 'kGk Hy_\ _Gk @ -Gk$ 'kGk O  @__@@nwo__ߢ@_$@_oh_o?h_   @_o__ߢ@_$@$_t`HG'H _$ w__oGˀ?H __ː@_"_t`HGˀ?H__פ$ G@@_$ H(_ HG@YHGˀ _H H'Gˀ H _ H H'à 'G'Gǡ4 _$`_\ Hh#w_\ Hh?_\ _ϥ,0$@_Ϡ w__\ H o_ H _\`\`H @=_\`Ht`PH8_\`\`@_ߠ@$  '_t P_\ h_\ G @'_\ GӐ@p*08408H H'GӀ H _ H H'ˠ 'G'Gϡ4 _$`_ H_ \_ߠ@t__t`@_ p\_ߠ$@t_ \_ߠ$@t_D H_ H_ݐ'Gۀ HGH)'H_H_ H_ H_1H _\ h_H_\`pt`H_t ` 'G< 0ww_ H _\`\``_@ HW/_D H(_\`\``_@,0D?H_\`H\``_@ h_\`\``_@ ,0D?H _\`\``_@ H,/_\ `_@w_ H_\ _ߡ,0\@w_\`\`@_ߠ@ '_ HG砌?H _\`\``_@ H/G/4  w_ H_ `w_\ w_ߠ _t`_\ _ @Hc/_ HM_\``\`Hh_\`\``,0D?H_ `w_\ w_Ϡ _t`_\ _ @H@/_\`\``,0\w_\`\`@_@ 'G㠌?H_ `w_\ w_Ϡ _t`_\ _ @H/_\``@֒: _t``GH/_ `w_\ w_ߠ _t`_\`\`@_ߠ@ /4 @w_\ @_\ @_ H_\ @ ww'_? h_ H'__\ ph G @?  ` 'GHq'_D HH_w_\ _ס,0D@?H_נ$ w_׀? h_ HW'_\ _ס,0D@?O_\ _ס,0D@'_ HG@HG߀ _H H7'G߀ H _ H H'Ӡ 'GH&'_\ _ @'_\ G@o*08408H H'G〤 H _ H H'ߠ 'GH'4 0ww__t`_t _,0@l_t _\ h H' 'G< 0ww _t` _t` @H_t _\ h _t _t  H'__\ t` 'G< 0www _t` @_t _\ h H,'__瀤h  _t`__\ t`H _t`__瀤h __\ t`__\ t`H __\ t`__\ t` 'G< 0ww_\ _t`_\  h$_\`t`_\ ,0@ʐ_t _\ h _t _t  H'_\ _\`\`,0@ڔH_  @* 'G< www_\  h_\  h H+'_\ _\ @_\`\`h _\ _\ @_\ @w_\ _,0@@w_h H'__t`__t`_\ _\ @_\ @w_\ $ w_\ $ w_\ $ w_\ _ס,0\@_\ _ϡ,0\@hW_?h#_\ _,0\@_\ _ס,0\@h_$ w_?h_\ _,0\@_\ _ס,0\@o_?h_\ _,0\@_\ _ס,0\@h_$ w_\ _ס,0\@_\ _,0t@_נ$ w_׀?h _Ϡ$ w_π? hH'H#_\ _ס,0\@_\ _ϡ,0\@h _Ϡ$ w_π? hHH _נ$ w_׀? hHO}_\ $ w_\ _\ @_\ @$ w__$@ w_ \_@t_ h=_?h9_\ _ǡ,0\@_,0\@h_\ _ǡ,0]__@,0u_Ǡ$ w_$ w_ hHH_\ _,\@_,0t@_$ w_? hHO_\ _,0@_,0@@ 'G< www_h(_\  h#_瀤h_\  h_\ _\ @_t`_\ ,0@4_t _\ h H'H+_h_\  h __@>H'_瀤h_\  h __@.H'_  @ H'www_\ hS__\ hM_\ _ס,0\@_\ _ϡ,0\@h_\ _ϡ,0\@_\ _ǧ,0t@_Ϡ w_Ǡ wH"_\ _ס,0\@_\ _ϡ,0\@h_Ϡ w_\ _ס,0\@_\ _ǧ,0t@_נ w_Ǡ w__\ h__\  o__\ h_\ _ǡ,0@_] _ס-p] $,0@@__\ _נ$@wH __\ h_\ _ǡ,0@_] _ϡ-p] $,0@@__\ _Ϡ$@w__t` 'G< ww_h_\  h H'_\`_\ ,0\`h_\ _\ @,0w_\ _,0@@aw_h H'__t`__t`_\  h_\ _t`_\ _\`\`,0@8 H'_\ _\ ,0@w_\ $ w_\ $ w_߀?hG_׀?hC_\ _ס,0\@_\ _ߡ,0\@h _ߠ$ w_w_נ$ wH$_\ _ס,0\@_\ _ߡ,0\@h_Ϡ$ w_\ _ߡ,0\@_\ _ϧ,0t@_ߠ$ wH_נ$ w_߀?h_׀? o_߀?h__ߠ $@w_\ _ϡ,0@_\ _ߠ ,0@@Ɣ_\ $ w_\ _\ ,0@$ w__Ϡ$@ w_ǀ h HL'_ \_Ǡ@t_\ _ߡ,0\@_ס,0\@h_\ _ߡ,0]__Ǡ@,0u_ߠ$ w_Ǡ$ w_ǀ hH#H_\ _ס,\@_Ǡ,0t@_נ$ w_׀? h_\ _ϡ,0@_ǡ,0@@jHO 'G<  ww_\ h __@ђ  "H H~/_\  h__\ t`_ \` t` Hm/_\`\`h_\`,0t`_\`\`,0@+w_׀h HT/__t`__\ \ hw_\ w_߀ h_\ _ߠ$,0\@,t@_ߠ$ w_߀ oH$_\ w_\ _ߠ$ ,0\@_h_\ _ߠ$,0\@,t@_ߠ$ w_\ _ߠ$ ,0\@_o__\ _ߧ,0t@_ \` t` / ww_\`\`h_\` ,0t`_\`\`,0@w_߀h H/__t`_ w_\ w_נ _t`__\ _ק,0t@ /0ww_h _h _\ _\ h H#/_\ w_ߠ$ w_߀?h_\ _ߧ,0\@_\ \h H /_ߠ$ w_߀? o /ww_\ $ ? hH6ww_\ $ w__׀h__נ@40w_\ _ϡ,0\@_h_Ϡ wH_w__׀ o_\ _ߡ,0\@_h_ߠ Hww_w_@ww_ h__\  hH_ \`$ t`__\ h_\ _,0\@,t@_ w__\  owww_\`\` hn_\ ,0wנ w#|,p _l@_\ h?Hw_\ _ס,0@@w_h?Hw__t`_\ _ס,0@@w_\ _ס,0@@w_\ (_ץ,p,p@w_\ 0_ץ,p,p@yw_πh_ǀh _h_h?Htw__t`__t` __t`(__t`0__t`_\`\`,0] t`] t`_\`\`,0 !<,@ $G'Gۀ H_D HGۀ H H'נ '_\`\`,0 Gס4 , !,@$?_\`\`,0u_\`(\`,p,p  @[_\`0\`,p,p  @O_ w_\ w_Ϡ _t`_w_߰ w'_\ @ww_\ h__\ _ס,0\@w_נ w__\  o_w_www_\  h_$ HMw_Œ w_\`@_\` ,p,pww_\ h'_\ _,0\@w__\ hH_ _@*08408H_Hw_ w__\  o___א@@<w_πh _$`_w_߰www'_\  h_$ HXw_@aw_\`@_\` ,p,pww_\ h/_\ _,0\@w_\ _πh_ h4  < 4 〤H_\ P_@*08408H_Hw_ w__\  o___ϐ@@tw_ǀh _$`_w_װwww__t`_` \`9'GӀ H Hj'w_\ h)_\ _ǡ,0\@w_\ _,0@D  H_ _@*08408H HF'_Ǡ w__\  o_\`@_\` ,p,pw_\`\`h_\ ,0 w_\ _,0@@w_h H'__t`__t`_w_\ w_ _t`__\ _,0t@ 'G< @w_\ 0@_\ H@_\`P`h _\ P\ @_\ P@_\ @_\ `@_\ X@_@www p @w_ǀhHw_Ǣ _@'GӀ H_@H~w_Ǡ`t`Pw_\ hc_\ _\ _ס,0\@,0w_D 'G H _ 4  #HH@_Ǩ h 4 < _ 4  < @4 , !,% G H _Ǣ h%`,$`H G H _Ǣ h%`,$`HG H_ 4 #H _Ǣ h%@`,$`_נ w__\  o___@'GӀ H_:w_w_߰ww'wwǐ p @w_hHw_ _@k'GÀ H_@Hw_ h , !<,@$_`t`Pw_\ h_\ _\ _ϡ,0\@,0w_D '_ 4  #'G HHH_ h 4 < _ 4  < @4 , !,% G H _ h%`,$`H G H _ h%`,$`HW_\`P`h$ @_t P_\ Ph_H]w_\ P_@ HHRww_ h%@`,$` H렌 H H H H렌 H  @H H _ __Ǡ$@_Ǡ w_Ϡ w__\  oY___ߐ@'GÀ H_?w_w_װ A@bTwwwwa]\ !@h H'נ '_ 8Gס4 , !,@$_ 8%@`,$`___a]\ @@('GۀHH wGۣ,0c]\@b0]@w_߰0A@awwa]\ w_a]t`_w_0w_\ w_\ w_ߐ !@h__\ H_ߐ@@\_\`H\`Ph __\ P_ߐ@@N_\`H\`Xh __\ X_ߐ@@@_\`H\``h __\ `_ߐ@@2_ 8%`,$` 'G< @w/' _G,@H  _G@: ,@www_\ w_D H _\ !@h H'Ϡ 'Gπ@ /w_\ h_\ _ס,0\@w_\ _ǡ,0@D 'GÀ H__\ _ǡ,0 @_\ !@h_D Hzw_\ _ǡ,0 @_,`_ w_Ǡ w__\ h<_\ _ǡ,0@D  H3_\ _ǡ,0@ 4  H)_\ _ǡ,0 @_,`_ w_Ǡ w__\ h_\ _ǡ,0@D  H _\ _ǡ,0@ 4  O  @i_$@@`_$@hG@=@@]?h_@ &HGÀ H6 ' 'G H,_\ _ǡ,0\@G,0\@w '_ G,Ph _G@G 'G 'G @OG 'G OHGÀ H_\ _ǡ,0\@w_D H4_\ Hh_ 4  H_\ @h# /  @@ @_?h_@  / OHNw_\ (hH  @_\ _,0D@@@] ?h _@_\ !@h_D H_\ _,0D@@@@\?h_@ h_ w__\ ( oH"GÀ H GÀ HGÀ H_ !@kGÀ H _ 8%`,$`H _נ w__\  oqww'G #?Scʠ@? @!"w_w_t _t _t !@_t _\ h H\'G #@?,@w__Ǡ@wG렌 H_נ ?w_נ!w_ 8%@`,$`H _ 8!@,@ $G @ '_ 8Gá4 , !,@$_t (__@@_א@@^'G〤 H 'G〤 H_dH_\ @*_t G'G< A@a̮w'wwwG HG H@>G,0c]\@b0]@w_@А w_߀ h_w__߀h _ߠ$ w __,@___@@-_w_װ A@`ww_\ hw_\ h_\ _,0@@#ݐ_ w__\  o_\ @w_\ h8_\ 0h _\ 0_,p,p\ @_\ 8h _\ 8_,p,p\ @_\ (h _\ (_,p,p\ @w_ w__\  o_\ (@j_\ 0@f_\ 8@b_\ @^_\ @h5w_\ h/_\ @_,p,pww_\ h_\ _,0\@w_2_ w__\  o_\ @/_ w__\ o_\ @@"_\ xa]h_\ x@_\ @_@@w_\ w_h_,_t _t _\ @_t _\ (@_t (pwwwwߠ '_ 8!,@ $__t`_ 8!,@ $_ 8!,@ $_t _t 0_ 8!<,@ $_ 8!,@ $_\ w_\  h_\  @w_πh H'۠ _t`__t` _t`__@@'G׀ H __t _t GHt'ۦ___\ (_! @  2h _ϐ@@'G׀ H_@\__t _t GHK'_t 0__ߠא@@_t h_\ hhO_@#'G׀ HO_ 4  H_! @h _\ (h_@_@'_@ѐG׀ H _C_t _t G'Gۡ< 㾀A@adw/ww w_π h_Hw w_ h_π h_Hw w_Hw w_ h _π h_Hw w_ h_π h_Hw w_Hw w_Hw w_ hD_π h_Hw w_ h_π h_Hwo wo_oHww ww_w h _π h_Hw_ w___ h_π h_HwO wO_OHwW wW_WHwg wg_gHw w_w_  @ _$`?_Ǡl@40_h H'_ _t`_\ ,0@x_t  w__hH_ߡ,0wO_ߐ @_t @_ߠ$ _t``] "_$`@Ɛ 1w_`]@@ƒ H _`]@@ H _ %`,$`_ !,@ $_D HZ_ 4  H a]_t`xHM  @_t x_\ xh HN' 'K 'C 'GGC@'?G??H_\ xGK,0@w7_7]  GG,Pu GC ?HG?GCH _ %`,$`GG 'GGC 'CGG @OGK 'KGK O_\ h_\ @h H' 'G<  A@cww_ %`,$` ' ' 'G`]  @ HG뀤 _H_G,0@ w_]  G,Pu G 'G 'G @OG 'G O0w_\ w_\ pw_瀤h_\ w_@:_w_瀤o_t p _$`_t h_\ @)_t w_\ h\ \ 8w__t`_\ 0_,p,pU'Gۀ HGH'_\ hyw_ǀht__ߡ,0\@w_\ _,0@D 'G HHZw_ǀh$_\ __,0\@,0w_D  H_\ _\ _,0\@hH _ w__ǀ o__ǀhH,G H(_\ (_,p,p\ \ w_@h_\ 0_,p,ph'G HGHg'w_ߠ w__ǀ o_@} _t H_\ HhGHL'_\ H h4  H4_@d _t P_@Z _t X_@P _t `_\ Ph _\ Xh_\ `hGH'H_\ Hw__t``__t`X__t`P_@+ 'G<  A@aܮww / /w_\ hwHW_\ _,0 @ H /H`HHH_\ _,0D@ @H  O OOO OOHA /H=H;H ' '_\ _,0\@G,0\@G4P hH 'G 'G뀤 OH@H_\ _,0@D $  O, < #c_נРD_ w__\  oꀤH逤H?w_\ h9_\ _,0@D  H_\ _,0 @ H_\ _,0@ !,@ $H_\ _,0@D  H  _\ _,0@$`_ w__\  o _$`_ !,@ $_\ h逤H H' '_ G4 , !,@$H x A@aԮww_\ w_\ ,0@5_t _\ ,0@._t _\ ,p,p@%_t (_\ ,p,p@_t 0_\ h_\ h _\ (h_\ 0h H'_\ 0,0@_t _\ hDw_\ 0h__\ ,pu_נ w__\ 0 o_\h`]@@w_\ 0h_\ _ס,p\hH _נ w__\ 0 o__\ 0h_\ @_t _\ h`]_@@{'G〤 HGHg'_\h`]@@j'G〤 HGHV'_\h`]@@_\h`]@@'G〤 HGH<'_@'G〤 HGH1'_ 84  H_\ 0 h _ 4  H_\ h_\ ,p,p@N_t 8_\ 8h H'_@'G'G< www_w_\ h_\ h_\ h_\ wH_\ w_\ o_\ o___א@'Gˀ HGH'_\ h H'_w_\ w_\ _πo_\ o_\ wOG< www_w___א@'GӀ HGH4'_\ h_\ wH(w_\ _ǀh_\ h_w_\ w_׀h H'_\ _ǀo_\ o_\ wOG<  ww_w_D 0 H_\ h_\ ('_\ Gۡ,0\@_t`(_ߨ ]  _\ (< ,@< u H9_D 0 H4_\ h/_\ D 0 H)_\ \ (w_ \`\ t`_\ h_\ t`_\ _\ (,0\@_ק,0t@_׀ @h _ߨ ]  _ס,P< u  'G<  ww_wߠ '_\ h_\ D 0 H__\ @@6_t _\ h_\ t`_\ h_\ D 0 H__\ @@_t _\ h_\ t`G'G< www_\ w_\ w_ 84  H_\ h_\ ( @h _\  _\ (,P h_\ Hdw_א@ w_א@ w_πh ___@@ږ Hw_w_w___@@̖ w_h_h _ǀh_h _$`H&w_\ (w__t`(__t`(_ 44  '_ 4 ,  +,@% _Ǣ 4  , `,$`_w_߰ ww_w_D 0 H _\`\ t`_\`\ 8t`8H1_t __ (@ς `\Ot\ y\ _t 8_\ 8?h H'_D 0 H_\ _\`8,0 D`(4 #, !<,@$ 'G< 0wwH&_\ t` H+_\`\ \`t` _\` \`t` H _\ h_\` \`t` _\ h_\` \`t` H _D 0 O OO 'G< A@c\www_w_\ 8wנ 'HH_\ ha]a]c]@%@H H'Ϡ 'H_ߢ %`,$`_\ h _\ \ \ 8wH_\ \ 8w_\ h _\ \ \ 8wH_\ \ 8w_ǀ? ha]a]c]@%@uH H' '_? ha]a]c]@%@\H H' '_\ (_ץ,p,p__@'Hn_\ (_ץ,p,p_\ \ 8@讒'H^_\ \ 8_\ _ק,0t@_D 0 H_] (_׫,p,p@] \@蒒'HB_D 0 Ha ]a]c]@%@H H'ˠ '_\ \ 8_\ _ק,0t@H_D 0 H  O$ OO$  O, < #`P_ܠDG'G< ```@wwww''_w_w_\ _ϡ,0@D  H<_\ _ϡ,0\@w_\ (_ǥ,p,pt __@@w_?h H='_\ _ϡ,0\@_ǧ,0t@_\ (_ǥ,p,p_@/ƀH H"'H_\ (_ϥ,p,p\  h _\ _ϡ,0\@_ǧ,0t@H _\ (_ϥ,p,p\  hd_\ (_ϥ,p,p\ \ w_\ (_ǥ,p,pt __߀h__πh_\ (_ǥ,p,p_@ƒ/ƀH H'H_\ _ϡ,0@ 4  #< 4 '__@@w_?h H'_\ (_ǥ,p,p_@땒/ƀH H'H_\ (_ϥ,p,p\ \ w_\ (_ǥ,p,pt __@@w_?h9__@@Ҕw_?h Hq'_\ (_ǥ,p,p_@S/ƀH H^'____@@'G HGHK'H_\ (_ǥ,p,p_@+/ƀH H6'_\ (_ϥ,p,p\ \ w__@@~w_?h H'_\ (_ǥ,p,p_@/ƀH H '_w_wO 'Gס<  ww'_\ $ w_\ _ס,0@ 4  H1_׀ h-__\ _ס,0\@h_\ _ס,0@ 4  #< 4 H_Hw_נ$ w_\ _ס,0@ 4  H_׀ o?w_߰ww'_\_,0@ `\@Ot\ \ w_׀?h@_\ _ס,0@  #, !<,@$_\ _ס,0@ w_`5  #< _\ _,0@ 4  #< 4 #, !<-%`_\ _ס,0@ %`,$`__\ _ק,0t@_w_߰ ww_\ h_\ 8_ߥ,p,p  @_ߠ w__\  ow_\ hE_\ 0_,p,p\ ww_\ 0_,p,p\ h'_\ 8__ߡ,0\@,p,p_@ꈒ/ހH H'_ߠ w__\ 0_,p,p\  o_ w__\  o 'G< w /w__\ h 怤HH7 /w_\ 0_,p,p\  hH"__@@- 'G߀ HGH'_\ 0_,p,p\  h /_@_ wO 'G< www/ /_\ (_,p,p\  'Gۀ HGH'ߨ?_\ 0_,p,pt`_\ _,0@ 4 #H5_\ (_,p,p\ h*_\`\`(_,p,p\ \ ,0 4  H__] ,p 4  #@@@'Gۀ HGH'_\ _,0@D  Hw_\ (_,p,p\ hs_\ (_,p,p\ _ϡ,0\@w_\ 0_,p,p\ ?h /HI_\ 0_,p,p\  h__@] 'Gۀ HGHr'H_\ 0_,p,p `\@Ot@烒'Gۀ HGHV'_\ 0_,p,p\  h /_@_Ϡ w__\ (_,p,p\  o_@/H H*'H怤H _\ 0_,p,pt H_\ 0_,p,p `]Ot_ `\@Ot 'Gߡ< 0www_\`__@@: _t``A@b,wwww_\`\``h _$` HZ'_\`\`` /_,`_ !,@ $_ !,@ $_D H_\``\`Hh_\`\``,0D?H _$`_ %`,$` H$'․ \H_\`` \`p h $_$` H'_ /_,` _$`_D H(_\`` @ץ'G@;HGۀ _H H'נ '_ G׀  2H  , !,@$H#`]  @ Hဤ _H H'۠ '_ Gۀ  2H  , !,@$H_ $h _! @h _$`HD_! @h  _$`$ 1< _t`H4_! @h _$` _$`H&_! @h _$` _$`H_! @h _$`!_$`H _! @h _$`"_$`H_! @h _$`H_! @h !_$`H_! @h "_$`H_! @h #_$`H_! @h _$` @_$`H_! @h _$` _$`H_! @h _$`H_! @h _$`H_ $h _砌 h _$`H_ $h _砌 h _$`H_砌"h _! @h _$`Hs_砌"h _! @h _$`HdHbဥ`<H%`' O, < #b_ǠD``H#`BH%`< O, < #b _ǠD`SH`BO,OOW`WO>O`wH`bH``OTOO`sO7O`{H`wOO%`{ O, < #b,_ǠD Hd' _$`_D H'_\``@'G@HGۀ _H H'נ '_ G׀  2H  , !,@$H"_ `]  @ H_ _H H'۠ '_ Gۡ4 , !,@$H_砌(h _$`H _ $h _! @h _$`H _$`H_ $h _ h _$`H_ $h _ h _$`H_砌"h _!@h _$`H_砌"h _!@h _$`H_!@h _$`H_!@h _$`H _$`H _$`H_!   @h_\ ` h_\`\``$  /_砌(hOဤ HH _$` _$`Hz_ h$_\`` \`ph_ `\` t`__@_ `\`$ t`G׀ HG׀ HHS _$` _$`HKHI‥`.H`(H ` O.`$OO%`( O, < #b<_ǠD`^H`?H`.OOO9`[OuO`{H`^OwO%`{ O, < #bH_ǠD 'G< TTX P  www_\`\``h _$` H'_\`\`` /_,`_D H_\``\`Hh_\`\``,0D?H _$` H'․ \H _砌 h_\`` \`ph_ `\` t`_\`\`` /_,` _$` Hx'․ [HK_\`` \`ph _\`\``  /H /_,` 'H _$`H+ _$`H&_砌 h _$`H _$`_,` 'H< :H .OOO =OOGH+'H _$`H" _$`H _$`H _$`H< ]H -OOO ^OO 'G< wwww_\ w__t`ئ__! @h____ߐ@@@@w_D H_ǀhH)w_ϐ@  w_ǀh ___@@ wH_w_h_h _$`Hw_w_װwwwwww_\ ww______ϐ@@@nw_D H_hHXw_D  HQ___! @_D  H+_D  H&_׀ h_D  H______ϐ@@@4w_D H_hHwHw___@@w w_h _$`H w_D  O_w_ǰwwwwww_\ w______ϐ@@@{w_D H_hHew_D  H^_D  HY_׀ h_D  HP______ϐ@@@Ow_D H_hH9w_h_h___@@ w_h _$`HwH_h_w_D  H_D  H _׀ o_D  O_w_ǰA@~bwwwwwww_\ wH__@@Жw_h _$`Hw_D HO_\`\``hI_\``\`HhC_\`\``,0D?H;___ߐ@Ȕ__@@w___@@z w_h_h _$`H\w_\`\``h_\``\`Hh _\`\``,0D?OH_____׬ _ϐ@@@Zw_D H_hH,wH_____ϐ@@@w_D H_hHwH_\  _\ < ,@< h _$`Hw_ ]  _\ < ,@< u __@@w_h _$`Hw_ \` t`_ %`,$`Hx_!@@h _$`Hw_ߠ h _$`Hw_ߠ h___ߐ@______ϐ@@Hw_D  H _! @h _$`HwǠ _$`__@@ w_h _$`HwH%_D #H _ 4  < H_w_D !H_D "HI_D !H _$`__@@ w _$`H _$`__@@ vw _$`__@@ kw___@@ F w_h _h_h _$`H$wH__@@ Gw_h _$`Hw___ߐ@X_Hw__@@ ,w_h _$`Hw_D H _ %`,$`H__\ a(]a0]_D  ! "H _ϐ@@@ w_D H_hHwHe__\ a8]a@]_D  # "H _ϐ@@@ vw_D H_hHwH@HwǠ _$`HwHw_D `H%` O, < #c$_РD` H%` O, < #c@_D%` O, < #cT_D___ߐ@_D  H_D  H _D  H_D  HC______ϐ@@@Қw_D H_hH,w_!@@h_D  H_D  H _$`Hw_D  O_D  O_D  O_D  O_w_ǰ@tHtDLL|wwwwww_\ w_ 0w_\ w_ _t`_w___! @_D  HwH$______ϐ@@ޚw_D H _D  H _$`_D HH&w_ h _ ]  _< ,@< u __@@  w_h _$`Hw__t`(_w_ǰA@{a\wowwwwwwww_\ `w_ߢ\t`\t`_D  Hw___א@@ ֔w_?h_D  H _ ,HwH _$`HOw_?h#_D  H_Hw_D  H_ ,H ___א@@ Hww?ww_ww_w_?h_?h&_! @h_D  H _$`H _$`H w__t``_\t`\t` _$`_Hw_?h__h_D  H _$`HwH_D $ `?'Gw_D $ @? ?ww_ww___א@_hHw_ h_ h _aH]@&Hw_ h>_w w _h#__@@ w___@@  w_h_hH_ w__o__h_Hw__@@ Yw_wHw_D 0 H _aP]\`(@Ք_?h H' '__G@@ Fw_hHM_?h9_ w__h1__@@ w___@@ % w_h_hH(__@@  w_hH_ w__o_h ___@@  w_HwǠ _$`w_ǰA@ycwowwwww_D H_D H _D H_D H H'_D H _\ @ h_D H _\ @  h H'aX] `@O$_D H_ H'_D H_\  H' 'G'G'_D H_ H'_D H_\  H' 'G'G'_D H_D Hϡ< @H'_D 'G'_D H_D Hˡ< @yH'_D 'G'GÀ?HG?H H}'G'G'@@f H Hn'_hH_\ _\ @h+_\ @,0 ww_\ _w,0@@w_\ _w,0@@w_h_h HC'__t`__t`_w_t`G_\`\`@,0$_ @w_\ w_ _t`G_\ _,0$@ 'G'@@  H@@ H_Gǐ@GǠ 'Gǀ!O 'Gӡ<  wwww_@~w_π h H '__ @ H'Gۡ< A@xawwwwwwwwwww / /r  @w P @w_h_h _$`Hew___ߐ@L's_D  H _$`HL_D  H-_ %`,$` /_ߠ!h_ ʅ_ `\Gs@t___ߐ@'s_D  H _$`H_D  H _$` ' //wg___Gs__r@@< @s' G HG _$`H /r___ߐ@'sG_ H?G_ H;_D  H _$`H_D  H,_ `\Gs@t__ߐ@'G H _$`HG H_ `\Gs < @t _$`H / HDwWO_G__ߐ@@ @s' G HG _$`H___ߐ@x's_D H_Hww___O@_$ _D HHeHH_g@ɭH__\ (h_\ (,0 w_\ _,0@@+w_瀤hH>__t`_ (w_\ w_ߠ _t`Gg_\ _ߥ,0$@Hi___g@@8_$ _D HHHU___g@d_$ _D HHHA_\ ___g_ߐ@@@-_$ _D HHH(a`]a]b]@,@|ȖH H'۠ 'HG_ O, < #bX_ϠD_D  H _$`H_D  HHO_ `\Gs@tH_z_D H__\ x@ɱ_\ (h!_\ 0h_\ 8h_\ @h_D Hf_\ Hh_ 4  H[_ %`,$` '_w_@@wg_ghHZ 'c_Gc,0\@hH Gc 'cGc OGc H% '_w_@@]ww_whH2__w_g@@2 ww_whH#H_@{_gwwH_@  '_w_@@0ww_whH_wH wϠ _$`_@{_@w_ϰpwww'ww/_\``@'GÀ H _$`_\``@A_$ _ `\Gà@t H?'_ `\G@t_D  H _D  H_D  H ___@@.H!'_D  H΀H__ϐ@G H H '_$ _ _,` 'Gǡ< www_ / '_\`\``h Ht'Gۀ H Hm'_D  H_a/H_ `w_\ w_Ǡ _t`_\ _ @/_\`\``h HJ'ဤH _\`\``  ]HH _\ G,@G۠ 'O_ `\` t` _\ G,@H _$`H _$`H _$`HH_D  H OOO OO 'G<  wwww_@zH h H '__ @* 'Gۡ< A@tbwwwwwww_w_!@h_ah]@@z4 H _ap]@@z* Hax]w_\ _\ Hh_\ H,0 w_\ _,0@@|pw_h H9'__t`__t`_ Hw_\ w_ _t`_@|_\ _,0$@_a(]@@y H:_h 'G`]  @ H __G @ƞGǠ 'Gǀ!OH 'G`]  @ H_Gǐ@ƅGǠ 'Gǀ!OH_a]@@y H:_h 'G`]  @ H __G @\GǠ 'Gǀ!OH 'G`]  @ H_Gǐ@CGǠ 'Gǀ!OH_ap]@@ye H:_h 'G`]  @ H __G @GǠ 'Gǀ!OH 'G`]  @ H_Gǐ@GǠ 'Gǀ!OHY_a8]@@y# H:_h 'G`]  @ H __G @ؒGǠ 'Gǀ!OH 'G`]  @ H_Gǐ@ſGǠ 'Gǀ!OH_ax]@@x H:_h 'G`]  @ H __G @ŖGǠ 'Gǀ!OH 'G`]  @ H_Gǐ@}GǠ 'Gǀ!OH_a]@@x H:_h 'G`]  @ H __G @TGǠ 'Gǀ!OH 'G`]  @ H_Gǐ@;GǠ 'Gǀ!OH_a]@@x] H:_h 'G`]  @ WH __G @GǠ 'Gǀ!OH 'G`]  @ WH_Gǐ@GǠ 'Gǀ!OHQ_ah]@@x H:_h 'G`]  @ H __G @ВGǠ 'Gǀ!OH 'G`]  @ H_Gǐ@ķGǠ 'Gǀ!OH_a]@@wْ H<_h 'c]\ Gǡ,0@ @H __G @čGǠ 'Gǀ!OH 'c]\ Gǡ,0@ @H_Gǐ@sGǠ 'Gǀ!OH_a]@@w H:_h 'G`]  @ H __G @JGǠ 'Gǀ!OH 'G`]  @ H_Gǐ@1GǠ 'Gǀ!OH_a]@@wS H:_h 'G`]  @ H __G @GǠ 'Gǀ!OH 'G`]  @ H_Gǐ@GǠ 'Gǀ!OHG_a]@@w H:_h 'G`]  @ H __G @ƒGǠ 'Gǀ!OH 'G`]  @ H_Gǐ@íGǠ 'Gǀ!OH H'ˠ 'Gˡ< wwww/ww  @xrw P @xmw_h_h _$`HwހH _ %`,$`____@@C'G H _@v_@G_$`Hyw_ H__ @B_ߠ w_ OހH_÷_D H__\ x@ '_w_@@w_hH8_D H- '_w_ %`,$`_@@ϖw_hH___@@ w_h_HwH_@_H w_@v_@x _$`w_ǰwww?w___@뱔_ /_D  H?HGw_D  Hր ,HH:_D  Hր 0H ր 9H_׀?h?Hw_׀?h֠$ 0< H w_ץ,p,p֠@$ 0w_w_w_#ch?Hw_w_wO_w_߰@w_\ @u_\ @u_@uwww'G'___ǐ@@w_װwwww_D h#@vw_ǀhHPw_\ p_t`__t`p_$ _ w_D 'Gà _$`_\ pGá,0@ w_t __t`__t`__Ϣ (\t`\t`_Ϥ 4!,@ $_Ϥ 4!,@ $_t _t ?_t`8_h__t`_瀤h__t`_w_װ0ww_w_D 0 H_\ (_߀h _ 4%`,$` 'G< @w_D  H_ 4  < H_\ -H_D  H_ 4  < H_\ @t0ww_ (͐ 'G< www_\ w_w__ߠ (@_t _\ hHLw__\ t`_\  4%`,$`_\ w_\ h _\ w_Ǡ wH.w_\ _h_\ h_w_\ w_\ w_߀h_Hw_\ _o_\ o_\ w_Ǡ wO_wwww'G۠?H HC'G۠ H _\ w_\ wHw_@sw_ 84  H____Gې@@@@ss@s'H______Gې@@@@ss@ks'GӀ  2H 'Gס< wwwww_____א@@@s @sw_ϰwwwwww______ϐ@@s @sw_ǰwwwwww_w_w________@@sss @;sw_wwwwww_w_w_w_________@@sss @sw_wwwwww_w_w_w/__נ@ww_瀤 h_׀ h _ h__瀤h?HGw_׀ h)_瀤 h!_@t+w_h?H4w___@@sD__@__א@@s;_wH_wH_w_______@@s< @sw_@rː_w_㾠A@m`\wowwwwww_w/Ơ '__נ@w_߀ h__瀤h?Hw__ h _׀ h __߀h_wH_ h _׀ h__hw_ 84  @ 'GG@'_ 84   @?,@'GG@'__h_\ h _ 84  H_ք_ 84  Hw_ǀh wH!_ 84  < H_\ _\ 0h_\ w_ hwǠ wH_\ 0 w_,0@sFw_h?wHr________G@@ss@s'wG H?wH%_ǀh!_ 8___4  < @@P , !,@%_ 84  < H?w_ h+ƀH$_\ _߀ha]a]b]@!@rH H'{ '{_\ _ߠ$@wH_\ w_@q_w_A@kcĮwwww' '_ wG〤 H'_ǡ,0@r_t _\ h H'_ǡ,0@r_t _\ h _\ @qh H'__t`HnG〤 H4__\ h,_\ _ǡ,0@@sw_h H'_\ _ǡ,0@@sw_h_@q8 H~'__t`__t`__t`H8G〤 Ha]a]b]@"-@qxH H'à '_\ _瀤ha]a]b]@"/@q]H H' ' 'w_瀠h__ϡ,p\_\ ,pu__ϡ,p\ _\ ,pu_Ϡ w__瀤 o__\ h??_\ _ϧ,0t@_\ _ϧ,0t@_Ϡ w__\  oG'ߡ4  wwwww_瀤h_ 8%!,@$__t`__t`__t`H_ 8!,@ $_t w_t __t` A@jcLwwwwwww_w_wG'_\ w?wwa]O!`\@Ot_w_\ h_ 84  H__׀h _ 84  H_\ Hw?w?_?wG_\ (w7__\ 0h __\ 0 $@Hw/w/_/wo__o$@w_\  h_\ Hh_\ Ph _\ Xh_\ `h H'_\ H\  h"_\ P\  h_\ X\  h _ 84  H_߀ h _׀ h H'ww_ǀ h_\ h H'+ '+G+@ /O___^` _\`(\`! @  2h @s'G HH`_w_w_ 84  /OG_\ ,0@@&'G HHG_ǀ h_ 4  H!<,0 ?_h 'H1_ ,0@pw_h 'H#Hw_wG @?  ` ''G''__߀h?H'# '#G#'__߀h_Hw_w_w__߀h_Hw_w_w_D  "H /n_Gh0nH _\ ! @h _7h H' '__׀h H' '_7h H' 'GG@G@H'  ' G ' '__ h__hHHH__h$_G_7__L@,084084 MH_ w__h_G_7__L@,084084 MOH%__h _G__L@,084084LH_ w__h _G__L@,084084LO__h%__瀤 h H'__L@,08408'G'g_7h_7Gg @H'Gg'_GGL@HH-H__ h-__瀤 h H'__L@,08408'G'g_7h_7Gg @H'Gg'_GGL@HH _$ w__o__hHHY__$@w__ hO_G@'G HH__$@w__瀤 h H'_W_ @'G'g_GGgL@HH_G@w__ h__h 'HOHG$  O, < #a_ߠDO_G@™'G HHnH _ h __D ?HHt 'G w/ w'__׀hHwwO_@@Ӕww_w?hV_w?h 'H[_ww_ 84  H_ǀ h_\ h__w,0\@wO__w@@^w_ 84  H _ǀ h _ 4  H_\ hO@C'G HHG HH?wwHH O@$_G@wOU_ǀ h w _ǀh??__,0@t`__,0t@_ w__ǀ o_t __t`_ 84  H*_ǀ h&_ 4  H _\ h H' '_O__G@ @@@'G HHw_ǀh]__,0\@?hN H5__,0\@_h_H w_g__,0\@,0\w___,0t@__,0@\ _h_H w_g__,0@\ ,0\w___,0@t`__,0@w_\_@t__,0@ w_\_@t_ w__ǀ ow_oh??___@,0u___@,0t`_ w__o o_\ h3w _ǀh-_\ _,p\h__\ _-0\ ,0\@ ,0t@__\ _-0\ ,0@\  ,0@t`_ w_ _ǀ o_@lP_\ hO@$,OCG'G< w_\ ww_\ w_\ w!<,0 ?_׀h H'_נ ,0@m>w_ǀh 'H_\ h~_נ ,0@m+w_h 'H__נ ,0@ @l____א@@@%_@@R'_@kސGӀ HH_\ h_\ hH+_נ$ w_׀? h 'Hj_\ _ס,0\@o_\ _ס,0\@ h4  O_] _ס,p\@v@wO____נ @@'_@kwGӀ HH7H%____א@@@%%_@@'_@kxGӀ HH_\ h 'H_\ @ke__t`w__t`__t` '_@kV_@kSG'G<  www_\ w_\ H h4  HC__$ D`@J'Ӡ H_\ PH6wӀ H_\ HH.wӠ H Ӡ H_\ `H"wӠ H_\ XHwӠ H__\`H\ PӐ@H w_\ HHw_\ HHw_߰СA@eaww/w_\ wwǠ?w_\ `w_瀤 2h /_w 'Ӣ__@w_hGӀ Ha]a]c0]@$k@kH H' '?Hw_\ Ѐh2__\ _,0t@_\ h' /__ @@y'GӀ HGHw_ h4  H__ @@ђ'GӀ HGHw_ h4  H_ h4  H ___@@,h H_Hw_w w_\`\``h_w_\ ` w__\ Xh__\ H h,_\`H\`ph&_@ 'GӀ HGӀ Ha]a]c0]@$@jvH H' '?H}wߢ__@@ w_\ Ѐh __@@ w_h"GӀ H?H]w_\ Ѐh_ǀhH _@@w_hH9H __h_wH /_ h4  H_ h4  H __\``@@h_\ `w wwHH_\`\``oV_瀤h_\_@t_w_߰0ww'_\ _,0@D '_\ _,0@ 4  #'G〤 H H0/߀H H)/ߠ H렌 Hߠ H Hߠ H렌 H ߠ H  H H/ / www__D`@A'w_\ h#_\ _\ _ס,0\@Ӑ@*08408H _\ _ס,0\@H w_נ w__\  ow_߰wwwwww_w_\ w_\ _ס,0@D  Hp_\ _\ ,0\@ w_\ (_ץ,p,pw__א@Ē/H?H;w?ww_\ hH_\ _,0\@w__@ǿhH/_?h_wH'__@ǭh_Hw_ǀh__\ ____ϐ@@@ H?HwH _ w__\  o_Hww_\ _ס,0@D '_\ _ס,0@ 4  H____\ @@: wHrG Hn_\ _ס,0\@ w__,0@\`\`$w_ǀh/__,0\@?h __,0@\ ?h?Hw_h_\ w___,0\@_\ _@@jS H?Hw_ h*__א@/H?Huw_\ (_ץ,p,p\ \ w_\ _\ ,0\@ _@h_HZw_ h__\ _ס,0@_\ @@*08408HC_\ _ס,0\@w_ h_\  Hw_\ _@w__t`_ǀh#_\ _\ h_\ _\ ,0\@h_\ _\ ,0\@ _@Ʀh?H w_t _Hw?w_wwwwww_w_\ w_ _t`_w_\`\`h_\`\`,p,p@iw_h HS'_ \`,0t`__t`__\ _,p,pu__\ _,p,pt`_ߡ,0@h`_\ _,p,pt _\ _,p,p\ h H '_\ _,p,p\ __ߡ,0@@gc_\ _,p,p _ϐ@S'G'Gˡ< A@aaDwwwwww_\ $ w__t`_w_ǀ? ha]a]` ]@%@g2H H' '_\ _ǥ,p,p\_t`__\ _ǥ,p,p\ _,0@@g_\ @f_\ _ǥ,p,p\ @f_\ _ǥ,p,p _ׂ `\@Ot_\ _ǥ,p,p\ w_ϰ㾰A@`ctwgwwww/_\ wa] `\@Ot /~ހHw_\ ,p,p@g_t _\ h H'Hw_\ w  @f_,0/h _,0  ?#wH_,0@g^w_h_@ H'נ /~___,0@@fq_\ w__\ h______@@@__\ hY__\ ȀhS_hBwo_瀠h__o,0\@?h __o,0@\ ?hH _o wo_o_瀤 o_o_瀤h_@eՐ~H_@eΐ_@Hx'___ߠ@@ȘwH_@e~H_@e H]'___ߪ__@@sw_? h5_?h_@e~H_@e_@C H5'_h___ߠ@@wH_@eq~H_@ej H'__\ oK_@e^~H_@eW_@'Gס< 0w_h)w_\ h_\ _,p,p\ (@e2_\ _,p,p\ @e(_ w__\  o_\ @e 'G< wwwwww_\ _ߡ,0@D 'Gˀ H_\ _ߡ,0\@ w__πh ___,0t@?__,0@t`HKGˀ HG_\ _ߡ,0\@ w__πh;__,0\@_׀h___,0@t`___ϡ,0@@e H#_\ _ߡ,0@ 4  H__,0\@?h ___ϡ,0@@dH___,0@t`ww '_\ wע_\ @Z'G瀤 HGHq'___נ@@ǖ'G瀤 HH\_׀ hV_\ _ס,0\@hG H' 'G'G_D H_\ _ס,0@ @d_@dG H9'w_נ$ w_\ _ס,0\@h___נ@@/'G瀤 HH___נ@@s'G瀤 HH_׀ o '_@dG'G< wwww_\ w_\ _,0\@ ww_\ h_\ _,0\@w '_\ _,0@ 4  H____\`@@@'GH/__\ _,0@_@@*08408H_\ _ ,0\@h_\ _ ,0\@ _\ _,0\@³h 'G HH0_\ (h_G@w__ _\ _-\__@@@*08408HH__@l/H H '_ w__\  ov 'Gۡ<  ww_\ w__\ Xh__\ H h_\`H\`ph _@ 'Gۀ HGH'__h_\ _ߡ-0 _$,0@ @cǔ__t`ؠ 'G< wwwww_߀hJ__ϡ,0\@h __ϧ,0\@_t@H3__ϡ,0\@h,__ϧ,0\@ _\ @'Gˀ HGH!'ۢ_@p__ϡ,0t@_@bːGˀ HGH '_Ϡ w__߀ o 'Gۡ< wwww_\ wϠ '_\ _,0\@hH w_\ _,0\@ w_w_\  h _\ _,0t@HD_h-___@@f'Gˀ HGHR'_\ (h____ _\ _@@@2'Gˀ HGH6'ۢ__ߐ@_\ _,0t@Gˀ HGH#'_h_\ _,0\@ h4  H____@@*'Gˀ HGH'۠ 'Gۡ<  www 'ߢ__@§wG߀ HGHF'_\ 8h8_Ϣ 8_\ @'G߀ H H2'w_\ h#_Ϩ 8_\ 8_\ _ס,0\@,p,p'G߀ H H'_נ w__\  o___Ϡ 8@L'G< wwww_\ 8_,p,pw  @bGw_\ h_\ _ϡ,0\@w__hHl_\ _,0@D  Hc_\ (_,p,p\ \ w_\ (_,p,p\  h _\ (_,p,p\ \ Hw?w_w__@jh __@bh_$ ?h*__@Uh"__@Mh__\ 8_,p,p@'Gˀ H_@a%GH9'_Ϡ w__\  ow_\ h%_\ _ϡ,0\@w_@h__@" w__@S_Ϡ w__\  o_@` 'Gۡ< wwwwww_\ w__ߐ@@w__ϐ@@}ww_\ hN_\ _\ _,0\@,p,pw_\ _\ ,0\@w__\ _,0\@____@@@": w__\ _,0\@____@@@: w__hH H /_ w__\  o /ΰw'www_\ w_\ 0_ߥ,p,pww_\ h_\ _,0\@wH_׀?hr_\ _ץ,p,pw_\ _hHV_瀤 @h _ " _,P hHG_\ (_,p,p\ \ w__߀h G H?H'Ӡ H'_G___א@@'G?H?Ht'G H G H Hi'_瀤 @h _ "  _,P<< 5 _L /_ (wO/OOH=G H__\ _,0\@h?H='H+G H__\ _,0\@h H+'HH_\ _,0@D  H OZOO OO_ w__\  o@G @ 'G'Gӡ< wwwwww_\ _,p,pw__\ h?H1'_\ _׀h H('__\ @ "h 'G__\ @ "h , 'G H H'_G___ϐ@@И'Gˡ< wwwwwww_\ h__\ _,0\@,p,pw__\ h_\ _πhH_\ _\ ,0\@w_\ _πh?w?ww_\ h8_\ _,0\@w_\ _,0@D 'G H__\ _,0\@h_wHG H __\ _,0\@h_w_ w__\  o_?h____@'Gǀ HGH'_?hGw_\ hA_\ _,0\@w_\ 8_,p,p_@h$_\ 0_,p,p_@h____@'Gǀ HGH['_$ w_ w__\  oHBw_\ h<_\ _,0\@w_\ _,0@D 'G HG H__\ _,0\@hH____@|'Gǀ HGH'_ w__\  o_ w__\  o 'Gˡ< 㾀wwww_\ w__@@ww_w?h H!'ww_\ h_\ _,0\@w_\ _,0@D 'k__\ h __\ hHGk HH_\ _w,p,pw__wwo__\ _hH__\`\`$wW__W@wO_Wh _\ _,0\@H w/_\ (_,p,p\ \ w/_/wG_O_\ h2_\ _O,0\@h*_\ _O,0\@h"_\ _O,0\@ _G@h__ ___G_O@@*08408HHj_h_ 8`\@Ot_ @'Gˀ HHn_w_w_o@6/FFH 'H\__,0\@w7_@'Gˀ HHK_\ h__\ __ @'Gˀ HH4_7__,0t@_o@" @W_\ _o,p,pw__o wo__L /^__ (w_O^/\O\/]O]O)_ w__\  o '_h_@\ҐG'Gۡ< wwwww_\ w____ߐ@@'GÀ H(_Gà@_׀h!_\ _Gà@,0\h_\ _Gà@,0\ _\ _,0\@h 'G'Gӡ< www_ h4  H__@@_$ _D HHRw_ `w_\ w_ _t`_\ _ @/_\ Xw_׀h_֡,0\@H6w_\ `w_׀h_\``$ D`@Q' H _֠!< ,0\@Hw_֡,0\@Hw_\ _@@ *08408H _$`HwO_߰www_\ w_\ `w__\ ؀h __\ _ϧ,0t@__t`H^_\ _ϡ,0\@h __\ _ϧ,0t@HNw_\ _ϡ,0\@w_\ Pw_瀤h_\ Pw__@_$ _D HHdwH _ `\@Ot_\``$ D`@Ŕ'__פÐ@w__\ _ϧ,0t@_w_h_@[_\ h2_瀤h.__ _ϐ@@n_$ _D HHw_ h4  H__ @@Œ_$ _D HH w_\ _ϡ,0\@w_w_߰ ww_\ w_\ `w_Ϡ w__׀hH!w_ `\` t`_\ _ϡ,0\@o__@$w_D H_߀o_w_www_\ ww_\ h<_\ _ϡ,0\@w_\ _,0@D  H$_\ _,0\@ @h_\` \`_,0\@,h___@@ܔ'Gˀ HGH '_Ϡ w__\  o 'G< ww_\ ww_\ h_\ _ϡ,0\@w_\ _,0@ 4  HH_\ _,0@ 4 #HN_\``D`@'_\ _,0@ 4  #< H H4_\ _,0@ 4  #< H H#_\ _,0@ 4  #< H H_\ _,0@ 4  #< H  HH___\``@@'G HH~_\ `G@w_D GHGH'_D 'G_$`__@В'Gۀ HGHh'_\`0\`_,0\@,p,pw_\ _,0\@w_h _ `\@OtH_\ P_@Ȕ'Gۀ HGH:'__$ D`@'_ߤ@ږ_\ _,0t@_h_@Yΐ_\ _,0\@h Gۀ HGH '_Ϡ w__\  o 'G< 㾠ww_\ w_\ `ww_\ h`_\ _ϡ,0\@w_\ _,0@w_D  HHD_ 4 #H>__D`@'_ 4  #< H H(_ 4  #< H H_ 4  #< H H_ 4  #< H  HH_\ w___ǐ@@'Gۀ HH__\ h_\ _,p,pww_w\ _h_w\ _ǀhH_w\`\`$w_ h_\`0\`(_,p,p\ \ ,p,pH wo_\`0\`_,0\@,p,pwo_ow__w\`\`$w__$ D`@'_\ _,0\@w_\ _ǡ,0\@hH wg_\ _ǡ,0\@\ wg_gw_h __@_\ _,0t@_\ _,0\@hGۀ HHqH3O_\ P_@r'Gۀ H__@XH]_ߤO@_\ _,0t@__@X_\ _,0\@hGۀ HH>_ h&_\ _ǡ,0\@\ _h___ǐ@N'Gۀ HH"__@'Gۀ HH_ w__\  o_Ϡ w__\  o 'G'G< 㾰www_\ w_\ w__@@ϒw_?h_\ _,p,pw_\ _h H{'_L /_ (wO/OO_\ _,0\@ww_\!ha_\!_ǡ,0\@w_\ _\ ,0\@_πhHF_\ w_ww_\ hq_\ (_,0\@w_\ _$@w_ h5__@_\ Hh__@_\ phHP___@X'G HGH'_\ w__@_@_@@YՔ HH/__@w__@w_____@@@'_\ wG HH G HGH'_ w__\  o__\ hH_ h_ w__瀤h__\ $@ww_w h1__\ H h__\ p hH_@'G HGH'_\ w__L@'k_ wGk'gGg__$ L@HH_\ _,0\@hHn_\ _,0\@ wo__o_ϐ@@ʖ w_?hHX_\ h__\ $@  @X_t _\ h HT'__\`\`\`__@@ @s'G HH*G HGH6'___@@w_h H''_____@@@('G HH_ w__瀤oL_Ǡ w__\! o 'G< wwwww__`\`\`__א@@ @ts'Gπ HGH%'____\ _\ @@@Q'Gπ HGH'__\ @_\ $@w__ǐ@'Gӡ< www'w_\ h&_\ _ϡ,0\@w_\ _ǡ,0@w_D G〤H _\ _瀤h_H w_Ϡ w__\  o?w_װ㾐wwwwwwG'_\ w 'w_\ _,0\@w_\ __D @ h>_\ wO_O_Ϣ@_D @ wG_G_O h !<,0 ?_Gh H'_\ _G,0@@XwW_Wh H'_W_t`_G_t`_W_O-0_\ $,0@ @VG_\ h_\ HwW_wW_Ww_\ wg_\ `w_\ _t`__t``__$ D`@'c__߀h%o_@H'G HGHh'_o_Gː@@7'G H_@UYGHT'H(_\ _,0\@w_h_ h4  Ho_ @'G HGH4'Ho  @U__߀h _h@_ h4  H:_wh_o__Gː@@@'G H_@UGH'Ǣ_oc@w_h G H_@TGH'__\ _,0t@w__πh__D hww_\ _ ,0\@ho_\ _ ,0\@ 'G H_@TGH'_h___ o@@'G H_@TGH'_ w_wh,_o_Gː@@h'G H_@TGH'_o__Gː@@@d'G H_@TtGHo'__$ D`@'c_oc@_w_h G H_@TSGHN'__\ _,0t@_h_ HwOwO_Ow__πh__D o[_@T1_\ _ϡ,0\@hH wO_\ _ϡ,0\@ wO_Ow__t`_g_t`__t``_h __א@h H'Ǡ 'Gǡ< wwww_\ wϠ '  @Tw_\ h '_\ _,0\@w_\ _,0@ 4  Hd____@@'G HV_\ _,0\@w_G@ww_\ _w,0\@ww_h_ @y'G H_@SGHf'ۢ_@/΀H_@S HV'ۢ_Ϡ@#_\ _w,0t@_\ _w,0\@h G H_@SqGH8'GH__\ _,0@_@@ *08408H__\ _,0\@K/΀H_@SI H'_ w__\  o]_@S: 'Gۡ< www'_\ @Ӓ'Gۀ HGHb'w_\ hO_\ _ϡ,0\@w_\ 0_,p,pw___G@Ȗw_ǀ?h_@Ē'Gۀ H_@RGH0'H___G@@@.'Gۀ H_@RҐGH'_Ϡ w__\  o_\ @R_ `\@Ot 'Gߡ< wwww'_w__ϐ@hy_\ _ϡ,0@D GۀH_\ _ϡ,0\@_߀hGۀ H__ϐ@|/΀H HW'HS__ϐ@m/΀H HH'_\ (_ϥ,p,p\  hH9_\ (_ϥ,p,p\  h__] (_ϥ,p,p\ \ _Gې@@'Gǀ HGH'_\ (_ϥ,p,p\ \ w__ϐ@:o 'Gס< wwww'_\ w__@@ w_?h H'_\ _,p,pw__\ @hH__\`\`$w__瀤hU_\ (_\ ,p,p\ \ w__@hH_@'_Ϧ_Gې@'_@'_@QGˀ H G HG HGˀ HGH 'GG@?,@G @'G'G'GH'O_\ _\ ,0\@w_\ _,0\@h=_\ _,0\@ _@hHY_\ _,0\@ 'ˢ_@^/Gˀ HH_@QXGˀGˤ@?,@ @'G'GH='H_@'Gˀ HGH.'ע_Ϡ@Ҕ_\ _,0t@_@Q,_\ _,0\@h Gˀ HGH'_L /_ (wO/OO 'Gס< 㾀ww /Ҡ / /wH !  ?#w?H@Rw?_?h H/ /_?wo_?!@wgw7_t X_7_t``___o_g@@w_$ ? hH_?@P_ h  !@Ri_t X Hn/ Hk/w_ @]'G瀤 HH-}U!UU_Ǡ h-w_g _ߡ,0\@_ @ h_נ w_g_ס,0@_ߡ,0\@_@o__ס,0\@_Gӧ,0t@__ס,0\@_GӠ!< ,0t@_,0w_ǡ40wGӠ '_ǀo_ߠ w_߀  oG *08408H.w_h)_g_ס,0@ *08408H__ס,0\@_t`PҀH__ס,0\@_thPH _נ w__ oH_@Nj_@Ngw_h_o_ߥ,p,p\ @NY_ߠ w__ oH_?@NJ /PA@Hb\wwwww_ wBww_\ hW_\ _\ _ǡ,0\@,0w_D '{_ 4  #'wG{ H _ @ђHcG{ H _\ @iHWG{ H(_D H _\ x@XH _\ ؠ @h _\ ؠ hH-G{ H'? @NqH a]@*_\ ؠ @h _\ ؠ hHHwHw H /vvH  THHw HHw H^woG{ H_ 4  HH_D H%w_,0wg_g\ __,0@\ \`x\< @w____gt`_o__@wo_ w_  oHw_,0wg_g\ __,0@\ w____gt`_o__@wo_ w_  o_ohHHw H^woG{ H _ 4  H#H4_D H%w_,0wg_g\ __,0@\ \`x\ < @w____gt`_o__@wo_ w_  oH w_,0wg_g\ __,0@\ < w____gt`_o__@wo_ w_  o_ohHw_hG{ H__,0@_ @*08408HHw/wW_,0]__,0@\ w__,0u@_/_@w/_ w_  o_/hH|ww'w7_,0^<__,0@\ w__,0u_'_@w'_,0]@__,0@\< w__,0u@__@w_ w_  o_'h*__,0@7@~__,0@W@v__,p,p_,p,p|'GӀ HH\_ w__,p,p_\ _ǡ,0\@/ҀHHD_hH _ w__ oI__h%__,0@@.__,p,p_\ _ǡ,0\@'GӀ HH_ w_Ǡ w__\  o_Hww_h__,p,p\ @K_ w__ o?w_װСA@F`wwwww_\ _,0@w_D  H_\ _ @/ H H'_ߦ _\ ph H'_\ _ߠ  @/ H H H H' 'GH' H ' H  H Hp'H> H ' H  H H]'H+ H ' H  H HJ'H H ' H  H H7'H H2'_G˦@_\ ph H''۠ w Gˀh_\ __@ / H H H'_ w_Gˀ oGH'__ߐ@'_D  H(Gˀ H H'_\ ؠ @h _\ _ @ H_\ ؠ h _\ _ @ H H'GH'__ߐ@'Gǀ HGˀ HGˀ H H'_D  H_\ w '_\ @h _\ Hh_\ (h __ߐ@kH' 'G'w_\ (hG_\ _,0D@HG'Hf_ w__\ ( ow_\ Hh_\ _,0D@'GG@@MHG'HE_ w__\ H oa] `@O$G'w_\ @h+_\ _,0D@'_\ _,0D@'@@LВ H@@LȒ HG'H _ w__\ @ o_ 4  HGH'G H H'GGˀHGH'G'GH'۠ 'Gۡ< 0www_\ _ @/H@_ 値H H/HI_\ @*08408H H/H9値 H Hw/値 H_\ \ ؠ @h 値 H _\ \ ؠ h H`/H H[/_D  H  O OOO OO_ 4 #H?__D`@'_ 4  #< Hߠ H(_ 4  #< Hߠ H_ 4  #< Hߠ H_ 4  #< H ߠ H H/ /0w_w', _\ Xh HY'_\`X,0@B'G HGHK'_\ Ѐh_\ _\ X ,0@@K\w_߀h H5'__t`_ H_D H_'G HGH'H_H_D H_H _\ h_A 'G<  w'wG_$`?_t`_瀤 h) (wע?_נl@_瀤h H('_,p,p@IƐ_t _,0@I_t!_\ h_\!h H '__t` _$`__ta 'G<  ww_\!hB_\!_,0\@ww_\ h_\ (_,0\@w_\ @HT_@HQ_ w__\  o_\ (@HD_\ h _\ \ @H:_\ @H6_@H3_ w__\! o_t!_t @w__\!@H_\ @Hwwwww_\`\`耤 h._\`\`,p,p@JKw_ǀh _\ @G H'__t`_] ] ,p,p] ,p,p @H}_ \`,0t`_\ h_\`\`$ ,p,p\ _瀤h  _\`\`$ ,p,p,` __\`\`,p,pu__\`\`,p,pt`__\`\`,p,pt`__\`\`,p,pt`__׀h?H'Ϡ 'G_\`\`,p,p4`"_ w_\ w_ _t` _\ _,p,p,` _D __ߢ$@h__ߠ$@_$` 'Gӡ< ww_\ w_ww_׀h__נ@40w_\ _ϥ,p,p\ _h_Ϡ wH_w__׀ o__ǀh_\ _ߥ,p,p\ _h_Hw?Hw_ www_\a\ah_\!,0w_\!_ס,0@@IGw_πh H6'__ta__ta  0@H_\a\a,0t_\a\a,0\h H'__\a\a,0\t`_!w_\ w_Ϡ _t`__\!_ϡ,0\@t` 'G< www_\` \`h_\ ,0 w_\ (_ϡ,0@@Hw_ǀhH$w__t`(__t`  (@H1w_׀h__\`(\` ,0u__t`__t`_ \` t`_w_߰ wwwww__t`__t`__t`__t`_   @Fwww'_w_w_w__h_Hw_Hw_װwwwww'_׀ h_w_Hw_w_w_w_w_w__h__߀h_׀ h_Hw_w_Hw_Hw_ǰwww'_@E w_@E w__Ǡ@$hHw__Ǡ@@Fw_w_h.___Ϡ$ @@F __Ϥ$ ,@__Ϣ@__ǐ@@E_w_w_w_h_@E__h_Hw_w_װwwwww'_@EP w_@EK w__@$hHw__@@Fw_w_h@___$ @@E __$ ,@__@__@@E_׀ h_w_Hw_ww_ww_w_w_w_h_@E+__h __߀h_H w_׀ h_Hw_w_w_ǰ A@?aw'`]D H ?`]@r$`HH@E&G@G (: H G@G ): HG HG 1Hc]\ G,0\@w_瀤h=@~wG@G (: HG@G ): H_b]G@G| (: $@ c@G}'H _b]G@ c@Gp'Gۀ dHwH _G,@_Hw_w_@A@>ctwcX]t  'c]\  !@Eb]c]\ t`b]c]\ t`b ]c]\ t`b(]c]\ t` b0]c]\ t`(b8]c]\ t`0b@]c]\ t`@bH]c]\ t`HbP]c]\ t`PbX]c]\ t`Xb`]c]\ t`hbh]c]\ t`pbp]c]\ t`xbx]c]\ t`b]c]\ t`b]c]\ t`b]c]\ t`b]c]\ t`b]c]\ t`b]c]\ t`b]c]\ t`b]c]\ t`b]c]\ t`b]c]\ t`b]c]\ t`b]c]\ t`b]c]\ t`b]c]\ t`b]c]\ t`8b]c]\ t``c]c]\ t`c]c]\ ta(0A@=bww_@C\cX]t  '0A@=bwb]\ h b]\ wH cX]\ w_h d@DVw_hb`]wH _cX]t` '_w_www?wwǠ w w__@_hF___@ /___@ /H__@wǠ w__נ$@wH"H__h_ wH__@wǠ wH _w_Ǡ wǠ w w__@_ o__t`?wwǠ w w__@_hF___@ /___@ /H__@wǠ w__Ϡ$@wH"H__h_ wH__@wǠ wH _w_Ǡ wǠ w w__@_ o_Ϧ _ע h_נ Hw__t`_Ϡ w_߰wwww__ߠ@0w__@_@@Du Hww__@__ߠ@$ @C h__ߠ@w_h__h_Hw_w_w__߀h__ @__Ǡ @H_Ϡ w__߀h __ @__Ǡ @O__πh>_$ w__Ϣ h__ @__Ǡ @H_Ϡ$ w__Ϣ h __ @__Ǡ @O_Ϧ _ h__Ǡ@Hw__@w__$@wH ___$@ ww__@__ߠ@$ @Bh __ߠ@w_ovH__ߢ$h__$@Hw_w_ ww__@__ߠ@$ @BXh__ߠ@w_hx_w__߀h__ @__Ǡ @H_Ϡ w__߀h __ @__Ǡ @O__πh3_$ w_π?h__ @__Ǡ @H_Ϡ$ w_π?h __ @__Ǡ @O_π?h__Ǡ@H&w__@wH ___$@ w__@__ߠ@$ @Ah __ߠ@w_ow_װwwww__ߠ@ʔwwϢ__ϧ,0t@_Ϡ w_π! ow_߀h__Ϡ$@$ _ ,0u@_Ϡ w__߀ o__@_@@B Hww__@__ߠ@$ @Ah__ߠ@w_h___ߠ@$  ,0]w_ h_h __h__$@ww__@wH{__h_Hw_w_w__ߢ$ h__ @__Ǡ @H_Ϡ w__ߢ$ h __ @__Ǡ @O_ߠ$ _πh>_$ w__Ϣ h__ @__Ǡ @H_Ϡ$ w__Ϣ h __ @__Ǡ @O_Ϧ _ h__Ǡ@Hw__@w__$@wH ___$@ ww__@__ߠ@$ @@Ӕh __ߠ@w_oQH__ߢ$h__$@Hw_w_ ww__@__ߠ@$ @@h__ߠ@w_h___ߠ@$  ,0]w_ h__@wHe_w__ߢ$ h__ @__Ǡ @H_Ϡ w__ߢ$ h __ @__Ǡ @O_ߠ$ _πh3_$ w_π?h__ @__Ǡ @H_Ϡ$ w_π?h __ @__Ǡ @O_π?h__Ǡ@H&w__@wH ___$@ w__@__ߠ@$ @@h __ߠ@w_ouw_װww_w_wנ /_L H,_L H'_L '_ߠ wG'_L '_נ wG'GG@ "H  @ /_L H_L O_L HHOwƀH_HHw__$@w_ _L @@>w_߀h_π h_H1w__Ϡ$@w___Ϣ@h Hw__Ϣ@_ߠ$@w_w_π h ____ϐ@VH w____ϐ@w_pA@8cww'''?'a]D '!"';_@>I'GG H_G$ G$@< c]@ @@H  a]$`?H'_G$ G$@< wנ'@A_/,0_'@wc]\ @>_ϡ: @c]t` ';Hc]\ w/_/l`>L >$@`]L@_,`_/l >w/_/l`>L >$@`]L@_,`_/l >w/_/l`>L >$@`]L@_,`_/l >w/_/l`>L >$@`]L@_,`_/l >w/_/l`>L >$@`]L@_,`_/l >w/_/l`>L >$@`]L@_,`HO_G ?%@@?)!'HS_@@!'HL_?@@@ Ha]D H Ga]$` He'?Hb'HFc]hc ]c(]b ]@!'@=H H'+ '+@=HG뀤 O, < #a_DGǀ H Ga]$`GH&'a]D H?H'c]\ !"a@c]t`ˠ '; O+ a]$`?'G< A@7b\wwww__@@w_πh?H'_#ch _@= Oa]$`?H'__t`_'G<  A@7atww'w_瀤h_@?DH  a]$`?Hw_h Hw_G@@?͒'Gۀ HGH wߠ Xa]$`?Hw_߰0ww?_l@_hd__L@@w_0www?_l@_hd___L@@w_߰ www_\ w_h_׀h @_l@w_׀h H'Ӡ '_GӠ@wH#*b,p @_l@_׀hdT_נ`40@w__t`___L@@9w_߰@w_@ w_0w_@=Qw_瀤h_ hd_w_0ww__@@>bw_h_ hc_w_0ww__@ dw_@w__ @<{w_0ww?_l@_ h__@@=iw_߀h_ hc_w_0ww_p__@@;w_@w_@;_@ @w_@w_ $ HHw_\ w_ w_w /_L /H _ w_L /O_w_L H_L /H /H ހH_w /_ߠ w_L O_w_0ww_@:w_瀤 h__$ L@ /HH_$ w_瀤 h __$ L@ /OH H wH_ߠ Hw_w_@'G l9 'G< 0A@5`w'G HG HGܐ'a]D 'G@;)Ga]$`G'G'G< A@4cwwwww_h wc0]w w_߀hc8]w_@<ԐH=w_瀤 h5__ߐ@ @=lw_?h?H2w_Ϡ w_?h_hG_$`Gˀ_Ϡ@?,@w_Hw_ w_w_$ w_瀤 o?H w____ߐ@@=5w_װ ww__@w__ h_Hwנ?w_w_0www__@ے_ؒw_߰ wwww__@’__w_װ0ww__ h_Hw_w_w_ A@4`|wעc@]cH] @;@:[w_L H_L H' .'G/OСA@3c̮wwwww_@@ HHw_ߠ@@- H_@9y_h_@9r a]$`Hw__ϐ @ iw_/h _  ?#wwH_?h_HwO?wO_OwW_W?hH_W@:iw_hH_w_h _wo_\ wgHwowgw__ww_ ww__w\ h_w\ _$@wW___W@wO_O_gh`_g h_g#|,p h_g,0Hw/?w/_/Hw7 w7_7wg_O_gh_Owg_g?h_gHw'?w'_'wG_G?hH_o_h_oh_G@9w?H_o_G@@;!w?_?hH_o_h __ h _?_o__@@9_?wo_o__@__W@@8_Ow_H_L ,08408< _o__,@_ w__ w__W$ wW_W o__hH_wL H %Hz_w\ P?h@8__ FwW_W_gh`_g h_g#|,p h_g,0Hw7?w7_7Hw? w?_?wg_W_gh_Wwg_g?h_gHw/?w/_/wO_O?hHt_o_h_oh_O@9[wGH_o_O@@:wG_GhHY_o_h __ h _G_o__@@8d_Gwo %_o__,@_Ww_Hj_w\ P?h@8;_wL H nHPH8____w\ P,0@\ ,`HB____w\ P,0@\ 4`H8____w\ P,0@\ $`H.____w\ P,0@\ t`H$____w\ P,0@\ t`H@8H__w\ P,0D@$  O, < #c_DH_wL H sH __w\ P,0D@ H_wD '[ 'WwO_w\`\` hV_w\ (?h$__w\ (,0D@ H@7__w\ (,0@D ';G; H G[ '[G; 4 wOHG;wOH-_w\ w7_7L $ 0< w/_7 w7_/w'_Off~f#}(p @h_O,p,pHw?w__'@wO_7_w\ o 'W 'K w?_w\`0\`8hW_w\ @?h__w\ @,0D@ H@7b__w\ @,0@D ';G; HG;w? 'KH7_w\ 0 w7w?_7_w\ 8h*_7L $ 0< w/_7 w7_/w'_?ff~f#}(p @h_?,p,pHw?w__'@w?_7_w\ 8o 'K__w\ P,0@\ w7GKH_  @7{_7w/w'_? hP_/D HHI_/D @'G H&_o_h _oh_o@6_h_@6_@6_h_@6 Xa]$`Hw_?GhH_/ w/_'G@w'_?G$@w?_? oHYGWHN  @7_7w/w'_/D HH<_/D @^'G H&_o_h _oh_o@6O_h_@6H_@6E_h_@6> Xa]$`Hw_/ w/_'G@w'OH _7@9)@*0@w/w'GWH_'wHwGWH_O_h_wD  H_O_$@w___@Ԓ_ghh_g h_g#|,p h_g,0Hw?w_Hw w_wg___@_gh___@wg_g?h_gHw?w_w_?hH_o_h_oh_@6wH_o_@@8 w_hH_o_h __ h __o__@@5_wo_o__@_@ @6:___@w_GKHGWH  @6(___'@K_ghh_g h_g#|,p h_g,0Hwנ?w_Hwߠ w_wg___'@)_gh___'@ wg_g?h_gHwϠ?w_w_?hHs_o_h_oh_@6ZwH_o_@@7w_瀤hHX_o_h __ h __o__@@5c_wo_'w_ h0_7D H@5<_7D @'G H@5-_o__@G@@5<__G@w__7 w7_G$@w_ o_7_/h@5H  @5v_7_/h_7D H@4_7D @'G H@4__G@~_ghh_g h_g#|,p h_g,0Hw?w_Hw w_wg__G@\_gh__G@Swg_g?h_gHw?w_w_?hH_o_h_oh_@5wH_o_@@6w_hH_o_h __ h __o__@@4_wo_o__@G@@4__G@w__7 w7_7_/ ohGWH_O_h_wD  H_O_$@w___@_ghh_g h_g#|,p h_g,0Hw?w_Hw w_wg___@ƒ_gh___@wg_g?h_gHw?w_w_?hH_o_h_oh_@4wH_o_@@6w_hH_o_h __ h __o__@@4_wo_o__@_@ @4N___@w_H_wL H aH_wL H AH__w\ P,0D@'[_wD 'W 'SwG_w\`\` hV_w\ (?h$__w\ (,0D@ H@3__w\ (,0@D 'SGS H GW 'WGS 4 wGHGSwGH-_w\ wO_OL $ 0< wG_O wO_Gw?_Gff~f#}(p @h_G,p,pHw7?w7_7_?@ wG_O_w\ o 'S 'Cw7_w\`0\`8hW_w\ @?h__w\ @,0D@ H@3P__w\ @,0@D 'SGS HGSw7 'CH7_w\ 0 wOw7_O_w\ 8h*_OL $ 0< wG_O wO_Gw?_7ff~f#}(p @h_7,p,pHw7?w7_7_?@w7_O_w\ 8o 'CG[ HcX] c`] H@5ˁH 4w/Hch] c`] H@5H 4w/_/_7h_7w/_/ tw/_/_Gh_Gw/_/ gw/_/"hswgH_/?h_/HwG?wG_GwO_O?hH_O@3wg_ghHw__gwWG[ H9__w\ P,0@   ???GG?GCGGGK%?' ,@,@%@ `? H/_wL H AH N_W,`_W wW A_W,`_W wW N_W,`_W wWH n_W,`_W wW a_W,`_W wW n_W,`_W wWH ';G?4 H?';?G??ߠ@5???GG; H  -_W,`_W wWHGW H  +_W,`_W wWH GW H _W,`_W wW?Gcp]  ????Ϡא@4 HN?G?Gǐ????ג@4?G????ǐ@4 H/_wL H AH I_W,`_W wW N_W,`_W wW F_W,`_W wWH i_W,`_W wW n_W,`_W wW f_W,`_W wWHU?Gcp]  ????Ϡא@4 H?G7HJ@X@B??'H  '7cp]  ??'GCH_7cX] c`] H@4YH 4h'??_7wא??@4n'??Gǐ@4l@Ϡ????Ϡג@4e??_ hUG Hcx]  ????Ϡא@4Q HH-cx]  ????Ϡא@4  Hc]  ????Ϡ@4??H??ߠ@3??Hc]  ????Ϡג@4??_$ wOkcp]  ????Ϡא@3 H%_7w_ hǨעc]  @????ϒ@3Ԕ??_$ w_ o'ǐ????ג@3??' 0_W,`_W wW_wL H _W,`_W wW_Ww_'א??@3~''??Gǐ@3|@Ϡ????Ϡג@3u??'G 0_W,`_W wWGW H'cp]  ????Ϡא@3- H_7 hH_W, _W wW'cp]  ????Ϡא@3 Hj'c]  ????Ϡג@32??''א??@3''??Gǐ@3@Ϡ????Ϡג@2??'G H 0H'_wL H$ 'GG@_W,`_W wW_7 h_7$ w7'cp]  ????Ϡא@2 O_7 h 0_W,`_W wW_7$ w7_7 o_wL H _W,`_W wW_WcP]G7@@0r_WL H _W wW_WL OH&cP]G7@@0ZwL /O_W,`O H_W wW_ w_L / O _W,`O OH __w\ P,0@ ?OGOGS%?' ,@,@%@ `? H/_wL H AH N_W,`_W wW A_W,`_W wW N_W,`_W wWH n_W,`_W wW a_W,`_W wW n_W,`_W wWH 'KGO4 H?'KO?OGK H  -_W,`_W wWHGW H  +_W,`_W wWH GW H _W,`_W wWOc] H4OHHH/_wL H AH I_W,`_W wW N_W,`_W wW F_W,`_W wWH i_W,`_W wW n_W,`_W wW f_W,`_W wWH_Oc] H OGH@8??H  'Gc] ??GCHw_7ch] c`] H@1jH 4hf??7_7w/7H'G'+7G+'?7_/ h&G+ H 7c] H H7c] H cH] 7?7H7?7H7ch] H?7_/$ w/O7c] HH_7w/_/ h7c] H?7_/$ w/_/ o?7H?? 0_W,`_W wW_wL H _W,`_W wW_Ww_?H'G';?G;'??G; 0_W,`_W wWGW H?c] H_7 hW_W, _W wW?c] H7?ch] H???H'G';?G;'??G; H 0H'7_wL H$ '7G;G7@_W,`_W wW_7 h_7$ w7?c] O_7 h 0_W,`_W wW_7$ w7_7 o_wL H _W,`_W wW_WcP]GG@@.g_WL H _W wW_WL OH&8cP]GG@@.O8w/L /.O._W,`O. H_W wW_/ w/_/L /-O-_W,`O- OGSH_W_g$@_Gh}_G_W_g$@$wO_W_O@wGGW H_O h _W,`_W wW_O$ wO_O oHZGW H/__h+_Gw?_W__h_?$ w?_W$ wW_WL _?,`_W__o_O h 0_W,`_W wW_O$ wO_O oH)_Gw?_W_gh_?$ w?_W$ wW_WL _?,`_W_go_O h _W,`_W wW_O$ wO_O o_GwW_W_g$@wO_O_/ h@,_O_g__$@ hk___O@_wG_G_gh`_g h_g#|,p h_g,0Hw'?w'_'Hw/ w/_/wg_G_gh_Gwg_g?h_gHw?w_w?_??hH _o_h_oh_?@-tw7H_o_?@@.w7_7hH r_o_h __ h _7_o__@@,}_7wo_o__@_g_O@@,r_gsh_g@,___O@w_H t__w\ P,0D@'[_wD 'W 'SwG_w\`\` hV_w\ (?h$__w\ (,0D@ H@,+__w\ (,0@D ''G' H GW 'WG' 4 wGHG'wGH-_w\ w_L $ 0< w_ w_w_Gff~f#}(p @h_G,p,pHw?w__@wG__w\ o 'SH  'CH9 'CH5_wL H`aH`EH`AOO%`E O, < #c_D`eH`aOO%`e O, < #c_D_w7 %_7,`_7 w7GW H '_7,`_7 w7GW H -_7,`_7 w7GW H +_7,`_7 w7GW H _7,`_7 w7GW H #_7,`_7 w7GCH<GW H 0_7,`_7 w7_w\`\` h,_w\` \`$w_7_w\ _@@+f_7_@w7H_w\ w_L ,08408< _7,`_ w_7 w7_$ w_ o_w\`0\`8h,_w\`8\`0$w_7_w\ 0_@@+6_7_@w7H_w\ 0w_L ,08408< _7,`_ w_7 w7_$ w_ oH l_7,`_7 w7 l_7,`_7 w7H L_7,`_7 w7HHG[$  O, < #`$_ؠD_wL H_7,` %_7,` n_7,` _7,` '3GCH_w\ (?h__w\ (,0D@ H@*__w\ (,0@D +3,0$@3 '3_w\ @?h__w\ @,0D@ H@*__w\ @,0@D +3,0$@3 '3__ _ghh_g h_g#|,p h_g,0Hw?w_Hw w_wg__ _gh__ wg_g?h_gHw?w_w_?hH G_o_h_oh_@+.wH_o_@@,Vw_hH ,_o_h __ h __o__@@*7_wo _o__,@?'' '#_g__$@w_#ch!#w_wHw__w\ P,0@L 'H9_o__@__G'@@,H9'#_o__@__G+G'@@@,uH('#_o__@__G+G/G'@@@,bsH'#@)H3 O, 4#`0_DH6__w\ P,0@ 'H9_o__@__'@@,5H9'#_o__@__G+'@@@,$H('#_o__@__G+G/'@@@,sH'#@)uH3 O, 4#`<_DH__w\ P,0@T 'H9_o__@__G'@@+H9'#_o__@__G+G'@@@+ӚH('#_o__@__G+G/G'@@@+sH'#@)$H3 O, 4#`H_DH__w\ P,0@ 'H9_o__@__'@@+H9'#_o__@__G+'@@@+H('#_o__@__G+G/'@@@+osH'#@(H3 O, 4#`T_DHC__w\ P,0@D 'H9_o__@__G'@@+BH9'#_o__@__G+G'@@@+1H('#_o__@__G+G/G'@@@+sH'#@(H3 O, 4#``_DH__w\ P,0@ 'H9_o__@__'@@*H9'#_o__@__G+'@@@*H('#_o__@__G+G/'@@@*sH'#@(1H3 O, 4#`l_DH__w\ P,0@\ wH9_o__@___'@@@*H9'#_o__@__G+_'@@@*H('#_o__@__G+G/_'@@@*|sH'#@'H3 O, 4#`x_DHP__w\ P,0@\ wH9_o__@___'@@@*OH9'#_o__@__G+_'@@@*>H('#_o__@__G+G/_'@@@*+sH'#@'H3 O, 4#`_DH__w\ P,0@\ wH9_o__@___'@@@)H9'#_o__@__G+_'@@@)H('#_o__@__G+G/_'@@@)sH'#@'>H3 O, 4#`_DH__w\ P,0@\ wH9_o__@___'@@@)H9'#_o__@__G+_'@@@)H('#_o__@__G+G/_'@@@)sH'#@&H3 O, 4#`_DH]__w\ P,0@ ?H<_o__@__'@;[@)[H;'#_o__@__G+'@;[@)IH)'#_o__@__G+G/'@@;[@)5sH'#@&H3 O, 4#`_DH __w\ P,0@   ??HC_o__@__'@;;[[@)sH?'#_o__@__G+'@;;[[@(sH*'#_o__@__G+G/'@@;;@(sH'#@&;H3 O, 4#`_DH__w\ P,0@D 'H9_o__@__G'@@(H9'#_o__@__G+G'@@@(H('#_o__@__G+G/G'@@@(sH'#@%H3 O, 4#`_DHZ__w\ P,0@D 'H9_o__@__G'@@(YH9'#_o__@__G+G'@@@(HH('#_o__@__G+G/G'@@@(5sH'#@%H3 O, 4#`_DH __w\ P,0@\ wH9_o__@___'@@@(H9'#_o__@__G+_'@@@'H('#_o__@__G+G/_'@@@'sH'#@%HH3 O, 4#`_DH__w\ P,0@\ wH9_o__@___'@@@'H9'#_o__@__G+_'@@@'H('#_o__@__G+G/_'@@@'sH'#@$H3 O, 4#`_DHg__w\ P,0@\ wH9_o__@___'@@@'fH9'#_o__@__G+_'@@@'UH('#_o__@__G+G/_'@@@'BsH'#@$H3 O, 4#`_DH@$HG[$  O, < #a4_DG' HG'_h _o__@G'L@ H@$lG#G'HG#''H_7L  H _7,`OBG# H{_g#|,p h_g,0Hw?w_ w__gh`_g h_g#|,p h_g,0Hw?w_Hw w_wg__gh_wg_g?h_gHwߠ?w_w_?hH_o_h_oh_@$wH_o_@@&w_hH_o_h __ h __o__@@#_woOG#''G' H&_o_h _oh_o@#_h_@#_@#_h_@# a]$`HwG'4  4_ h_#chH{_g#|,p h_g,0Hw?w__G'4  4@$_sw__gh`_g h_g#|,p h_g,0Hw?w_Hw w_wg__gh_wg_g?h_gHwߠ?w_w_?hHO_o_h_oh_@$6wH_o_@@%^w_hH4_o_h __ h __o__@@#?_woO GCHAGSH=G'w__Gh6_G_$@wG'_@裒_g__$@h_g#|,p h_g,0Hw?w__G'_@覔_גw__G'@w___gh`_g h_g#|,p h_g,0Hwנ?w_Hwߠ w_wg__gh_wg_g?h_gHwϠ?w_w_?hH_o_h_oh_@#wH_o_@@$w_瀤hH_o_h __ h __o__@@"_wo__G'$@w__o__@w_G'@w__@w_L $ -_@?,@` w_w_L AH_L ZH _L aH_L zHwG'_@''GW H_ h _,`_ w_$ w_ oHZGW H/_瀤h+_w__瀤h_ߠ$ w_$ w_L _,`__瀤o_ h 0_,`_ w_$ w_ oH)_w__h_ߠ$ w_$ w_L _,`__o_ h _,`_ w_$ w_ o__G'@w_H_w\ w_wO_ w_wwW_w XwwOq__ ^_ghh_g h_g#|,p h_g,0Hw??w?_?HwG wG_Gwg__ <_gh__ 3wg_g?h_gHw7?w7_7wW_W?hH_o_h_oh_W@"mwOH_o_W@@#wO_OhHk_o_h __ h _O_o__@@!v_Owo _o__,@_o_h__ _gh_o__ @@#gwW_Wh_Wwo_h_@!_@ _h_@ ___t`_oHJw_o_h _oh_o@ _h_@ ސ_@ ې_h_@ Ԑ Oa]$`H&w_o_h _oh_o@ _h_@ _@ _h_@  a]$`Hw_װt777777;`;`;H;H;;;;`;;`?X??@@AABB`C$C`CDhDDEEF,FG,GpH4HpHIxIIJJK<LL@LM\MMNOOHP PHPQPQQRRSSTTX?4@xACDDEFHITJKM,NOQ,RpS0?wだH@#?H?G$ 'G〤<H G#H@#?<'G_$`?灠H㶀A@a̮w??w 'c]  ?w??g?owg@#G H| 'c]  ??c]  ???w??W?_wW@#' HGˢ G,@'g?w??W?_wW@#go??HH=G,0@< < G,0@< < G 'g?w??W?_wW@"go??g?w??W?_wW@"ڔgo??OH 'c]  ??c]  ??Gˢ G,@$#|HHkGˢ G,@$'g?w??W?_wW@"go??c]  ?w??g?owg@" HH=G,0@< < G,0@< < G 'g?w??W?_wW@"fgo??g?w??W?_wW@"Sgo??Oc]  ?w??g?owg@"] HIG HEG$ 'Gˢ G,@$#|H4Gˢ G,@$'G,0@  G?w??7??w7@"GO??c]  ?w??g?owg@! HHG OG H:G$ 'G,0@  ?w??7??w7@!Ӓ HGˢ G,@'G,0@  G?w??7??w7@!GO??G OG_$`??ׁHJA@bwwww_\ w__\ h;H_ w_w_D?_,`H _ w_w_D?_,`H_ w_w_D?_4`H _ w_w_D?_4`H_ w_w_D?_$`H_ w_w_?_$`H_ (p  @_t`_ wH_ (p  @_t`_ wH_ (p  @_t`_ wH_ (p  @_t`_ wH_  _< _ wH_  ? w_$   _נ < < H_ w_w_D?_$`H_ w_w_D?_$`H_ (p  @_t`_ w_\ hc]_t`Ht_ (p  @_t`_ w_\ hc]_t`H^_ (p  @_t`_ wHR_ (p  @_t`_ wHF_ (p  @_t`_ wH:_ (p  @_t`_ wH._ (p  @_t`_ wH"_ (p  @_t`_ wH?H#'_D $  O, < #a_D_ߠ w_w_נ w__\  o 'G< Lx(T<x(@p ww__@w__ h_Hwנ?w_w_0www__@ے_ؒw_߰ wwww__@’__w_װ0ww__ h_Hw_w_w_㾠A@cLwWwww_wwww_t  w_ǥ,p,p,p@_t _\ hHz_t w_t _L H1_L /_נ wO %H"?w_\`\`,p,p,pw_נ$ _t`_$ _t _t ?_t`(_t 0_t 8?_t`@?_t`P_L 0Hl_L 9Hg_w_L 0H_L 9H_ w_L 0H_L 9O_L $HIw_w_L 0H/_L 9H*_ff~f#}(p @h_,p,pHw?w__L $ 0< @w_ w_L 0H_L 9O_ hH_?hH_$ w_ w_L 'H _ D` $`_נ wHO_L -H _ D` $`_נ wH@_L +H _ D` $`_נ wH1_L H _ D` $`_נ wH"_L #H _ D` $`_נ wH_L 0H _ D` $`_נ wHHO_L *H__t`_נ w__t` _ h w_L 0Hm_L 9Hh_w_L 0H_L 9H_ w_L 0H_L 9O_L $HJw_w_L 0H/_L 9H*_ff~f#}(p @h_,p,pHw?w__L $ 0< @ w_ w_L 0H_L 9O_ hH_?hH_$ _t`(_ w_\ (?h__t`(_Ϡ w_\ (?hH_\ (w__ hO_#|,p h_,0Hww?ww_ww__h_ w_#|,p h_,0Hwo?wo_ow_?hH_\ h _\ _@@ђHwg_@wg_gw_hH|__t`_\ _h_w_\ w_ _t`_\ _,0$@_\ _o_\ _,0D@ H  _\ _,0$@H _\ _,0D@ HH+H5_L 0H0_L 9H+__t`_L 0H_L 9H_נ w_L 0H_L 9O__t` _\` \`$w__h_w_L .HQ_נ w_L *H_נ$ _t`0_נ w__t`8_ h w_L 0Hm_L 9Hh_w_L 0H_L 9H_ w_L 0H_L 9O_L $HJw_w_L 0H/_L 9H*_ff~f#}(p @h_,p,pHw?w__L $ 0< @w_ w_L 0H_L 9O_ hHv_?hHp_$ _t`@_ w_\ @?h__t`@_Ϡ w_\ @?hHW_\ @w__ hO_#|,p h_,0Hww?ww_ww__h_ Zw_#|,p h_,0Hwo?wo_ow_?hH8_\ h _\ _@@tHwg_@?wg_gw_hH__t`_\ _h_w_\ w_ _t`_\ _,0$@_\ _o_\ _,0D@ H  _\ _,0$@H _\ _,0D@ HHH,_נ$ _t`0_L 0H_L 9H_נ w_L 0H_L 9O__t`8_\`8\`0$w__h_w '_L hH G  `,@'_נ wH__L LH G '_נ wHR_L lH G '_נ wHE_L jHHG 'HG '_נ wH1_L zH_L ZHHG 'HG '_נ wH_L tHHG 'HG '_נ wHHO_L /_נ wHG HG H 'HG H 'HG H 'H G H 'H 'HG HG H 'HG H 'HG H 'H G H 'H 'HG HG H 'H 'HG H 'H 'H ' c/HG H 'H 'H ' s/H 'HG HG H 'HG H 'HG H 'H G H 'H 'Hr 'HnHsO`cH5`EH`AH`%OOO`COO`SH%`E O, < #b_WD`XH`SOOOB`aOgO`nH%`c O, < #b_WD`sH%`n O, < #b_WD`uH`sO]OO`xO OG H__t`P_\ P?h__t`P_Ϡ w_\ P?hH_\ Pw__ hO_#|,p h_,0Hwo?wo_ow__h_ w_#|,p h_,0Hwg?wg_gw_?hH_\ h _\ _@@ Hw__@ؐw___ww_whH_w_t`_\ _h_w_\ ww_w _t`_\ _w,0$@_\ _o_\ _,0D@ H G_\ _,0$@H _\ _,0D@GHHfO_,`H__t`_\` t`_\ _ǀ h>_#|,p h_ǡ,0Hw?w_w_.}#E|(p @h _ǥ,p,p,pHww?ww_ww_?hHD_\ _@@w_hH7__t`_L O__\`\`,p,p,pu__t`__t` H5'_\ h_\ @_\ h_\ @ a]$`?H'_\ h_\ @_\ h_\ @ߐ a]$`?'G< \\\\\\<,PP0123456789abcdefghijklmnopqrstuvwxyzm4_syscmdm4_esyscmdm4_translit%'+- 0#*.*hhdnext_tokenm4_tmpnamemake_diversioninsert_diversion_helper %)/;CSa%[QUQ K'#*35=oIX{j+am'#=|Yq#=oRck 3 ?7s]w i'/wU8DYRblveCU%`6ڍalO)m7qI#] B̓P(q`0yUaw v X:a56?5:@QGy%׏-i̥;6~,kAd5_Nx |@^)pQHl$A^oNT +csQgDR!cEGvߴ?MGO{+`.6r89tG-CwViPVPgP/a'3Xtq !hA(EocotpZ%! xCopyright %s %d Free Software Foundation, Inc.,Hex D_SuccessNo matchInvalid regular expressionInvalid collation characterInvalid character class nameTrailing backslashInvalid back referenceUnmatched [ or [^Unmatched ( or \(Unmatched \{Invalid content of \{\}Invalid range endMemory exhaustedInvalid preceding regular expressionPremature end of regular expressionRegular expression too bigUnmatched ) or \)link_nfa_nodesparse_bracket_expre_search_stubre_copy_regscheck_matchingpop_fail_stackabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789gen_tempname?@A?ꗍO;d@0??@????@?(NULL): Try `%s --help' for more information. Usage: %s [OPTION]... [FILE]... Process macros in FILEs. If no FILE or if FILE is `-', standard input is read. Mandatory or optional arguments to long options are mandatory or optional for short options too. Operation modes: --help display this help and exit --version output version information and exit -E, --fatal-warnings once: warnings become errors, twice: stop execution at first error -i, --interactive unbuffer output, ignore interrupts -P, --prefix-builtins force a `m4_' prefix to all builtins -Q, --quiet, --silent suppress some warnings for builtins --warn-macro-sequence[=REGEXP] warn if macro definition matches REGEXP, default %s \$\({[^}]*}\|[0-9][0-9]+\) Preprocessor features: -D, --define=NAME[=VALUE] define NAME as having VALUE, or empty -I, --include=DIRECTORY append DIRECTORY to include path -s, --synclines generate `#line NUM "FILE"' lines -U, --undefine=NAME undefine NAME Limits control: -g, --gnu override -G to re-enable GNU extensions -G, --traditional suppress all GNU extensions -H, --hashsize=PRIME set symbol lookup hash table size [509] -L, --nesting-limit=NUMBER change nesting limit, 0 for unlimited [%d] Frozen state files: -F, --freeze-state=FILE produce a frozen state on FILE at end -R, --reload-state=FILE reload a frozen state from FILE at start Debugging: -d, --debug[=FLAGS] set debug level (no FLAGS implies `aeq') --debugfile[=FILE] redirect debug and trace output to FILE (default stderr, discard if empty string) -l, --arglength=NUM restrict macro tracing size -t, --trace=NAME trace NAME when it is defined FLAGS is any of: a show actual arguments c show before collect, after collect and after call e show expansion f say current input file name i show changes in input files l say current input line number p show results of path searches q quote values as necessary, with a or e flag t trace for all macro calls, not only traceon'ed x add a unique macro call id, useful with c flag V shorthand for all of the above flags If defined, the environment variable `M4PATH' is a colon-separated list of directories included after any specified by `-I'. Exit status is 0 for success, 1 for failure, 63 for frozen file version mismatch, or whatever value was passed to the m4exit macro. -stdincannot open `%s'internal error detected; please report this bug to <%s>bug-m4@gnu.org-B:D:EF:GH:I:L:N:PQR:S:T:U:d::egil:o:st:warning: `m4 -%c' may be removed in a future releasewarning: `m4 %s' is deprecated-N--diversionsbad debug flags: `%s'warning: `m4 -e' is deprecated, use `-i' insteadm4GNU M41.4.14Rene' Seindalcannot set debug file `%s'stderrINTERNAL ERROR: bad code in deferred argumentsarglengthdebugdefineerror-outputfatal-warningsfreeze-stategnuhashsizeincludeinteractivenesting-limitprefix-builtinsquietreload-statesilentsynclinestracetraditionalundefineword-regexpdebugfilediversionswarn-macro-sequencehelpversion\$\({[^}]*}\|[0-9][0-9]+\)--warn-macro-sequence: bad regular expression `%s': %sWarning: definition of `%s' contains sequence `%s'error checking --warn-macro-sequence for macro `%s'm4_Warning: too few arguments to builtin `%s'Warning: excess arguments to builtin `%s' ignoredempty string treated as 0 in builtin `%s'non-numeric argument to builtin `%s'leading whitespace ignored in builtin `%s'numeric overflow detected in builtin `%s'Warning: %s: invalid macro name ignoredINTERNAL ERROR: bad token data type in define_macro ()undefined macro `%s'%s: %s%s%s %s INTERNAL ERROR: builtin not found in builtin table<%s> INTERNAL ERROR: bad token data type in m4_dumpdef ()undefined builtin `%s'builtin `%s' requested by frozen file is not supportedWarning: cannot concatenate builtin `%s'INTERNAL ERROR: bad symbol type in m4_defn ()/usr/xpg4/bin/shstatus == 127builtin.ccannot run command `%s'rcannot read piperadix %d in builtin `%s' out of rangenegative width to builtin `%s'error undiverting `%s'cannot undivert `%s',cannot open `%s'XXXXXX%s: cannot create tempfile `%s'recommend using mkstemp instead %sexit status out of range: `%d'Debugmode: bad debug flags: `%s'INTERNAL ERROR: bad flag in m4_debugmode ()cannot set debug file `%s'to && *tofrom && *fromWarning: \0 will disappear, use \& instead in replacementsWarning: sub-expression %d not presentWarning: trailing \ ignored in replacementbad regular expression: `%s': %serror matching regular expression `%s'bad regular expression `%s': %s__file____line____program__builtinchangecomchangequotedebugmodedebugfiledecrdefinedefndivertdivnumdnldumpdeferrprintesyscmdevalformatifdefifelseincludeincrindexindirlenm4exitm4wrapmaketempmkstemppatsubstpopdefpushdefregexpshiftsincludesubstrsyscmdsysvaltraceofftraceontranslitundefineundivertplaceholderunix__unix____gnu__sh-cerror writing to debug streamaWarning: cannot protect debug file across forksm4debug:%s:%d:...m4trace: -%d- id %d: %s %s ...%s(, %l%S%rINTERNAL ERROR: builtin not found in builtin table! (trace_pre ())<%s>INTERNAL ERROR: bad token data type (trace_pre ())) -> ???%s%s(...) -> %l%S%rbad expression in eval (missing right parenthesis): %sbad expression in eval: %sbad expression in eval (bad input): %sbad expression in eval (excess input): %sinvalid operator in eval: %sdivide by zero in eval: %smodulo by zero in eval: %snegative exponent in eval: %sINTERNAL ERROR: bad error code in evaluate ()Warning: recommend ==, not =, for equality operatorINTERNAL ERROR: bad comparison operator in cmp_term ()INTERNAL ERROR: bad shift operator in shift_term ()INTERNAL ERROR: bad operator in mult_term ()empty string treated as 0non-numeric argument %sleading whitespace ignorednumeric overflow detectedWarning: unrecognized specifier in `%s'wcannot open `%s'# This is a frozen state file generated by %s GNU M4 1.4.14V1 `'Q%d,%d # C%d,%d T%d,%d INTERNAL ERROR: builtin not found in builtin table!F%d,%d INTERNAL ERROR: bad token data type in freeze_one_symbol ()# End of frozen state file unable to create frozen stateexpecting line feed in frozen fileexpecting character `%c' in frozen filecannot open %sinteger overflow in frozen filefrozen file version %d greater than max supported of 1ill-formed frozen file, version directive expectedill-formed frozen filepremature end of frozen fileunable to read frozen stateinput read from %sINTERNAL ERROR: recursive push_string!input reverted to %s, line %dinput exhaustedread errorerror reading fileINTERNAL ERROR: input stack botch in pop_input ()INTERNAL ERROR: bad call to init_macro_token ()INTERNAL ERROR: input stack botch in peek_input ()INTERNAL ERROR: input stack botch in next_char ()Warning: end of file treated as newline`'# ERROR: end of file in comment!quote_levelinput.cERROR: end of file in stringINTERNAL ERROR: bad token type in expand_token ()ERROR: end of file in argument listINTERNAL ERROR: bad token type in expand_argument ()INTERNAL ERROR: bad symbol type in call_macro ()recursion limit of %d exceeded, use -L to change itcannot clean temporary file for diversion%s/m4-%d0 < divnumoutput.c%dm4-cannot create temporary file for diversionw+Warning: cannot protect diversion across forkscannot seek within diversionr+cannot protect diversion across forkscannot close temporary file for diversionERROR: cannot flush diversion to temporary fileERROR: copying inserted file!output_diversion->usedfalseerror reading inserted file!output_diversion->used && output_diversion != &div0 && !output_fileD%d,%d cannot stat diversiondiversion too largeD%d,%lu D%d,0 M4PATH.rWarning: cannot protect input file across forkspath search for `%s' found `%s'INTERNAL ERROR: invalid mode to symbol_lookup (): program errorstack overflowcannot find a temporary directory, try setting $TMPDIRcannot create a temporary directory using template "%s"cannot remove temporary file %scannot remove temporary directory %s/dev/null%s subprocess failedcannot create pipe/dev/null%s subprocess failedA NULL argv[0] was passed through an exec system call. /.libs/lt-fileTMPDIR/var/tmp//tmp%.*s/%.*sXXXXXX%sunable to display error message%s (%s) %s %s %s (C) License GPLv3+: GNU GPL version 3 or later . This is free software: you are free to change and redistribute it. There is NO WARRANTY, to the extent permitted by law. Written by %s. Written by %s and %s. Written by %s, %s, and %s. Written by %s, %s, %s, and %s. Written by %s, %s, %s, %s, and %s. Written by %s, %s, %s, %s, %s, and %s. Written by %s, %s, %s, %s, %s, %s, and %s. Written by %s, %s, %s, %s, %s, %s, %s, and %s. Written by %s, %s, %s, %s, %s, %s, %s, %s, and %s. Written by %s, %s, %s, %s, %s, %s, %s, %s, %s, and others. Report bugs to: %s bug-m4@gnu.org%s home page: <%s> GNU M4http://www.gnu.org/software/m4/General help using GNU software: %s subprocess%s subprocess got fatal signal %d%s subprocess failed%smemory exhaustedcannot perform formatted outputerror closing file%s: %s%swrite error%s: %s%sUnknown system error: %s%s: %s:%s:%d: POSIXLY_CORRECT--%s: option '%s' is ambiguous %s: option '--%s' doesn't allow an argument %s: option '%c%s' doesn't allow an argument %s: option '%s' requires an argument %s: unrecognized option '--%s' %s: unrecognized option '%c%s' %s: invalid option -- '%c' %s: option requires an argument -- '%c' %s: option '-W %s' is ambiguous %s: option '-W %s' doesn't allow an argument %s memory exhausted"`'literalshellshell-alwayscc-maybeescapelocaleclocaleUTF-8UTF8node->next == NULLregcomp.cREG_VALID_INDEX (left)REG_VALID_INDEX (right)!IS_EPSILON_NODE (node->token.type)alnum_space0upperloweralphacntrldigitprintblankgraphpunctxdigitpmatch[0].rm_so == startregexec.cregs_allocated == REGS_FIXEDregs->num_regs >= nregserr == REG_ESPACEREG_VALID_INDEX (num)Real-time signal %dUnknown signal %dHangupInterruptQuitIllegal instructionTrace/breakpoint trapAbortedFloating point exceptionKilledBus errorSegmentation faultBroken pipeAlarm clockTerminatedUrgent I/O conditionStopped (signal)StoppedContinuedChild exitedStopped (tty input)Stopped (tty output)I/O possibleCPU time limit exceededFile size limit exceededVirtual timer expiredProfiling timer expiredWindow changedUser defined signal 1User defined signal 2EMT trapBad system callPower failureResource lostXXXXXXinvalid KIND in __gen_tempname! "invalid KIND in __gen_tempname"tempname.c%#.0f%+d(NULL)oPH0P`h@px Xx(0H Hx8@HPX`hpxp(08PX`hpx p(0HXh (08@HPX`hpx8@HPX`hpx@HPpx@h Ppx (080Px(X0Ph0@HPX`hpx @h0Hh X(08@HPXxHP./@/ (0`hHh(8@HPXи(Hp0hpx0XXpl8PXpooD(0P @pHP PXp (08@HPp\ 08Php˜¨ (8H`xÈà0@P`pxĘq 08@HXhx0oxq`M\` r =0 t<q8r0oh@0<]8opX]Pr,q8r xD`xqpPPf`qohr"r(fPq1(@q qx(x>ohdqqpHhePqHqXnhp=]0Pq=P=L= (8`L0o0o0o0o0o 0o@0o`0o0o0o0o0o0o 0o@0ow`0oo0og0o_0oW0oO0oG 0o?@0o7`0o/0o'0o0o0o0o 0o@0o`0o0o0o0o0o0o 0o@0o`0o0o0o0o0o0o 0o@0ow`0oo0og0o_0oW0oO0oG 0o?@0o7`0o/0o'0o0o0o0o 0o@0o`0o0o0o0o0o 0o 0o @0o `0o 0o 0o 0o 0o 0o 0o @0ow `0oo 0og 0o_ 0oW 0oO 0oG 0o? @0o7 `0o/ 0o' 0o 0o 0o 0o 0o @0o `0o 0o 0o 0o 0o 0o 0o @0o `0o 0o 0o 0o 0o0o 0o@0ow`0oo0og0o_0oW0oO0oG 0o?@0o7`0o/C p x= g o",o] o @]]P oo`@H@H eP nh ?ݰpp`lpdxDoEFgHIiLPQRQ s0t8GHUXWhx(`8HXp`ppѠX `8 p    x      @(0 h80@ H X `p x`P  0  X`  ̨P(08xX`xhX8` %'(H)*-0./01X145568x9p;x<` (08@Xx=] ]P]] i@ p     +r8+ (20ES_ n| 8_ | @_  jX k`d k m( m@$ m m   o  ( ( X P" H( 0 . P4 `: h(@ F L @`R X p^ d qhj xp v | tX   8  0  8 X  x   8       ( 0/|p_  X d x ( $ `    px+ p8 ѠG XT Ta i 80s {   p\  , H     xx    , 0  @X | h  0 0 ) 44 T@ J 0U Px_ h 00t ~  XL ` h    ̨ @   8  8 H8  0  8 H 0   (& H0, x02 @> J hT (Z ` f l r x ~ 8  8 @ H P X ` h p x p4 H     8   8 ( 0" 8) P0 X7 `> hE pL x8S Z 0a h 0o  vp } ( 0 H X h         (       ( 0  8 @ H P% X, `3 h: pA xH O V ] d k r  @y    x4    8 @ H P X ` h p x     @      % , 3 (: A 0H HO P V p] xd k r y             @ @( h0  ( (        %|_  #xX #d $h %( %$- , P  p< x0 B H N T Z ` f 2s y   9<  :     ( 0 8H  8       |p_  CX Cd D E(( Eh$ EH  F@  F`  8 & 0 , P( 2 x0 8  >  D  J  P (0 V X( f Y x [4 w \4 n ^84  _  X8  a  8  d 8  g0  h  -  l  n(  o@ | _  q(X qd r s8( sx$  0  P  h    s  u  w '  0   6 ( <  B| _  X xd  ( X$ K l _  e   0 k 0 q @ w H } P  X  `  h  p  x  8  ^ @      @(  h(  |      8 8  0  H  h |_  X 8d  ( $    (        N  8  4 ) X0 / Ր @ 8 F H Q  W 8 ] (@ i ( o ޘ { (  0  8  @  H  P  X  x    |h_   X `d  ( @$    8   H  (  8  D H  `  P8  7 |_  'X (Xd ( )( *8$  *xH ? *4 S +(@ i +X  +D  ,P@  ,(  ,T  -X@  -(  -` 5 .h\ H .H Y /@H p 0 v /           1h  (  00  `  h0  6       (  8   ;h  <@ 0 =L 0 C@X) HA H G hN U  \ Hc kP{    ( 8|<_  uX vPd v w( x0$  @ H P X0 {P0  | _  @X d 0 P( $  1| `_   `H ? 4 S @ i hX  D  8@  (  T  @@  (  h  @" 7 K xc $p XT L 0P ( l `@  x@ ' x8|=_ C hB P X`   q   ~ 8  x   |]0_  X 8d  ( ` | (4 x@/ PP 8@i @ @ @L h (p X  h p7 (XV @r @ HL L L @ @ 0@) ˆ(= TU 8lu L (( hL d PL  Ÿd1 8LM ƠLi x ǘ HP Ȱ` (T ɘT ` ʀ`3 `I p`C hB hP `X` b иT (p x 8 H8   ې % p  0| _ C hB (P  X`  xt    |]P_  H  X d  0( p h! p @6 8L| _ 8 ` h| 4 P@/ PP @i h@ @ L h p X h xp7 XV p@r @  L L L X@ @ @) `(= TU lu L ( @L d (L  d1  LM  xLa  \f  XD  Tl  (Lq  |  H (` h    < h$ ( T- XTA TY 8j `4~ $   %, ', (H, ),  *@! -07 .K /x\ 0p 1Xd 1 4 5 5 6 8x+ 9pP ;xl <`|f`_ | _ | _ C BhB C(P D X` E Gxt H    H| _  08 h p| _  S(x x     | _    | _ C XhB Y P ZX` [& ,   2   8 >  D  J 0(P X(V 0\ 0b 8h @n X  pp t  p  z @| _ x|nh _  ehX ed fX gx(C ghB h8P i0X` j l p0 ` ( 8| _  tPX td u@ v`(C vhB w P xX` y P X| _ C {hB |pP }hX` ~ p | _  hX d X x(a \f 0D Tl L h| _ | _ &| _ 5|oh_ C XhB P X` @J ? \ E|op_ C PhB P X` 8  P V  |o_ \ hi n s   oo  & | @_ | D_ D| _  X d  (| _  X\| _ |oH_ C 8hB P X`   F ! T4 (: 0 P P0 0@ (F  L  R X  ^ @0d p(j .q| _ {| _ | _ | X_  ݰpC hB `P XX`   | _ |o`_  pX d ` (C hB @P 8X`  x`   t   ! 0T4| _ < LG PT hPc (p 8 `0 d (l l 8 d (    t8 `L ( c +Xv H -X *0 .P < ?D ; =h ?xT( BHt: BM C ` Dv E J N ShL U V W  X # Yt 3 ]H C ]p T d| g _  f  a8  cX  |p  n  mT  xH  ! !  X!* x\!0 ,!8 !F ![ H!b P!i 8!x 0!  ! ``!  ! P(! ! 0! p4! ! 8! hT" X"  p" " "" (") "@ p"O "f "y `H"  " (8" " (" @ " " " " " " հ#  8 H# P#0 א0#= p#J 8#T  #c x#s #z # x# # # l# 0# <# h$$ $  $ $ $  $% ($, 0$3 8$: @$A H$H $[ |$j ${ P $ p$ ($  $ $$ $ /l$ 6$ *$ 8%  Ax% <%! l%/ I@(%D OPd%V .p\%q %y o88% t% % i% kh% nH% 5p4& 7& =&& $&> &P &X ?&g&o Fh& GP& PD& K& hx& X& N8& S0x' ^'' cx'9 T0'O H'f ]0' Y' pD' x ' xX' z' ' ' (   ( h(3 (L  @(_ (| 8(  ,( \(|q_ C ˜hB P X` ŀ( J ( x\( P^ (  ( 0  8  P( h  p t ( ˜  ¨( ) ) )    )  ) (  8) H)% `  x  È à )+ )1 )7 )= )C )I 0)O @)U P)[ `)a H)n| _ )w H) `) )|qx_ t) p x ) Ę()  | _ )| _ )| _  X d p ()| _ )| _ *| _ *| _ *|q_ *% **q */| _ a \f 8D Tl L*< *A p ' L *T *] *f *o *x * * *  * 0* 8* @*| _ *| _ H ' H*T X*] h*| _ x* * x*| _ a g\f hhD hTl i8L*++`+&+4 +R 8+_+~+ ֠+ + `+ WH+ b4,@+ pX,  p, \, 4,+ ,>,F I,R ,X,i,q0, , `, W`(, 0, @,,ox, `--) @,-4 00,-Eq-P -]@-d X8`-l`P-- M- [ - %-"  8. q ..: 1x0.O s.aP.~@.@.  p.. H.\. lP8.` d( &t/ P/   P8/  T/4/R @/] D/s///  /r// /0 05 40F=0 0n b8H0 ?H0 !# i0 t?0 D0@0@0<11 X1 mw {pd1, 1'121:q1L 1_ X1l1 ,1 8@1@1r01o8122h2+2J 2Q`2Z2a `2r@2"`202  L  mp22 x2<3 d3$`3+ P3:q3B <3L3R3a3߀3]83ڠ3 3 03 3op3X4 X4 (8484U `4` 4j 4p  |4 44 OH4X4]P4r,4 w  55  5"  5G 5y q055q5 `t5  5  T5 o5q586!ۀ6&626e `D6y6 66  6 \6܀6 0P6 h4-* 7@7#797N PT7`r 7v ?h$7~ ͸$7 b877x7785  Hh8BD8P`8`8m  D8} t 8 S0888`8  888ڀ88 T88 x/9 &H9X. 9; h9P k\9b 89k ux9p9} \9 9 9 T9`6 9 X9q9p: P:  :5 P3:D Pq:f@9 :o TX:x yL5 Zp: ]p: -,ߠ:: h:H: ո; ; ;-;O  ;uހ;|;;  ;f`;qd;< ۠<`<"݀<(@ r>fP>3 y >A >Iq>e 8t>w >`> 1 > D>(>? j(?) `?= pd<?R x?^ @?o?{ a?  =?? @@?@? ې? @q@  8\ QL@( .4@: >P@@@c @j @@r@} X 8@@@  c@ @@@`AHA HXA)  DA<@AD 4APAWqxA{A A A(A xA >XA >ABo83 AHBhXB9 hBF  Bk  PBz  X8A;{:`BdBqBqB`B B ?; BCp6 {pxC @< C( C8CBHCMhCe Ct (C xCePC CC C BDqDD*D5 8@8@1D=DWHDfDtD{qD 8`DXDD D DXD ptE`E+ @dE xpTE,E3EI 4ES ܠ?@Ek EE Pd( p/_ 0DE d8`Enh.E XEF  h4iݠE F x4F)F^pFy =P,`F=F dF  F ԨF F+G  G]0G:PGJ jGV Hh8 |Gh 81r8GsGG  G i@G@qG  8E `G=G K`\GPH=H!H) p8=Dm hHG  HR hH]LHo H@H @H H= H(I  IXI4 I;8XI^ Id`I.I PIILI PPI xsum4crti.scrt1.s__get_exit_frame_monitor_ptr__do_exit_code_ptr__crt_scratchvalues-Xa.cDrodata.rodatavalues-xpg6.cBbss.bssDdata.datam4.cDpicdata.picdataxnmallocxnreallocx2nreallocxcharallocto_ucharignore_valueignore_ptr.L194.L208fault_handler.L228.L234.L236.L238.L240.L241.L243.L245.L247.L249.L251.L253.L255.L257.L259usage.L302.L307.L321process_file.L348.L355.L356.L390.L405.L410.L413.L415.L496.L504.L530.L531.L532.L533.L556.L641.L647builtin.cm4___file__m4___line__m4___program__m4_builtinm4_changecomm4_changequotem4_debugmodem4_debugfilem4_decrm4_definem4_defnm4_divertm4_divnumm4_dnlm4_dumpdefm4_errprintm4_esyscmdm4_evalm4_formatm4_ifdefm4_ifelsem4_includem4_incrm4_indexm4_indirm4_lenm4_m4exitm4_m4wrapm4_maketempm4_mkstempm4_patsubstm4_popdefm4_pushdefm4_regexpm4_shiftm4_sincludem4_substrm4_syscmdm4_sysvalm4_traceoffm4_traceonm4_translitm4_undefinem4_undivertfree_pattern_buffer.L270.L295.L324.L367.L383.L421.L503.L519bad_argc.L542.L557.L568.L578numeric_argshipout_intdump_args.L737.L741.L756.L757.L773.L777.L793.L800define_macro.L845.L888.L914.L925.L938.L1003.L1007.L1014.L1032dump_symboldumpdef_cmp.L1132.L1170.L1199.L1220.L1238.L1254.L1264.L1304.L1313.L1321.L1346.L1387.L1396.L1430.L1473.L1510.L1514.L1524.L1528.L1542.L1567.L1570.L1592.L1593.L1604.L1605.L1620.L1640.L1641.L1663.L1677.L1743.L1751.L1818.L1823.L1838.L1842.L1854.L1867.L1871.L1882.L1889.L1899.L2022.L2052.L2084.L2139.L2147.L2163.L2172.L2186.L2190.L2198.L2202.L2253.L2323.L2337.L2341.L2415.L2426mkstemp_helper.L2482.L2485.L2554.L2558.L2562.L2586.L2590.L2594.L2613.L2626.L2722.L2737.L2788.L2795set_trace.L2862.L2872.L2959.L2964.L2972.L2977.L2988.L2998.L3002.L3024.L3069.L3073.L3077.L3103.L3135.L3140.L3171.L3178.L3189.L3196.L3209.L3241expand_ranges.L3366.L3371.L3400.L3414.L3505.L3549.L3654.L3682.L3703substitute.L3783.L3800.L3853.L3860.L3877.L3943.L3979debug.cdebug_set_file.L370.L403.L412.L478.L485.L493.L524trace_format.L543.L570.L577trace_header.L611trace_flush.L633.L646.L655.L670.L681.L692.L698.L703.L716.L727.L749.L752.L754.L765eval.ceval_init_lexeval_undoeval_lex.L615.L619.L623.L627.L631.L636.L640.L644.L648logical_or_termlogical_and_termxor_termequality_term.L1038cmp_term.L1127shift_termadd_termmult_term.L1419exp_termunary_termsimple_termformat.c.L130.L143.L153.L165arg_intarg_longarg_double.L_cseg0.L290.L572.L662freeze.creverse_symbol_list.L151.L159.L166.L168.L173.L175.L180.L191.L193.L198.L230.L244.L250.L280.L287.L305.L310issue_expect_message.L330.L520.L671.L986.L1229input.c.L154.L402.L425.L444.L466pop_input.L558init_macro_token.L625peek_input.L659.L734next_char_1.L788match_input.L910.L934.L937.L940.L943.L1002.L1155.L1312.L1363macro.cexpand_token.L195expand_macro.L301.L322expand_argumentcollect_arguments.L433.L461output.cgl_oset_nx_create_empty_inlinegl_oset_size_inlinegl_oset_search_inlinegl_oset_search_atleast_inlinegl_oset_nx_add_inlinegl_oset_remove_inlinegl_oset_free_inlinegl_oset_iterator_inlinegl_oset_iterator_next_inlinegl_oset_iterator_free_inlinegl_oset_create_empty_inlinegl_oset_add_inlinecmp_diversion_CBthreshold_diversion_CB.L309cleanup_tmpfile.L357.L377.L378.L381m4_tmpname.L399.L406.L416.L435m4_tmpfile.L463.L495.L511m4_tmpopenm4_tmpclosem4_tmpremove.L668m4_tmprename.L849make_room_foroutput_character_helper.L972.L1572.L1582.L1770.L1820insert_diversion_helper.L2045.L2057.L2068.L2072.L2094path.c.L200.L265m4_fopen.L363symtab.cstring_hash.L379gl_avltree_oset.crebalancegl_tree_nx_add_firstgl_tree_nx_add_beforegl_tree_nx_add_aftergl_tree_remove_nodegl_tree_nx_create_emptygl_tree_sizegl_tree_searchgl_tree_search_atleastgl_tree_search_nodegl_tree_nx_addgl_tree_removegl_tree_oset_freegl_tree_iteratorgl_tree_iterator_nextgl_tree_iterator_freegl_avltree_oset_check_invariantsc-stack.cnpgettext_auxdcpgettext_exprdcnpgettext_expr.L190xalloc_dienull_actionfind_stack_directionsegv_handler.L296.L298clean-temp.cgl_list_nx_create_empty_inlinegl_list_nx_create_inlinegl_list_size_inlinegl_list_node_value_inlinegl_list_node_nx_set_value_inlinegl_list_next_node_inlinegl_list_previous_node_inlinegl_list_get_at_inlinegl_list_nx_set_at_inlinegl_list_search_inlinegl_list_search_from_inlinegl_list_search_from_to_inlinegl_list_indexof_inlinegl_list_indexof_from_inlinegl_list_indexof_from_to_inlinegl_list_nx_add_first_inlinegl_list_nx_add_last_inlinegl_list_nx_add_before_inlinegl_list_nx_add_after_inlinegl_list_nx_add_at_inlinegl_list_remove_node_inlinegl_list_remove_at_inlinegl_list_remove_inlinegl_list_free_inlinegl_list_iterator_inlinegl_list_iterator_from_to_inlinegl_list_iterator_next_inlinegl_list_iterator_free_inlinegl_sortedlist_search_inlinegl_sortedlist_search_from_to_inlinegl_sortedlist_indexof_inlinegl_sortedlist_indexof_from_to_inlinegl_sortedlist_nx_add_inlinegl_sortedlist_remove_inlinegl_list_create_empty_inlinegl_list_create_inlinegl_list_node_set_value_inlinegl_list_set_at_inlinegl_list_add_first_inlinegl_list_add_last_inlinegl_list_add_before_inlinegl_list_add_after_inlinegl_list_add_at_inlinegl_sortedlist_add_inlinestring_equalscleanup.L1021.L1048.L1160do_unlink.L1184do_rmdirunregister_fdexecute.cnonintr_closenonintr_open.L292fatal-signal.cget_handlerinit_fatal_signalsuninstall_handlersfatal_signal_handlerinit_fatal_signal_setgl_linkedhash_list.cxsumxsum3xmaxnext_primehash_resizehash_resize_after_addadd_to_bucketremove_from_bucketgl_linked_nx_create_emptygl_linked_nx_creategl_linked_sizegl_linked_node_valuegl_linked_node_nx_set_valuegl_linked_next_nodegl_linked_previous_nodegl_linked_get_atgl_linked_nx_set_atgl_linked_search_from_togl_linked_indexof_from_togl_linked_nx_add_firstgl_linked_nx_add_lastgl_linked_nx_add_beforegl_linked_nx_add_aftergl_linked_nx_add_atgl_linked_remove_nodegl_linked_remove_atgl_linked_removegl_linked_list_freegl_linked_iteratorgl_linked_iterator_from_togl_linked_iterator_nextgl_linked_iterator_freegl_linked_sortedlist_searchgl_linked_sortedlist_search_from_togl_linked_sortedlist_indexofgl_linked_sortedlist_indexof_from_togl_linked_sortedlist_nx_addgl_linked_sortedlist_removemalloca.cmemchr2.cpipe.c.L220.L279.L335create_pipeprogname.c.L25.L39.L47tmpdir.cdirexists.L41.L67.L104.L114.L161verror.c.L54version-etc.c.L171.L176.L182.L197.L201.L205.L209.L213.L217.L221.L225.L229.L304.L308.L311version-etc-fsf.cwait-process.ccleanup_slavesunregister_slave_subprocess.L459xalloc-die.c.L261.L262xprintf.c.L186xvasprintf.cxstrcatxasprintf.ccloexec.cclose-stream.cclosein.c.L216closeout.c.L202.L207flush_stdout.L55.L59print_errno_messageerror_tail.L111.L133.L132.L162.L169exitfail.cfcntl.c.L29filenamecat.cfilenamecat-lgpl.clongest_relative_suffixfopen-safer.cgetopt.cexchange_getopt_initialize.L419.L600.L695.L759.L766.L774.L810.L855.L960.L1000getopt1.cmkdtemp.cmkstemp-safer.cobstack.cprint_and_abort.L508.L509pipe-safer.cquotearg.cquoting_options_from_stylegettext_quote.L470.L472quotearg_buffer_restyledquotearg_n_optionsregex.cbitset_setbitset_clearbitset_containbitset_emptybitset_set_allbitset_copybitset_notbitset_mergebitset_maskre_string_char_size_atre_string_wchar_atre_string_elem_size_atre_string_allocatere_string_construct_commonre_string_realloc_buffersre_string_constructbuild_wcs_upper_bufferbuild_upper_bufferbuild_wcs_bufferre_string_translate_bufferre_string_skip_charsre_string_reconstructre_string_context_atre_string_peek_byte_casere_string_fetch_byte_casere_string_destructre_node_set_allocre_node_set_init_1re_node_set_init_2re_node_set_init_copyre_node_set_add_intersectre_node_set_init_unionre_node_set_mergere_node_set_insertre_node_set_insert_lastre_node_set_comparere_node_set_containsre_node_set_remove_atre_dfa_add_nodecalc_state_hashre_acquire_statecreate_ci_newstatere_acquire_state_contextcreate_cd_newstateregister_statefree_statere_compile_internalre_compile_fastmap_iterre_set_fastmapfree_dfa_contentfree_tokeninit_dfafree_workarea_compileprintf_parseanalyzeoptimize_utf8create_initial_state.L4133.L4135init_word_charpreorderoptimize_subexpspostorderlower_subexpscalc_firstcalc_nextlink_nfa_nodescalc_eclosurecalc_inveclosurelower_subexpcreate_tree.L5160.L5161.L5196.L5202.L5228duplicate_node_closureduplicate_nodesearch_duplicated_nodecalc_eclosure_iterfetch_tokenpeek_tokenpeek_token_bracketparse_reg_expparse_branchparse_expression.L6906.L6907.L6921.L6922create_token_treeparse_sub_expparse_bracket_expbuild_charclass_opparse_dup_opfetch_numberfree_treeduplicate_treemark_opt_subexp.L7366build_range_expbuild_collating_symbol.L7768parse_bracket_elementbuild_equiv_classbuild_charclassfree_charsetparse_bracket_symbol.L8111.L8113.L8117.L8206.L8451.L8513.L8636.L8698.L8760.L8822re_search_internalre_search_stubre_search_2_stub.L9662.L9663re_copy_regs.L9779.L9785.L9862match_ctx_initcheck_matchingcheck_halt_state_contextprune_impossible_nodesmatch_ctx_cleanset_regsmatch_ctx_freesift_ctx_initsift_states_backwardmerge_state_arrayacquire_init_state_context.L10709check_subexp_matching_toptransit_state_bkrefextend_bufferstransit_statemerge_state_with_logfind_recover_statecheck_halt_node_contextproceed_next_nodepush_fail_stackcheck_node_accept_bytescheck_node_accept.L11285pop_fail_stack.L11303free_fail_stack_returnupdate_regsupdate_cur_sifted_statebuild_sifted_statessift_states_iter_mbcheck_dst_limitsclean_state_log_if_neededadd_epsilon_src_nodescheck_subexp_limitssift_states_bkrefsub_epsilon_src_nodessearch_cur_bkref_entrycheck_dst_limits_calc_poscheck_dst_limits_calc_pos_1transit_state_mbbuild_trtablematch_ctx_add_subtopget_subexpget_subexp_subfind_subexp_nodecheck_arrivalmatch_ctx_add_sublastmatch_ctx_add_entrycheck_arrival_expand_eclexpand_bkref_cachecheck_arrival_add_next_nodescheck_arrival_expand_ecl_subgroup_nodes_into_DFAstates.L15612strsignal.c.L204debug_initgetbuffer.L266.L273.L294.L315.L329.L336.L343.L350.L364.L371.L385.L392.L420.L427.L434.L441.L448.L455.L462.L469.L476free_key_memstrstr.ccritical_factorizationtwo_way_short_needletwo_way_long_needletempname.c.L28.L106.L107wcrtomb.cxmalloc.cfreadahead.cbasename-lgpl.cdup-safer.cfd-safer.cmbrtowc.c.L26.L32vasnprintf.c.L66decimal_point_char.L_cseg1.L_cseg2.L_cseg3.L_cseg4.L_cseg5.L_cseg6.L_cseg7.L_cseg8.L_cseg9.L_cseg10.L_cseg11printf-frexp.cprintf-frexpl.cprintf-args.c.L81.L93printf-parse.ccrtn.s_END__START_xrealloc_sysconf_sys_siglistp__1cG__CrunMdo_exit_code6F_v_quotearg_mem$XAoAMiKaDTUMkQ1.actions_count$XAoAMiKxDTUMUP5.output_diversionobstack_free$XBoAMiKpDTUMEQ4.link_nfa_nodes.__func__xfprintfverrorversion_etc_varpl_getoptrpl_re_searchquotearg_nexpand_user_macroquotearg_alloc_mem_Qp_negoutput_textbtowc__fsr_init_value_Qp_mul$XBoAMiKxDTUMUP5.m4_tmpname.tailiswlowermfile_name_concatverror_at_linexvprintffreadaheadqsort$XAoAMiKjDTUMUJ3.ignore_EPIPEhack_all_symbols$XBoAMiKrDTUM0e4.rpl_strsignal.oncexvasprintfdebug_set_outputrpl_optargbuiltin_initstrchrxstrdupgl_avltree_oset_implementationposix_spawn_file_actions_destroy$XBoAMiKpDTUMEQ4.pop_fail_stack.__func__printf_frexpl$XAoAMiKuDTUME74.digitssigaltstackinsert_diversion$XAoAMiKxDTUMUP5.tmp_file2_recentdebug_message_prefixfreeze_diversions$XAoAMiKuDTUME74.builtin_tabraise_Qp_fltproduce_frozen_statexvfprintf_obstack_memory_usedsuppress_warningsrpl_re_compile_fastmap$XAoAMiKoDTUMkK4.slotveccall_macroquotearg_colon_memcleanup_temp_subdir$XAoAMiKwDTUM0J5.wrapup_stackrpl_strstrunblock_fatal_signals$XAoAMiKxDTUMUP5.free_listdebug$XAoAMiKuDTUME74.sysval$XBoAMiKxDTUMUP5.make_diversion.__func__rquoteexpansion_level_finigl_linkedhash_list_implementation$XAoAMiKxDTUMUP5.output_temp_dir_obstack_begin_1$XAoAMiKZDTUMkF1.alternate_signal_stackprintf_fetchargstrace_pre$XAoAMiKtDTUMU44.program_error_message$XAoAMiKrDTUMUl4.lettersquotearg_alloctowupperwctomb$XAoAMiKxDTUMES5.dir_list_end_Qp_addxprintfm4_errormbsinitstrerror_r_Qp_subcurrent_diversionset_custom_quotingexpand_input$XAoAMiKaDTUMkQ1.fatal_signalspush_macro$XAoAMiKbDTUMUf1.primesfcloseerror_print_progname$XAoAMiKoDTUMkK4.default_quoting_options__assert_c99$XAoAMiKxDTUMUP5.output_unusedsync_output$XAoAMiKxDTUMUP5.output_cursorsetbuf_Qp_itoqstrtodcleanup_temp_direxit_failure_get_exit_frame_monitor$XBoAMiKgDTUMEd2.register_slave_subprocess.cleanup_slaves_registeredrpl_regexecstrtolfree_symbol$XAoAMiKxDTUMES5.dir_listquotearg_n_memstrcmpcreate_pipe_in__xargvx2reallocerrno__environ_lock$XAoAMiKxDTUMUP5.tmp_file1_ownerstrrchr$XAoAMiKZDTUMEJ1.cleanup_listoutput_exit_etextcleanup_temp_dir_contentslookup_symbol$XAoAMiKjDTUMUJ3.file_nameprefix_all_builtinsset_commentclose_stdin_set_file_name$XAoAMiKxDTUMUP5.output_filepop_wrapupbase_lenferrorquotearg_n_style_memlstat__iobcreate_pipe_bidi$XAoAMiKwDTUMkM5.argv_stack$XAoAMiKaDTUMkQ1.saved_sigactionserror_one_per_linerpl_regerrorprintf_frexpfind_builtin_by_addr$XBoAMiKxDTUMUP5.m4_tmpname.__func__$XBoAMiKxDTUMUP5.insert_diversion_helper.__func__wait_subprocessiswalnum__xargc_getopt_long_r$XBoAMiKuDTUME74.m4_esyscmd.__func__quotearg_n_customm4_error_at_linelquote$XAoAMiKgDTUMEd2.slaves_allocatedrpl_regfreenl_langinfo$XBoAMiKxDTUMUP5.shipout_text.start_of_output_linefree_macro_sequence$XAoAMiKwDTUM0J5.current_inputfopen_temptowlower$XAoAMiKpDTUMEQ4.utf8_sb_mapset_macro_sequencestrcpyquotearg_custom_memmkstemp_safer$XAoAMiKtDTUMU44.long_options_GLOBAL_OFFSET_TABLE_$XAoAMiKwDTUM0J5.ispcleanup_temp_filerpl_re_syntax_optionsmemchr2_obstack_beginversion_etc_ar$XAoAMiKxDTUMUP5.tmp_file2_owner$XAoAMiKvDTUMkA5.last_text$XAoAMiKaDTUMkQ1.actions$XBoAMiKaDTUMkQ1.init_fatal_signal_set.fatal_signal_set_initializedrpl_re_matchnesting_limitdebug_levelset_program_namequotearg_customrpl_regcompm4_path_searchputc_unlocked_edataungetcclose_stdout_set_file_nameiswprintatexitposix_spawnpxasprintfmkdirversion_etc_copyrightdebug_decode$XAoAMiKwDTUM0J5.file_namesrpl_getopt_long_onlyrpl_re_set_syntaxfd_safermaingettimeofdayquotearg_freesigaddset$XBoAMiKpDTUMEQ4.parse_bracket_exp.__func__init_pattern_buffermemmovefclose_tempecomm$XAoAMiKoDTUMkK4.slot0mkdtemp$XBoAMiKrDTUMUl4.gen_tempname.__func__m4_placeholder$XAoAMiKpDTUMEQ4.__re_error_msgid_Qp_qtoievaluateadd_include_directoryversion_etc_arnrpl_mbrtowc$XAoAMiKwDTUM0J5.wspfopen_safer$XAoAMiKuDTUME74.predefined_tab_obstack_allocated_psymtab_init$XAoAMiKxDTUMUP5.diversion_tableposix_spawn_file_actions_addclose$XBoAMiKuDTUME74.m4_translit.__func__lseekfputc_PROCEDURE_LINKAGE_TABLE_quotearg_char_mem$XAoAMiKcDTUMku1.mmalloca_results$XAoAMiKrDTUM0e4.local_buf$XAoAMiKuDTUME74.substitute_warnedsigemptysetiswctypefread$XAoAMiKuDTUME74.macro_sequence_bufreload_frozen_statequotearg_colon$XAoAMiKwDTUM0J5.start_of_input_linetoupper$XAoAMiKjDTUMkG3.file_name$XBoAMiKaDTUMkQ1.init_fatal_signals.fatal_signals_initializedxcallocfputssymtab$XAoAMiKuDTUME74.macro_sequence_inusequoteargquotearg_n_styleclone_quoting_options$XBoAMiKpDTUMEQ4.re_search_stub.__func____xpg4__xpg6retcodegetpid_environfseekofwriteposix_spawn_file_actions_addopenrpl_re_set_registersset_cloexec_flagundivert_all$XAoAMiKaDTUMkQ1.fatal_signal_setexpand_formatexecute$XAoAMiKrDTUM0e4.static_bufset_quoting_flagsclose_stdoutposix_spawnattr_init$XBoAMiKpDTUMEQ4.re_copy_regs.__func__rpl_getopt_internal$XAoAMiKtDTUMU44.signal_message$XAoAMiKwDTUM0J5.input_changerpl_re_compile_patternset_quoting_styleunregister_temp_subdirrpl_wcrtombset_char_quotingsigprocmaskmake_diversion$XBoAMiKuDTUME74.m4_syscmd.__func__fstatoutput_init$XAoAMiKtDTUMU44.fatal_warningsskip_lineposix_spawn_file_actions_initoutput_current_linepush_wrapupdebug_flush_filesfreea$XAoAMiKaDTUMkQ1.actions_allocatedmemchrxmemdupstrcasecmppush_file$XAoAMiKxDTUMUP5.tmp_file1$XAoAMiKxDTUMUP5.tmp_file2vasnprintf$XAoAMiKgDTUMEd2.slaves_count_Qp_fgttolower__align_cpy_8quoting_style_args_obstack_newchunkquotearg_style_memwcscolldup_cloexecfflush$XBoAMiKrDTUMUl4.gen_tempname.valuestrlenfdopenrpl_fcntl$XBoAMiKxDTUMUP5.m4_tmpname.bufferclose_stdintrace_prepre$XBoAMiKpDTUMEQ4.check_matching.__func___Qp_feq$XAoAMiKmDTUMEu3.getopt_data$XAoAMiKwDTUMkM5.argc_stackgen_tempname$XBoAMiKwDTUM0J5.next_token.__func__rpl_re_match_2quotearg_stylemax_debug_argument_length$XAoAMiKrDTUM0e4.keybcommposix_spawn_file_actions_adddup2close_stream_temp_lib_version_Qp_fge$XAoAMiKoDTUMkK4.slotvec0waitpidquotearg_buffersigactionrpl_optind$XAoAMiKoDTUMkK4.nslotsdefine_builtinclose_streaminclude_env_init$XAoAMiKaDTUMkQ1.static_actionspush_string_init$XAoAMiKxDTUMUP5.total_buffer_size_getopt_internal_rtrace_postcurrent_fileposix_spawnattr_setflags__fpendingxzalloc$XBoAMiKuDTUME74.ntoa.strwarning_statusmemcmprpl_strsignalerror_message_countset_quotesobstack_alloc_failed_handler__ctype_mask___Argvdefine_user_macro$XAoAMiKwDTUM0J5.token_stack_getopt_long_only_rfileno_DYNAMICinclude_init__dtou$XAoAMiKxDTUMUP5.div0dup_saferposix_spawnattr_destroy$XAoAMiKpDTUMEQ4.__re_error_msgid_idx$XAoAMiKwDTUM0J5.nextunregister_temp_fileversion_etc$XAoAMiKgDTUMEd2.static_slavesxmallocposix_spawnattr_setsigmaskrpl_getopt_longc_stack_action$XBoAMiKaDTUMkQ1.at_fatal_signal.cleanup_initialized$XAoAMiKvDTUMkA5.eval_textmmalloca$XAoAMiKxDTUMES5.dir_max_lengthemit_bug_reporting_addressquoting_style_valscreate_temp_dirkill$XAoAMiKuDTUME74.macro_sequence_regspush_string_finish$XAoAMiKZDTUMEJ1.descriptorshash_table_sizeinsert_fileget_quoting_stylepipe_safer$XAoAMiKwDTUMkM5.macro_call_idmemcpyrpl_re_search_2_startwcslenquotearg_char$XAoAMiKZDTUMkF1.program_error_messageshipout_textrpl_optopt$XAoAMiKZDTUMkF1.segv_actionstrncmpclose_stdout_set_ignore_EPIPEnext_tokeninput_initno_gnu_extensionsfind_builtin_by_name$XBoAMiKxDTUMUP5.insert_file.bufferat_fatal_signallast_component$XAoAMiKZDTUMkF1.stack_overflow_message$XAoAMiKgDTUMEd2.slavesquotearg_n_custom_mem$XAoAMiKuDTUM094.tracememset$XAoAMiKxDTUMUP5.diversion_storageldexp$XAoAMiKwDTUM0J5.token_bottomgetenvcreate_pipe_out__ctyperpl_opterrntoa_Qp_fneanotate anotate i ijX (0"j@#jD$jLanotatex p 0vxwowo0vxw owoanotate  pPtp\PP@@pPppXPP@@ ` p8pPѠhX8p( @Xp x @0hH0`xP 08PhX`̨Panotate8 0 &H&Danotate anotate anotate anotate P0P,anotatex p 0"|0"xanotate P6/@h.@e/@q/@P6/@d.@e/@q/@anotate anotate anotate `xhpXx`xanotateX P t panotate PLиX(אиל(PHиT(׌иט(anotate anotate8 0 \pXpanotate  hX8` %'(H )(*0-08.@/H0P1XX1`4h5p5x68x9p;x<`anotate anotate anotate anotate anotate anotate anotateX P mlml mlmlanotate anotate anotate anotate anotate anotate anotate anotate anotate anotate anotate  Xݰanotate anotate anotate p `Pڸp \P ڴanotate anotate anotate anotate anotate anotate anotate anotate anotate anotate @(#)SunOS 5.10 Generic January 2005@(#)assert.h 1.10 04/05/18 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdbool.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)assert.h 1.10 04/05/18 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdbool.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)assert.h 1.10 04/05/18 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdbool.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)assert.h 1.10 04/05/18 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdbool.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)assert.h 1.10 04/05/18 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdbool.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)assert.h 1.10 04/05/18 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdbool.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)assert.h 1.10 04/05/18 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdbool.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)assert.h 1.10 04/05/18 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdbool.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)assert.h 1.10 04/05/18 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdbool.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)assert.h 1.10 04/05/18 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdbool.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)assert.h 1.10 04/05/18 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdbool.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)stdbool.h 1.1 03/12/04 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)libintl.h 1.16 04/09/28 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)ucontext.h 1.22 04/09/28 SMI@(#)ucontext.h 1.31 03/12/18 SMI@(#)regset.h 1.29 07/09/06 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)stdbool.h 1.1 03/12/04 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)alloca.h 1.16 04/09/28 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)libintl.h 1.16 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)stdbool.h 1.1 03/12/04 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)libintl.h 1.16 04/09/28 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)spawn.h 1.1 03/12/06 SMI@(#)sched.h 1.10 03/03/06 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)stdbool.h 1.1 03/12/04 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)stdbool.h 1.1 03/12/04 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)alloca.h 1.16 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)stdbool.h 1.1 03/12/04 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)libintl.h 1.16 04/09/28 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)spawn.h 1.1 03/12/06 SMI@(#)sched.h 1.10 03/03/06 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)stdbool.h 1.1 03/12/04 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)libintl.h 1.16 04/09/28 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)stdbool.h 1.1 03/12/04 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)libintl.h 1.16 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)libintl.h 1.16 04/09/28 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)libintl.h 1.16 04/09/28 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)stdbool.h 1.1 03/12/04 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)stdbool.h 1.1 03/12/04 SMI@(#)stdio_ext.h 1.3 07/03/05 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)stdbool.h 1.1 03/12/04 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)libintl.h 1.16 04/09/28 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)stdbool.h 1.1 03/12/04 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)libintl.h 1.16 04/09/28 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stdbool.h 1.1 03/12/04 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)getopt.h 1.1 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)libintl.h 1.16 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)getopt.h 1.1 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)libintl.h 1.16 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)unistd.h 1.76 06/03/10 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdbool.h 1.1 03/12/04 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)libintl.h 1.16 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)limits.h 1.59 04/08/24 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)stdbool.h 1.1 03/12/04 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)langinfo.h 1.11 03/12/04 SMI@(#)nl_types.h 1.14 00/09/16 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)libintl.h 1.16 04/09/28 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)wctype.h 1.19 03/12/04 SMI@(#)wctype_iso.h 1.2 03/12/04 SMI@(#)wctype_c99.h 1.1 03/12/04 SMI@(#)alloca.h 1.16 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)signal.h 1.43 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)libintl.h 1.16 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdbool.h 1.1 03/12/04 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)getopt.h 1.1 04/03/29 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)stdbool.h 1.1 03/12/04 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wchar_c99.h 1.3 04/03/29 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)alloca.h 1.16 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stddef.h 1.18 04/09/28 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)libintl.h 1.16 04/09/28 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)float.h 1.22 04/09/28 SMI@(#)langinfo.h 1.11 03/12/04 SMI@(#)nl_types.h 1.14 00/09/16 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)float.h 1.22 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)float.h 1.22 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wchar_c99.h 1.3 04/03/29 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.77 09/06/02 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)wchar.h 1.37 03/12/04 SMI@(#)wchar_iso.h 1.8 04/09/28 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)wchar_c99.h 1.3 04/03/29 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)stdint.h 1.1 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)int_const.h 1.5 04/09/28 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)inttypes.h 1.4 04/04/29 SMI@(#)inttypes.h 1.3 03/12/04 SMI@(#)int_fmtio.h 1.6 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)getopt.h 1.1 04/03/29 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMIacomp: Sun C 5.10 SunOS_sparc 2009/06/03ld: Software Generation Utilities - Solaris Link Editors: 5.10-1.4977m4.c /var/tmp/m4-1.4.14/src /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -xc99=all -I../lib -I../lib -g -c m4.c -W0,-xp\$XAoAMiKtDTUMU44.Xa;g;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;G=$XAoAMiKtDTUMU44.;backend;raw;cd;DBG_GEN 5.2.7xnmalloc{jk8n{snzxszpD voidsunsigned longsize_txnreallock`kn{ {pxnpshDx2nreallockln{ {px pnpshnX kl l l` l l` l l` ll` ll`  DEFAULT_MXFASTDxcharallocmmnbZnxDcharZ to_ucharm@mPn ZchDunsigned charignore_value#mmni#|Dintignore_ptr$mmnN{p$xDsync_output* hdebug_level- `hash_table_size0 Pno_gnu_extensions3 Lprefix_all_builtins6 Xmax_debug_argument_length9 dsuppress_warnings< \_Boolfatal_warningsi? @warning_statusB Hnesting_limitE Dm4_error`mnnwstatus_|errnum_xformat_p{..._hargsa`D0Zw{va_listm4_error_at_linepoon^statusn|errnumnxgfilenplinenlyformato`{...oXargsqPD0Z^Zpfault_handleroqnsigno|Dusageqt8n status|DZ rpl_option name#has_arg#flag#val#$longlong_options @long_options process_fileEtXupn nameDx ttuh tuh tuhfull_namebPpfp QhDZ  __FILE __pad # FILE  mainmun argcl| argvlpactOnHhead&o@tail&pdefn&qoptcharrdefines&tinteractiveiuseen_fileivdebugfile8wfrozen_file_to_readJxfrozen_file_to_write\ymacro_sequencenz~ t d dnext&a~sym$b~ D   Pmacro_namebi~macro_valuebj~AD b   ;pid_t uid_t sigval Ksival_int#sival_ptr{# }__uid #__value #clock_t __utime }#__status#__stime }#   __kill K#__cld #ctid_t zoneid_t ( __pid #__pdata #__ctid # __zoneid#$bcaddr_t  __addr{#__trapno#__pc# __fd#__band#time_t timespec[tv_sec#tv_nsec#timestruc_tshort@(  S__faddr#__tstamp[#__syscallq#__nsysargZ#__faultZ#__sysargz# __mstate#`gl_int32_t __entityS# __pad #__proc-#__fault#__file#__prof#__rctlh#!siginfo si_signo#si_code#si_errno#si_pad# __data#"###{  _handler #_sigaction#unsigned<__sigbits#sigset_tsigaction sa_flags#_funcptr#sa_mask<#$macro_definitionnext#code#arg#Z%macro_definition Z/ZAZSZesymbol(XnextX#&traceda#&shadoweda#¯o_argsa#&blind_no_argsa#&deleteda#pending_expansions# nameb#data#wbool_bitfield'token_data_type TOKEN_VOID TOKEN_TEXT TOKEN_FUNCtextb#Z_obstack_chunkRlimitb#prev#contents#ptrdiff_t tempintR#tempptr{#(#{#"#{#obstackX9chunk_size#chunk#object_baseb#next_freeb#chunk_limitb# tempf#(alignment_mask#0chunkfun#8freefun#@extra_arg{#H&use_extra_arg#P&maybe_empty_object#P&alloc_failed#Ptoken_dataxtypey#u#Bx"#9##builtin_func u_t#func#Btoken_datawsymbolZ-)6?f0signal_messageH (Z)program_error_message  *emit_bug_reporting_address ZZ Z+version_etcp####(Zp+set_program_name#y"#,c_stack_action#--,__posix_sigwaitR##,sigemptyset#RO-O-,sigaction###"#"!# ,signal!Y##ZY+reload_frozen_state#bZ+produce_frozen_state#Zb,m4_path_search &##Z&+add_include_directorye#/*include_env_init*include_init*undivert_allZZ'symbol_lookup. SYMBOL_LOOKUP SYMBOL_INSERT SYMBOL_DELETE SYMBOL_PUSHDEF SYMBOL_POPDEF+define_user_macroi###*free_macro_sequenceZ+set_macro_sequence#*builtin_init*expand_inputZ,lookup_symbol$*##*symtab_init+make_diversiona#*output_exit*output_init.pop_wrapupiZ+push_file###i*input_initZ,debug_set_outputi2#Z2,debug_decodep#;*debug_initretcodeN r(Z,xasprintfb#-Z-,xfprintf 1##Z 1- :,xprintf t# CZ t,xstrdupb # },xrealloc{ #{#,xmalloc{!#*xalloc_dieZ!Z!'+verror_at_line!###!##!0#{Z!+error!###!*close_stdin off64_t ,ftello!" #!,fseeko"X###"X,fsetpos"##"a,fgetpos"##".tmpfile Z"Z",freopen #E#"### Z#EZ#W,fopen ###N##` off_t ,ftello####,fseeko$###$,fsetpos$P##$--",fgetpos$#$P#$YZ$,puts$#$Z$-$-,fputs%#$#$--b+setbuf%S#%#%#Z%S-%\Z%n-%w- ,freopen %#%e#%#%Z%-%Z%-%,fopen &/#%#%.tmpfile bZ&M$&_,rpl_getopt_long&##&D#&V#&h#,mkstemp&#b,mkstemp'#bunsigned long long'rlim64_trlimit64'zrlim_cur'(#rlim_max'(#';,getrlimit'##'z';',setrlimit'##'rlim_trlimit(Grlim_cur'#rlim_max'#( ,getrlimit(##(G( (,setrlimit(##(Z(-(-&D,strtol)"#(#(#+free)>#{+exit)Z#/)Z,atexit)#)]*abort,__posix_ttyname_r)##b#,__posix_getlogin_r*#b#,lockf*L###Z*L,truncate*#*U#,tell!*#s*ssize_t ,pwrite*+##*##*s,pread*+a##+##*,lseek!+##!#,ftruncate+##s+,write*,##+#Z,,truncate,V#,#,tell#,z#s,z,pwrite*,##,##*,pread*- ##+##*,lseek#-D####,lockf-{###,ftruncate-##+_exit-#Z-Z-,attropen.)#-#-#Z.),openat.t##.2#Z.t,creat.#.}#Z.,open.#.#Z.Z/,attropen/S#.#/#Z/S,openat/##/\#Z/,creat/#/#Z/,open0#/#Z0-0'dev_t ino_t mode_t nlink_t gid_t blksize_t blkcnt_t Z0stat1st_dev09#st_ino0I#st_mode0Y#st_nlink0j#st_uid #st_gid0|#st_rdev09# st_size##(st_atim[#0st_mtim[#@st_ctim[#Pst_blksize0#`st_blocks0#hst_fstype0#p0-1,lstat2=#00#2Z2=,fstatat2##2F#1#Z2-2-1,stat2#2#2,fstat3##1Z3Z3?stat644nst_dev09#st_ino0I#st_mode0Y#st_nlink0j#st_uid #st_gid0|#st_rdev09# st_size##(st_atim[#0st_mtim[#@st_ctim[#Pst_blksize0#`st_blocks0#hst_fstype3"#p3?,fstatat4##3#4n#Z4-4-4n,lstat5 #4#4Z5 -5-4n,stat5\#5#5&,fstat5##4n,rpl_strsignalb5#Z5,strchrb5#5#Z5,strlen60#6Z60Z6B,strcmp6#69#6K6,__posix_ctime_rb6#6#btm$7tm_sec#tm_min#tm_hour#tm_mday# tm_mon#tm_year#tm_wday#tm_yday#tm_isdst# 67-7-b0__posix_asctime_rb#7#7_builtin.c /var/tmp/m4-1.4.14/src /opt/sunstudio12.1/prod/bin/cc -xtarget=ultra -m64 -xcode=pic32 -xc99=all -I../lib -I../lib -g -c builtin.c -W0,-xp\$XAoAMiKuDTUME74.Xa;g;P;R=Sun C 5.10 SunOS_sparc 2009/06/03;G=$XAoAMiKuDTUME74.;backend;raw;cd;DBG_GEN 5.2.7xnmalloc{n}nzxszpD void}unsigned longsize_txnreallocLnpxnpshDx2nreallocxpnpxpnpshnX D       DEFAULT_MXFASTDxcharallocnldnxDchard to_ucharn dchDunsigned chardunsignedbool_bitfieldlong3d3_obstack_chunklimitl#prev #contents#ptrdiff_ttempint#tempptr#int " obstackXtchunk_size#chunk #object_basel#next_freel#chunk_limitl# temp#(alignment_mask#0chunkfun#8freefun"#@extra_arg#Huse_extra_arg#Pmaybe_empty_object#Palloc_failed#P+token_data_type TOKEN_VOID TOKEN_TEXT TOKEN_FUNCtextl#u_t#func#token_dataItype}#u#ItR[builtin_funcbuiltin,name#gnu_extension#groks_macro_args#blind_if_no_args#func#builtin,>bbuiltin_tabG\ >P-builtin_tab\ dddpredefined Munix_name#gnu_name#func#predefined M b predefined_tab k  bH predefined_tab  find_builtin_by_addrn ^ Ufuncxbp phD, U, gfind_builtin_by_namen   namexbp hD, d , define_builtinln  namex bpp -modelsym U`A Dd , symbol_lookup - SYMBOL_LOOKUP SYMBOL_INSERT SYMBOL_DELETE SYMBOL_PUSHDEF SYMBOL_POPDEF symbol_lookupsymbol( &next &#traced#shadowed#macro_args#blind_no_args#deleted#pending_expansions# namel#data /# Etoken_data Esymbol Dfree_pattern_buffern [bufxregspD __re_long_size_treg_syntax_tre_pattern_buffer@[buffer #allocated #used #syntax #fastmapl# translate #(re_nsub#0can_be_null#8regs_allocated#8fastmap_accurate#8no_sub#8not_bol#8not_eol#8newline_anchor#8 __re_size_tregoff_tzre_registersnum_regsd#start#end#set_macro_sequence<nPYregexpxmsgkpDdPdb free_macro_sequence`nD define_user_macro$n- 6name#x Htext#p -mode#l!s U%`!defnl&X t  !offsetz2H!len3@ H       T T!tmpd=D$d-d? builtin_initTn!bpUx!ppVp!stringlWhAD, M bad_argcn name~x argc~t min~p max~l!isbadjD(_Bool / numeric_arg@$n% macrox .argp 7valueph!endplXD$d%d@d!digitsI @%$!digits "ntoaPnx value| radixx!negativeo!uvalueh!str !sl`D dxgl_int32_tgl_uint32_td#$shipout_intxn> tobsx valt!sGhD d>$dump_argsn tobsx argct  argvh sep` quoted_!iX!lenPD,d$define_macro! n argc |  argv p -mode l!bp"`D$,$m4_defineL8`n$ tobsKx argcKt  argvKhD$m4_undefineRln tobsQx argcQt  argvQh!iSdD$$m4_pushdef\n tobs[x argc[t  argv[hD$m4_popdefbn tobsax argcat  argvah!icdD$$m4_ifdefpn tobsox argcot  argvoh!s Uq`!result(rXD$d$m4_ifelse Dn tobsx argct  argvh!result`!meXD$d$dump_symbolpnI Usymx argp!datahAD  U%dump_symbol_dataobst#baseI#size#R dumpdef_cmpn s1x "s2pD }}$m4_dumpdef Dn tobsx argct  argvh!s U`!i\!dataR@!bpAD$,$m4_builtin(pn tobs'x argc't  argv'h!bp)`!name*X   !i<LAD$,d$m4_indirQtn tobsPx argcPt  argvPh!s UR`!nameSX 8t t t!ieLAD$d$m4_defnyn tobsxx argcxt  argvxh!s Uz`!b{X!i|TD$$m4_syscmd\n tobsx argct  argvh!cmd `!statusT!sig_statusP!prog_args !__func__  CD$d d  d  $m4_esyscmd4n" tobsx argct  argvh!cmd"`!prog_args"!child#!fd!pin#i!status!sig_status!__func__#{  H @ @!avail!len , < <!ch CD$d"d"" #pid_t#5__FILE #Z__pad###5FILE #Zd#r # $m4_sysval)Xn$ tobs'x argc't  argv(hD$$m4_eval5n$ tobs4x argc4t  argv4h!value6d!radix7`!min8\!s$9PD$d$$m4_incrwn%O tobsvx argcvt  argvvh!valuexdD$$m4_decrn% tobs